(data stored in ACNUC7421 zone)

EMBL: CP000444

ID   CP000444; SV 1; circular; genomic DNA; STD; PRO; 4792610 BP.
XX
AC   CP000444; AALI01000000-AALI01000153;
XX
PR   Project:PRJNA13903;
XX
DT   06-SEP-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Shewanella sp. MR-7, complete genome.
XX
KW   .
XX
OS   Shewanella sp. MR-7
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-4792610
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Nealson K.,
RA   Konstantinidis K., Klappenbach J., Tiedje J., Richardson P.;
RT   "Complete sequence of Chromosome1 of Shewanella sp. MR-7";
RL   Unpublished.
XX
RN   [2]
RP   1-4792610
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Nealson K.,
RA   Konstantinidis K., Klappenbach J., Tiedje J., Richardson P.;
RT   ;
RL   Submitted (22-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 38cb2cb1594447e280bff6538c0e54ce.
DR   BioSample; SAMN02598316.
DR   EnsemblGenomes-Gn; EBG00001436551.
DR   EnsemblGenomes-Gn; EBG00001436552.
DR   EnsemblGenomes-Gn; EBG00001436553.
DR   EnsemblGenomes-Gn; EBG00001436554.
DR   EnsemblGenomes-Gn; EBG00001436555.
DR   EnsemblGenomes-Gn; EBG00001436556.
DR   EnsemblGenomes-Gn; EBG00001436557.
DR   EnsemblGenomes-Gn; EBG00001436558.
DR   EnsemblGenomes-Gn; EBG00001436559.
DR   EnsemblGenomes-Gn; EBG00001436560.
DR   EnsemblGenomes-Gn; EBG00001436561.
DR   EnsemblGenomes-Gn; EBG00001436562.
DR   EnsemblGenomes-Gn; EBG00001436563.
DR   EnsemblGenomes-Gn; EBG00001436564.
DR   EnsemblGenomes-Gn; EBG00001436565.
DR   EnsemblGenomes-Gn; EBG00001436566.
DR   EnsemblGenomes-Gn; EBG00001436567.
DR   EnsemblGenomes-Gn; EBG00001436568.
DR   EnsemblGenomes-Gn; EBG00001436569.
DR   EnsemblGenomes-Gn; EBG00001436570.
DR   EnsemblGenomes-Gn; EBG00001436571.
DR   EnsemblGenomes-Gn; EBG00001436572.
DR   EnsemblGenomes-Gn; EBG00001436573.
DR   EnsemblGenomes-Gn; EBG00001436574.
DR   EnsemblGenomes-Gn; EBG00001436575.
DR   EnsemblGenomes-Gn; EBG00001436576.
DR   EnsemblGenomes-Gn; EBG00001436577.
DR   EnsemblGenomes-Gn; EBG00001436578.
DR   EnsemblGenomes-Gn; EBG00001436579.
DR   EnsemblGenomes-Gn; EBG00001436580.
DR   EnsemblGenomes-Gn; EBG00001436581.
DR   EnsemblGenomes-Gn; EBG00001436582.
DR   EnsemblGenomes-Gn; EBG00001436583.
DR   EnsemblGenomes-Gn; EBG00001436584.
DR   EnsemblGenomes-Gn; EBG00001436585.
DR   EnsemblGenomes-Gn; EBG00001436586.
DR   EnsemblGenomes-Gn; EBG00001436587.
DR   EnsemblGenomes-Gn; EBG00001436588.
DR   EnsemblGenomes-Gn; EBG00001436589.
DR   EnsemblGenomes-Gn; EBG00001436590.
DR   EnsemblGenomes-Gn; EBG00001436591.
DR   EnsemblGenomes-Gn; EBG00001436592.
DR   EnsemblGenomes-Gn; EBG00001436593.
DR   EnsemblGenomes-Gn; EBG00001436594.
DR   EnsemblGenomes-Gn; EBG00001436595.
DR   EnsemblGenomes-Gn; EBG00001436596.
DR   EnsemblGenomes-Gn; EBG00001436597.
DR   EnsemblGenomes-Gn; EBG00001436598.
DR   EnsemblGenomes-Gn; EBG00001436599.
DR   EnsemblGenomes-Gn; EBG00001436600.
DR   EnsemblGenomes-Gn; EBG00001436601.
DR   EnsemblGenomes-Gn; EBG00001436602.
DR   EnsemblGenomes-Gn; EBG00001436603.
DR   EnsemblGenomes-Gn; EBG00001436604.
DR   EnsemblGenomes-Gn; EBG00001436605.
DR   EnsemblGenomes-Gn; EBG00001436606.
DR   EnsemblGenomes-Gn; EBG00001436607.
DR   EnsemblGenomes-Gn; EBG00001436608.
DR   EnsemblGenomes-Gn; EBG00001436609.
DR   EnsemblGenomes-Gn; EBG00001436610.
DR   EnsemblGenomes-Gn; EBG00001436611.
DR   EnsemblGenomes-Gn; EBG00001436612.
DR   EnsemblGenomes-Gn; EBG00001436613.
DR   EnsemblGenomes-Gn; EBG00001436614.
DR   EnsemblGenomes-Gn; EBG00001436615.
DR   EnsemblGenomes-Gn; EBG00001436616.
DR   EnsemblGenomes-Gn; EBG00001436617.
DR   EnsemblGenomes-Gn; EBG00001436618.
DR   EnsemblGenomes-Gn; EBG00001436619.
DR   EnsemblGenomes-Gn; EBG00001436620.
DR   EnsemblGenomes-Gn; EBG00001436621.
DR   EnsemblGenomes-Gn; EBG00001436622.
DR   EnsemblGenomes-Gn; EBG00001436623.
DR   EnsemblGenomes-Gn; EBG00001436624.
DR   EnsemblGenomes-Gn; EBG00001436625.
DR   EnsemblGenomes-Gn; EBG00001436626.
DR   EnsemblGenomes-Gn; EBG00001436627.
DR   EnsemblGenomes-Gn; EBG00001436628.
DR   EnsemblGenomes-Gn; EBG00001436629.
DR   EnsemblGenomes-Gn; EBG00001436630.
DR   EnsemblGenomes-Gn; EBG00001436631.
DR   EnsemblGenomes-Gn; EBG00001436632.
DR   EnsemblGenomes-Gn; EBG00001436633.
DR   EnsemblGenomes-Gn; EBG00001436634.
DR   EnsemblGenomes-Gn; EBG00001436635.
DR   EnsemblGenomes-Gn; EBG00001436636.
DR   EnsemblGenomes-Gn; EBG00001436637.
DR   EnsemblGenomes-Gn; EBG00001436638.
DR   EnsemblGenomes-Gn; EBG00001436639.
DR   EnsemblGenomes-Gn; EBG00001436640.
DR   EnsemblGenomes-Gn; EBG00001436641.
DR   EnsemblGenomes-Gn; EBG00001436642.
DR   EnsemblGenomes-Gn; EBG00001436643.
DR   EnsemblGenomes-Gn; EBG00001436644.
DR   EnsemblGenomes-Gn; EBG00001436645.
DR   EnsemblGenomes-Gn; EBG00001436646.
DR   EnsemblGenomes-Gn; EBG00001436647.
DR   EnsemblGenomes-Gn; EBG00001436648.
DR   EnsemblGenomes-Gn; EBG00001436649.
DR   EnsemblGenomes-Gn; EBG00001436650.
DR   EnsemblGenomes-Gn; EBG00001436651.
DR   EnsemblGenomes-Gn; EBG00001436652.
DR   EnsemblGenomes-Gn; EBG00001436653.
DR   EnsemblGenomes-Gn; EBG00001436654.
DR   EnsemblGenomes-Gn; EBG00001436655.
DR   EnsemblGenomes-Gn; EBG00001436656.
DR   EnsemblGenomes-Gn; EBG00001436657.
DR   EnsemblGenomes-Gn; EBG00001436658.
DR   EnsemblGenomes-Gn; EBG00001436659.
DR   EnsemblGenomes-Gn; EBG00001436660.
DR   EnsemblGenomes-Gn; EBG00001436661.
DR   EnsemblGenomes-Gn; EBG00001436662.
DR   EnsemblGenomes-Gn; EBG00001436663.
DR   EnsemblGenomes-Gn; EBG00001436664.
DR   EnsemblGenomes-Gn; EBG00001436665.
DR   EnsemblGenomes-Gn; EBG00001436666.
DR   EnsemblGenomes-Gn; EBG00001436667.
DR   EnsemblGenomes-Gn; EBG00001436668.
DR   EnsemblGenomes-Gn; EBG00001436669.
DR   EnsemblGenomes-Gn; EBG00001436670.
DR   EnsemblGenomes-Gn; EBG00001436671.
DR   EnsemblGenomes-Gn; EBG00001436672.
DR   EnsemblGenomes-Gn; EBG00001436673.
DR   EnsemblGenomes-Gn; EBG00001436674.
DR   EnsemblGenomes-Gn; EBG00001436675.
DR   EnsemblGenomes-Gn; EBG00001436676.
DR   EnsemblGenomes-Gn; EBG00001436677.
DR   EnsemblGenomes-Gn; EBG00001436678.
DR   EnsemblGenomes-Gn; EBG00001436679.
DR   EnsemblGenomes-Gn; EBG00001436680.
DR   EnsemblGenomes-Gn; EBG00001436681.
DR   EnsemblGenomes-Gn; EBG00001436682.
DR   EnsemblGenomes-Gn; EBG00001436683.
DR   EnsemblGenomes-Gn; EBG00001436684.
DR   EnsemblGenomes-Gn; EBG00001436685.
DR   EnsemblGenomes-Gn; EBG00001436686.
DR   EnsemblGenomes-Gn; EBG00001436687.
DR   EnsemblGenomes-Gn; EBG00001436688.
DR   EnsemblGenomes-Gn; EBG00001436689.
DR   EnsemblGenomes-Gn; EBG00001436690.
DR   EnsemblGenomes-Gn; EBG00001436691.
DR   EnsemblGenomes-Gn; EBG00001436692.
DR   EnsemblGenomes-Gn; EBG00001436693.
DR   EnsemblGenomes-Gn; EBG00001436694.
DR   EnsemblGenomes-Gn; EBG00001436695.
DR   EnsemblGenomes-Gn; EBG00001436696.
DR   EnsemblGenomes-Gn; EBG00001436697.
DR   EnsemblGenomes-Gn; EBG00001436698.
DR   EnsemblGenomes-Gn; EBG00001436699.
DR   EnsemblGenomes-Gn; EBG00001436700.
DR   EnsemblGenomes-Gn; EBG00001436701.
DR   EnsemblGenomes-Gn; EBG00001436702.
DR   EnsemblGenomes-Gn; EBG00001436703.
DR   EnsemblGenomes-Gn; Shewmr7_R0001.
DR   EnsemblGenomes-Gn; Shewmr7_R0002.
DR   EnsemblGenomes-Gn; Shewmr7_R0003.
DR   EnsemblGenomes-Gn; Shewmr7_R0004.
DR   EnsemblGenomes-Gn; Shewmr7_R0005.
DR   EnsemblGenomes-Gn; Shewmr7_R0007.
DR   EnsemblGenomes-Gn; Shewmr7_R0008.
DR   EnsemblGenomes-Gn; Shewmr7_R0009.
DR   EnsemblGenomes-Gn; Shewmr7_R0010.
DR   EnsemblGenomes-Gn; Shewmr7_R0011.
DR   EnsemblGenomes-Gn; Shewmr7_R0012.
DR   EnsemblGenomes-Gn; Shewmr7_R0013.
DR   EnsemblGenomes-Gn; Shewmr7_R0014.
DR   EnsemblGenomes-Gn; Shewmr7_R0015.
DR   EnsemblGenomes-Gn; Shewmr7_R0016.
DR   EnsemblGenomes-Gn; Shewmr7_R0017.
DR   EnsemblGenomes-Gn; Shewmr7_R0018.
DR   EnsemblGenomes-Gn; Shewmr7_R0020.
DR   EnsemblGenomes-Gn; Shewmr7_R0021.
DR   EnsemblGenomes-Gn; Shewmr7_R0022.
DR   EnsemblGenomes-Gn; Shewmr7_R0023.
DR   EnsemblGenomes-Gn; Shewmr7_R0024.
DR   EnsemblGenomes-Gn; Shewmr7_R0025.
DR   EnsemblGenomes-Gn; Shewmr7_R0026.
DR   EnsemblGenomes-Gn; Shewmr7_R0027.
DR   EnsemblGenomes-Gn; Shewmr7_R0028.
DR   EnsemblGenomes-Gn; Shewmr7_R0030.
DR   EnsemblGenomes-Gn; Shewmr7_R0032.
DR   EnsemblGenomes-Gn; Shewmr7_R0033.
DR   EnsemblGenomes-Gn; Shewmr7_R0034.
DR   EnsemblGenomes-Gn; Shewmr7_R0035.
DR   EnsemblGenomes-Gn; Shewmr7_R0036.
DR   EnsemblGenomes-Gn; Shewmr7_R0037.
DR   EnsemblGenomes-Gn; Shewmr7_R0038.
DR   EnsemblGenomes-Gn; Shewmr7_R0039.
DR   EnsemblGenomes-Gn; Shewmr7_R0040.
DR   EnsemblGenomes-Gn; Shewmr7_R0041.
DR   EnsemblGenomes-Gn; Shewmr7_R0043.
DR   EnsemblGenomes-Gn; Shewmr7_R0044.
DR   EnsemblGenomes-Gn; Shewmr7_R0045.
DR   EnsemblGenomes-Gn; Shewmr7_R0046.
DR   EnsemblGenomes-Gn; Shewmr7_R0047.
DR   EnsemblGenomes-Gn; Shewmr7_R0048.
DR   EnsemblGenomes-Gn; Shewmr7_R0049.
DR   EnsemblGenomes-Gn; Shewmr7_R0050.
DR   EnsemblGenomes-Gn; Shewmr7_R0051.
DR   EnsemblGenomes-Gn; Shewmr7_R0052.
DR   EnsemblGenomes-Gn; Shewmr7_R0053.
DR   EnsemblGenomes-Gn; Shewmr7_R0054.
DR   EnsemblGenomes-Gn; Shewmr7_R0055.
DR   EnsemblGenomes-Gn; Shewmr7_R0056.
DR   EnsemblGenomes-Gn; Shewmr7_R0057.
DR   EnsemblGenomes-Gn; Shewmr7_R0058.
DR   EnsemblGenomes-Gn; Shewmr7_R0059.
DR   EnsemblGenomes-Gn; Shewmr7_R0060.
DR   EnsemblGenomes-Gn; Shewmr7_R0061.
DR   EnsemblGenomes-Gn; Shewmr7_R0062.
DR   EnsemblGenomes-Gn; Shewmr7_R0063.
DR   EnsemblGenomes-Gn; Shewmr7_R0064.
DR   EnsemblGenomes-Gn; Shewmr7_R0065.
DR   EnsemblGenomes-Gn; Shewmr7_R0066.
DR   EnsemblGenomes-Gn; Shewmr7_R0067.
DR   EnsemblGenomes-Gn; Shewmr7_R0068.
DR   EnsemblGenomes-Gn; Shewmr7_R0069.
DR   EnsemblGenomes-Gn; Shewmr7_R0070.
DR   EnsemblGenomes-Gn; Shewmr7_R0071.
DR   EnsemblGenomes-Gn; Shewmr7_R0072.
DR   EnsemblGenomes-Gn; Shewmr7_R0073.
DR   EnsemblGenomes-Gn; Shewmr7_R0074.
DR   EnsemblGenomes-Gn; Shewmr7_R0075.
DR   EnsemblGenomes-Gn; Shewmr7_R0076.
DR   EnsemblGenomes-Gn; Shewmr7_R0077.
DR   EnsemblGenomes-Gn; Shewmr7_R0078.
DR   EnsemblGenomes-Gn; Shewmr7_R0079.
DR   EnsemblGenomes-Gn; Shewmr7_R0080.
DR   EnsemblGenomes-Gn; Shewmr7_R0081.
DR   EnsemblGenomes-Gn; Shewmr7_R0082.
DR   EnsemblGenomes-Gn; Shewmr7_R0083.
DR   EnsemblGenomes-Gn; Shewmr7_R0084.
DR   EnsemblGenomes-Gn; Shewmr7_R0085.
DR   EnsemblGenomes-Gn; Shewmr7_R0086.
DR   EnsemblGenomes-Gn; Shewmr7_R0088.
DR   EnsemblGenomes-Gn; Shewmr7_R0089.
DR   EnsemblGenomes-Gn; Shewmr7_R0090.
DR   EnsemblGenomes-Gn; Shewmr7_R0091.
DR   EnsemblGenomes-Gn; Shewmr7_R0092.
DR   EnsemblGenomes-Gn; Shewmr7_R0093.
DR   EnsemblGenomes-Gn; Shewmr7_R0094.
DR   EnsemblGenomes-Gn; Shewmr7_R0095.
DR   EnsemblGenomes-Gn; Shewmr7_R0096.
DR   EnsemblGenomes-Gn; Shewmr7_R0097.
DR   EnsemblGenomes-Gn; Shewmr7_R0098.
DR   EnsemblGenomes-Gn; Shewmr7_R0099.
DR   EnsemblGenomes-Gn; Shewmr7_R0100.
DR   EnsemblGenomes-Gn; Shewmr7_R0101.
DR   EnsemblGenomes-Gn; Shewmr7_R0103.
DR   EnsemblGenomes-Gn; Shewmr7_R0104.
DR   EnsemblGenomes-Gn; Shewmr7_R0105.
DR   EnsemblGenomes-Gn; Shewmr7_R0107.
DR   EnsemblGenomes-Gn; Shewmr7_R0108.
DR   EnsemblGenomes-Gn; Shewmr7_R0109.
DR   EnsemblGenomes-Gn; Shewmr7_R0110.
DR   EnsemblGenomes-Gn; Shewmr7_R0111.
DR   EnsemblGenomes-Gn; Shewmr7_R0112.
DR   EnsemblGenomes-Gn; Shewmr7_R0113.
DR   EnsemblGenomes-Gn; Shewmr7_R0115.
DR   EnsemblGenomes-Gn; Shewmr7_R0116.
DR   EnsemblGenomes-Gn; Shewmr7_R0117.
DR   EnsemblGenomes-Gn; Shewmr7_R0119.
DR   EnsemblGenomes-Gn; Shewmr7_R0120.
DR   EnsemblGenomes-Gn; Shewmr7_R0121.
DR   EnsemblGenomes-Gn; Shewmr7_R0122.
DR   EnsemblGenomes-Gn; Shewmr7_R0123.
DR   EnsemblGenomes-Gn; Shewmr7_R0124.
DR   EnsemblGenomes-Gn; Shewmr7_R0125.
DR   EnsemblGenomes-Gn; Shewmr7_R0126.
DR   EnsemblGenomes-Gn; Shewmr7_R0130.
DR   EnsemblGenomes-Gn; Shewmr7_R0131.
DR   EnsemblGenomes-Gn; Shewmr7_R0132.
DR   EnsemblGenomes-Gn; Shewmr7_R0133.
DR   EnsemblGenomes-Gn; Shewmr7_R0134.
DR   EnsemblGenomes-Gn; Shewmr7_R0135.
DR   EnsemblGenomes-Gn; Shewmr7_R0136.
DR   EnsemblGenomes-Gn; Shewmr7_R0137.
DR   EnsemblGenomes-Gn; Shewmr7_R0138.
DR   EnsemblGenomes-Gn; Shewmr7_R0139.
DR   EnsemblGenomes-Gn; Shewmr7_R0140.
DR   EnsemblGenomes-Gn; Shewmr7_R0141.
DR   EnsemblGenomes-Gn; Shewmr7_R0142.
DR   EnsemblGenomes-Gn; Shewmr7_R0143.
DR   EnsemblGenomes-Gn; Shewmr7_R0144.
DR   EnsemblGenomes-Tr; EBT00001814186.
DR   EnsemblGenomes-Tr; EBT00001814187.
DR   EnsemblGenomes-Tr; EBT00001814188.
DR   EnsemblGenomes-Tr; EBT00001814189.
DR   EnsemblGenomes-Tr; EBT00001814190.
DR   EnsemblGenomes-Tr; EBT00001814191.
DR   EnsemblGenomes-Tr; EBT00001814192.
DR   EnsemblGenomes-Tr; EBT00001814193.
DR   EnsemblGenomes-Tr; EBT00001814194.
DR   EnsemblGenomes-Tr; EBT00001814195.
DR   EnsemblGenomes-Tr; EBT00001814196.
DR   EnsemblGenomes-Tr; EBT00001814197.
DR   EnsemblGenomes-Tr; EBT00001814198.
DR   EnsemblGenomes-Tr; EBT00001814199.
DR   EnsemblGenomes-Tr; EBT00001814200.
DR   EnsemblGenomes-Tr; EBT00001814201.
DR   EnsemblGenomes-Tr; EBT00001814202.
DR   EnsemblGenomes-Tr; EBT00001814203.
DR   EnsemblGenomes-Tr; EBT00001814204.
DR   EnsemblGenomes-Tr; EBT00001814205.
DR   EnsemblGenomes-Tr; EBT00001814206.
DR   EnsemblGenomes-Tr; EBT00001814207.
DR   EnsemblGenomes-Tr; EBT00001814208.
DR   EnsemblGenomes-Tr; EBT00001814209.
DR   EnsemblGenomes-Tr; EBT00001814210.
DR   EnsemblGenomes-Tr; EBT00001814211.
DR   EnsemblGenomes-Tr; EBT00001814212.
DR   EnsemblGenomes-Tr; EBT00001814213.
DR   EnsemblGenomes-Tr; EBT00001814214.
DR   EnsemblGenomes-Tr; EBT00001814215.
DR   EnsemblGenomes-Tr; EBT00001814216.
DR   EnsemblGenomes-Tr; EBT00001814217.
DR   EnsemblGenomes-Tr; EBT00001814218.
DR   EnsemblGenomes-Tr; EBT00001814219.
DR   EnsemblGenomes-Tr; EBT00001814220.
DR   EnsemblGenomes-Tr; EBT00001814221.
DR   EnsemblGenomes-Tr; EBT00001814222.
DR   EnsemblGenomes-Tr; EBT00001814223.
DR   EnsemblGenomes-Tr; EBT00001814224.
DR   EnsemblGenomes-Tr; EBT00001814225.
DR   EnsemblGenomes-Tr; EBT00001814226.
DR   EnsemblGenomes-Tr; EBT00001814227.
DR   EnsemblGenomes-Tr; EBT00001814228.
DR   EnsemblGenomes-Tr; EBT00001814229.
DR   EnsemblGenomes-Tr; EBT00001814230.
DR   EnsemblGenomes-Tr; EBT00001814231.
DR   EnsemblGenomes-Tr; EBT00001814232.
DR   EnsemblGenomes-Tr; EBT00001814233.
DR   EnsemblGenomes-Tr; EBT00001814234.
DR   EnsemblGenomes-Tr; EBT00001814235.
DR   EnsemblGenomes-Tr; EBT00001814236.
DR   EnsemblGenomes-Tr; EBT00001814237.
DR   EnsemblGenomes-Tr; EBT00001814238.
DR   EnsemblGenomes-Tr; EBT00001814239.
DR   EnsemblGenomes-Tr; EBT00001814240.
DR   EnsemblGenomes-Tr; EBT00001814241.
DR   EnsemblGenomes-Tr; EBT00001814242.
DR   EnsemblGenomes-Tr; EBT00001814243.
DR   EnsemblGenomes-Tr; EBT00001814244.
DR   EnsemblGenomes-Tr; EBT00001814245.
DR   EnsemblGenomes-Tr; EBT00001814246.
DR   EnsemblGenomes-Tr; EBT00001814247.
DR   EnsemblGenomes-Tr; EBT00001814248.
DR   EnsemblGenomes-Tr; EBT00001814249.
DR   EnsemblGenomes-Tr; EBT00001814250.
DR   EnsemblGenomes-Tr; EBT00001814251.
DR   EnsemblGenomes-Tr; EBT00001814252.
DR   EnsemblGenomes-Tr; EBT00001814253.
DR   EnsemblGenomes-Tr; EBT00001814254.
DR   EnsemblGenomes-Tr; EBT00001814255.
DR   EnsemblGenomes-Tr; EBT00001814256.
DR   EnsemblGenomes-Tr; EBT00001814257.
DR   EnsemblGenomes-Tr; EBT00001814258.
DR   EnsemblGenomes-Tr; EBT00001814259.
DR   EnsemblGenomes-Tr; EBT00001814260.
DR   EnsemblGenomes-Tr; EBT00001814261.
DR   EnsemblGenomes-Tr; EBT00001814262.
DR   EnsemblGenomes-Tr; EBT00001814263.
DR   EnsemblGenomes-Tr; EBT00001814264.
DR   EnsemblGenomes-Tr; EBT00001814265.
DR   EnsemblGenomes-Tr; EBT00001814266.
DR   EnsemblGenomes-Tr; EBT00001814267.
DR   EnsemblGenomes-Tr; EBT00001814268.
DR   EnsemblGenomes-Tr; EBT00001814269.
DR   EnsemblGenomes-Tr; EBT00001814270.
DR   EnsemblGenomes-Tr; EBT00001814271.
DR   EnsemblGenomes-Tr; EBT00001814272.
DR   EnsemblGenomes-Tr; EBT00001814274.
DR   EnsemblGenomes-Tr; EBT00001814276.
DR   EnsemblGenomes-Tr; EBT00001814277.
DR   EnsemblGenomes-Tr; EBT00001814284.
DR   EnsemblGenomes-Tr; EBT00001814285.
DR   EnsemblGenomes-Tr; EBT00001814288.
DR   EnsemblGenomes-Tr; EBT00001814289.
DR   EnsemblGenomes-Tr; EBT00001814291.
DR   EnsemblGenomes-Tr; EBT00001814293.
DR   EnsemblGenomes-Tr; EBT00001814295.
DR   EnsemblGenomes-Tr; EBT00001814297.
DR   EnsemblGenomes-Tr; EBT00001814298.
DR   EnsemblGenomes-Tr; EBT00001814300.
DR   EnsemblGenomes-Tr; EBT00001814301.
DR   EnsemblGenomes-Tr; EBT00001814303.
DR   EnsemblGenomes-Tr; EBT00001814305.
DR   EnsemblGenomes-Tr; EBT00001814307.
DR   EnsemblGenomes-Tr; EBT00001814309.
DR   EnsemblGenomes-Tr; EBT00001814310.
DR   EnsemblGenomes-Tr; EBT00001814312.
DR   EnsemblGenomes-Tr; EBT00001814314.
DR   EnsemblGenomes-Tr; EBT00001814316.
DR   EnsemblGenomes-Tr; EBT00001814317.
DR   EnsemblGenomes-Tr; EBT00001814320.
DR   EnsemblGenomes-Tr; EBT00001814323.
DR   EnsemblGenomes-Tr; EBT00001814324.
DR   EnsemblGenomes-Tr; EBT00001814326.
DR   EnsemblGenomes-Tr; EBT00001814327.
DR   EnsemblGenomes-Tr; EBT00001814329.
DR   EnsemblGenomes-Tr; EBT00001814332.
DR   EnsemblGenomes-Tr; EBT00001814334.
DR   EnsemblGenomes-Tr; EBT00001814336.
DR   EnsemblGenomes-Tr; EBT00001814338.
DR   EnsemblGenomes-Tr; EBT00001814340.
DR   EnsemblGenomes-Tr; EBT00001814342.
DR   EnsemblGenomes-Tr; EBT00001814345.
DR   EnsemblGenomes-Tr; EBT00001814346.
DR   EnsemblGenomes-Tr; EBT00001814348.
DR   EnsemblGenomes-Tr; EBT00001814351.
DR   EnsemblGenomes-Tr; EBT00001814352.
DR   EnsemblGenomes-Tr; EBT00001814354.
DR   EnsemblGenomes-Tr; EBT00001814356.
DR   EnsemblGenomes-Tr; EBT00001814358.
DR   EnsemblGenomes-Tr; EBT00001814360.
DR   EnsemblGenomes-Tr; EBT00001814362.
DR   EnsemblGenomes-Tr; EBT00001814364.
DR   EnsemblGenomes-Tr; EBT00001814366.
DR   EnsemblGenomes-Tr; EBT00001814368.
DR   EnsemblGenomes-Tr; EBT00001814370.
DR   EnsemblGenomes-Tr; EBT00001814372.
DR   EnsemblGenomes-Tr; EBT00001814374.
DR   EnsemblGenomes-Tr; EBT00001814376.
DR   EnsemblGenomes-Tr; EBT00001814379.
DR   EnsemblGenomes-Tr; EBT00001814380.
DR   EnsemblGenomes-Tr; EBT00001814382.
DR   EnsemblGenomes-Tr; EBT00001814384.
DR   EnsemblGenomes-Tr; EBT00001814385.
DR   EnsemblGenomes-Tr; EBT00001814387.
DR   EnsemblGenomes-Tr; EBT00001814389.
DR   EnsemblGenomes-Tr; EBT00001814391.
DR   EnsemblGenomes-Tr; EBT00001814393.
DR   EnsemblGenomes-Tr; EBT00001814395.
DR   EnsemblGenomes-Tr; EBT00001814397.
DR   EnsemblGenomes-Tr; EBT00001814398.
DR   EnsemblGenomes-Tr; EBT00001814400.
DR   EnsemblGenomes-Tr; EBT00001814403.
DR   EnsemblGenomes-Tr; Shewmr7_R0001-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0002-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0003-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0004-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0005-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0007-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0008-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0009-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0010-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0011-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0012-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0013-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0014-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0015-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0016-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0017-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0018-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0020-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0021-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0022-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0023-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0024-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0025-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0026-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0027-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0028-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0030-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0032-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0033-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0034-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0035-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0036-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0037-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0038-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0039-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0040-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0041-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0043-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0044-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0045-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0046-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0047-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0048-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0049-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0050-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0051-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0052-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0053-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0054-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0055-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0056-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0057-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0058-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0059-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0060-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0061-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0062-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0063-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0064-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0065-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0066-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0067-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0068-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0069-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0070-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0071-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0072-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0073-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0074-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0075-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0076-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0077-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0078-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0079-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0080-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0081-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0082-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0083-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0084-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0085-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0086-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0088-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0089-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0090-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0091-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0092-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0093-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0094-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0095-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0096-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0097-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0098-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0099-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0100-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0101-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0103-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0104-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0105-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0107-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0108-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0109-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0110-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0111-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0112-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0113-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0115-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0116-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0117-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0119-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0120-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0121-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0122-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0123-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0124-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0125-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0126-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0130-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0131-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0132-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0133-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0134-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0135-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0136-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0137-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0138-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0139-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0140-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0141-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0142-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0143-1.
DR   EnsemblGenomes-Tr; Shewmr7_R0144-1.
DR   EuropePMC; PMC3147445; 21642407.
DR   EuropePMC; PMC5740310; 29061750.
DR   EuropePMC; PMC5740354; 29038283.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000444.
DR   SILVA-SSU; CP000444.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000370
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4792610
FT                   /organism="Shewanella sp. MR-7"
FT                   /strain="MR-7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:60481"
FT   gene            81..1463
FT                   /locus_tag="Shewmr7_0001"
FT   CDS_pept        81..1463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: son:SO0008 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal; Chromosomal replication initiator, DnaA; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41007"
FT                   /db_xref="GOA:Q0I0U8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0U8"
FT                   /protein_id="ABI41007.1"
FT                   /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGDTLVLYAPNR
FT                   FVLDWVRDKYINIINQFFTEQMGNDAPKLRFDIGSRPSAKKPEPAPVAAVRVPNPQTKA
FT                   SVGTSFNTTEPVVNANHRSNINPTYQFDNFVEGKSNQLGKAAALQVAENPGGAYNPLFL
FT                   YGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSV
FT                   DALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGW
FT                   GLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIANA
FT                   NFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVARP
FT                   RQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIRTL
FT                   SS"
FT   gene            1484..2584
FT                   /locus_tag="Shewmr7_0002"
FT   CDS_pept        1484..2584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: son:SO0009 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41008"
FT                   /db_xref="GOA:Q0I0U7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0U7"
FT                   /protein_id="ABI41008.1"
FT                   /translation="MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSGHSLKMT
FT                   GTDLEVELVGQAVVHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRS
FT                   RFSLATLPAEEYPNVEAFQAEIEFTLKQGVLKSLIDATQFSMANQDVRYYLNGLLLETE
FT                   GNVLRAIATDGHRLALSHRTIDAQLPEKQVIVPRKGVMEMARLLEADDLDIAIAIGDNA
FT                   IRATTSTTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHFKQALTRASILSNEKFRGV
FT                   RIQLEAGLLKITANNPEQEEAEEIIDVDYNNQPLEIGFNVSYLLDVLNNLKSDDVRITL
FT                   IDGNSSALLENHLEEDSMYVVMPMRL"
FT   gene            2747..3829
FT                   /locus_tag="Shewmr7_0003"
FT   CDS_pept        2747..3829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: son:SO0010 DNA replication
FT                   and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41009"
FT                   /db_xref="GOA:Q0I0U6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0U6"
FT                   /protein_id="ABI41009.1"
FT                   /translation="MSLIRLNIDSFRNIQLAQLSPSSGINLIYGQNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVINNEQDKLTLFATLNLPRGDSKIGLRRFRSGETEVKIDGEKVKR
FT                   LSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHSDPQFYAAWVNVRRVLKQRNQ
FT                   LLRNNSSYEQIQYWDREFVRYTEQVTEIRNRYVDSLNELLKGIIGEFLPQVDVKVSFTR
FT                   GWDSKTDFAQLLESQYPRDLATGHTVSGPHKADLRLRVGSLPAQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQIDKHSIYLVDDLPSELDAQHRQLLLKQLVDTGAQVFVTAIEPAAIVDS
FT                   LHTPPSRMFHVEQGRVTVIE"
FT   gene            3846..6263
FT                   /locus_tag="Shewmr7_0004"
FT   CDS_pept        3846..6263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: son:SO0011 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41010"
FT                   /db_xref="GOA:Q0I0U5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0U5"
FT                   /protein_id="ABI41010.1"
FT                   /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCTDITITIHVDGSVSVRDDGRGIPVAIHPEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSKKLQLTIRREGKVHEQFYTHGVPDEPIKVIGDATK
FT                   TGTEIRFWPSEETFSDVEFHFEILAKRVRELSFLNSGVGIRLVDERDNKNEFFKYEGGI
FT                   SAFVDYLNRNKTPVNKDVFHFMQEREDGITVEVAMQWNDGYQESIFCFTNNIPQRDGGT
FT                   HLAGFRSALTRNLNNYMENEGYNKKGKTNATGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKAAVEQTMGEKLNDYLLENPADAKLIVGKIVDAARAREAARKAREMTRRKGAL
FT                   DLGGLPGKLADCQEKDPGLSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKTRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QMPELIERGYVYIAQPPLFKVKKGKQEQYLKDEAALTQYLTTQALDGTSIYPSQGAPGM
FT                   SGEPLERLVTQYREVEAIVARLEQRYPTQITNRMLYHPMINNEMLADEGKMKEWIDAFI
FT                   HELVELENSGVLYSGEPVLDPERKVYLPKITIRKHGIDTHYLFSYDFFQSTDYQRIGKL
FT                   GAALEGLIEVGGYVQRGERVKEVGSFIEALDWTIGEAKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPESRRMLQVTIDDAVGADQLFTCLMGDQVEPRRDFIEANALNVANLDV"
FT   gene            complement(6345..7001)
FT                   /locus_tag="Shewmr7_0005"
FT   CDS_pept        complement(6345..7001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0005"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain
FT                   protein; KEGG: son:SO0012 glutathione S-transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41011"
FT                   /db_xref="GOA:Q0I0U4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0U4"
FT                   /protein_id="ABI41011.1"
FT                   /translation="MELYIGNKTYSSWSLRAWLMAAKSGIQFDEILLQLDTDSFYQRLK
FT                   SISPTLKVPTLIDGNITVWDSLSICEYINDTYLSGSAWPQDPKQKAKARSFACEMHSGF
FT                   HALRNALPMNIRAHRYVELSPAVLQDIARIDNIWSQQMAEFATAQGTWLFGKWSIADMM
FT                   FAPVVMRFFTYEIEVSQASRAYMEFIVSQPEMQAWIQAAKTETEIVDADEAGVDR"
FT   gene            7128..7976
FT                   /locus_tag="Shewmr7_0006"
FT   CDS_pept        7128..7976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0006"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: vvu:VV20874 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41012"
FT                   /db_xref="GOA:Q0I0U3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0U3"
FT                   /protein_id="ABI41012.1"
FT                   /translation="MDIEALRSFVAFVDTGSFTRAAMQTYKTQSAVSMQMKRLEQELGK
FT                   TLFVKEGRNLVLSTEGQRFGLYAKQLLQLHDETVTTIKQTQVGTQLHLGCPDDYAEFVL
FT                   PRIVALLHGHIKQLDLQITCASSQKLRIMLDSGQLDAAIVTRLPESDEGYLLQTSKGVW
FT                   VSASGSNLSDADPLPIALFQKDCKFHIAALDGLMKQDRHYQLLACSSSAAALKAIVAKD
FT                   LAISAMAECSVSAPLNIIDSETLPPLPVVAVALVISAKAYSPINAELAKQIARGYQGYL
FT                   E"
FT   gene            8132..9175
FT                   /locus_tag="Shewmr7_0007"
FT   CDS_pept        8132..9175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0007"
FT                   /product="putative signal transduction protein"
FT                   /note="KEGG: son:SO0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41013"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0U2"
FT                   /protein_id="ABI41013.1"
FT                   /translation="MIKSIFNKIFNIREQTILERPKSFSQTELSKPVTAVSGKQLPEEP
FT                   QDTSVSIDLAALFYSLLFPARTKDAGGVANNLERRVMAEIELALASPQVIAEKVLKLPS
FT                   KVLELDRKLAEPQFDTKDLLALIEKDPLLSVEVLKLCNSPAFKRGDREVTSLQQALVQL
FT                   GREQLRRFVTSCLVREMLDIKPIYFRRFGAEIWRHSMQVAFLTSELSEEDRDTAFLLGL
FT                   LHDVGKLAIFKMLLDAFVQAEPGEQPNSWLFRQVMTAKSLTLSALLAKHWQLPSTFETE
FT                   LDKLAHVHTRPNEGIAAVVWRANIISEISMLQQAGKLPADMLSNLLALVGLEPAQFEAL
FT                   HEKLQQF"
FT   gene            complement(9239..11305)
FT                   /locus_tag="Shewmr7_0008"
FT   CDS_pept        complement(9239..11305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0008"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: son:SO0014 glycyl-tRNA synthetase beta chain;
FT                   TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41014"
FT                   /db_xref="GOA:Q0I0U1"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0U1"
FT                   /protein_id="ABI41014.1"
FT                   /translation="MNFENLLIELGTEELPPKALRKLAESFLANFTEELTKADLAFKSA
FT                   AWYAAPRRLAINVTELAIAQADKIVEKRGPAVSSAFDAEGKPTKAAEGWARGNGITVDQ
FT                   AERLVTDKGEWLVYNAKVEGVETKSLIAAMAQRALDKLPIPKPMRWGSSKTQFIRPVHT
FT                   ATMLLGSELIEGELLGIKSARNVRGHRFMGTGFELDHADNYLTLLKEKGKVIADYESRK
FT                   ALIKADAEKAAAKIGGTADIEDDLLEEVTSLVEWPVVLTASFEEKFLNVPSEALVYTMK
FT                   GDQKYFPVFDEAGKLLPNFIFVANIESKDPAQIIAGNEKVVRPRLADAEFFFNTDKKHT
FT                   LESRLPSLETVLFQQQLGTLKDKVTRISALAAFIAEQTGANAVDAARAGLLSKTDLMTN
FT                   MVMEFTDTQGTMGMHYARLDGETEAVALAMEEQYKPKFSGDTVPTAAVSCAVALADKLD
FT                   TLVGIFGIGQAPKGAADPFALRRAAIGVLRIIVENKLPLDLVTLIAKAQELHGTNLSNA
FT                   NASDEVLEFLMARFRAWYQDKGIDVDVILAVLARRPTRPADFDSRINAVSHFRSLEASS
FT                   ALAAANKRVSNILAKVEGELPTAINSALLAEAAEQALAAKLAELQPQLAPLFANADYQQ
FT                   ALTLLSSLRESVDQFFEDVMVMADDEALKNNRLALLNNLREQFLHVADISLLQ"
FT   gene            complement(11315..12220)
FT                   /locus_tag="Shewmr7_0009"
FT   CDS_pept        complement(11315..12220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0009"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: son:SO0015 glycyl-tRNA synthetase alpha chain;
FT                   TIGRFAM: glycyl-tRNA synthetase, alpha subunit; PFAM:
FT                   glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41015"
FT                   /db_xref="GOA:Q0I0U0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0U0"
FT                   /protein_id="ABI41015.1"
FT                   /translation="MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQT
FT                   FLRSLGPEPMSSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLQ
FT                   ALGIDTQIHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECSPVTGE
FT                   ITYGLERLAMYIQGVDSVYDLVWTDGPMGRITYGDVFHQNEVEQSTYNFEHADVDFMFA
FT                   LFDQCEKMCQHLLSLEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMA
FT                   KAVAESYYQAREALGFPMCK"
FT   gene            12339..12914
FT                   /locus_tag="Shewmr7_0010"
FT   CDS_pept        12339..12914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0010"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: son:SO0016 DNA-3-methyladenine glycosidase I;
FT                   TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41016"
FT                   /db_xref="GOA:Q0I0T9"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0T9"
FT                   /protein_id="ABI41016.1"
FT                   /translation="MEEIRCNWVSDDPLYREYHDKVWGRPVYDSKELFAKLCLDGQQAG
FT                   LSWITILKKQQNYEQAFADFEPAVIATFDDAKVEELMNNPGIVRNRLKIHSIIRNAKGY
FT                   LAYTADGKDFAEFLWSFVGGKPLVNQFTSMSQVPAQTPESEAMSKALKKLGFNFVGPTI
FT                   CYAFMQAVGMVNDHLVDCIAYDACCGGK"
FT   gene            complement(13000..16188)
FT                   /locus_tag="Shewmr7_0011"
FT   CDS_pept        complement(13000..16188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0011"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; WD40 domain protein beta
FT                   Propeller; KEGG: son:SO0017 hypothetical amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41017"
FT                   /db_xref="GOA:Q0I0T8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0T8"
FT                   /protein_id="ABI41017.1"
FT                   /translation="MLKPKLTPLYIALMLGLSSHAVQATDAQKTSWDVNAPANAPLEKV
FT                   TIDVTEGTWMNISVSPDGKHLVFDLLGNIYQIPVTGGEAKPLAQGIAWQMQPVYSPDGK
FT                   HIAFTSDADGGDNIWIMDANGSNPRTVTTETFRLLNSPAWSPDSQYLVGRKHFTASRSL
FT                   GAGEVWLYHVAGGEGVKLTERPNDEKDLGEPAYSPDGRYIYFSQDDTPGKTFHYSKDSV
FT                   NGIYKIKRYDTQTGDIEILIEGTGGAIRPTPSPDGTKLAYIKRDDFQSSLYLLDLKSGE
FT                   TTKLYGDLDRDMQETWAIHGVYPTMAWTQDNKDIFFWAKGKINRLNVANKTVTNIPFRV
FT                   KTQLDVQPSVRFKQDIDKDVFDVKMLRMAQVSPDGSKVAFEALGKIWLKTLPDGKMSRL
FT                   TELGNDIEELYPQWSRDGKNIVFTTWNDQDQGTVQVISAKGGKAKQLTTEPGKYVEPTF
FT                   SPDSELVVYRKTQGGHLTPRTWSQEPGLYKVDLKTKQNKKITAEGYQAQFGASADRIFF
FT                   MNTGENDTPQLASINLDGFDKRVHYSSKHATEFRVSPDGEQLAFAERFKVWVTPFAKHG
FT                   ETVEIGPNASNLPVTQLSVRAGESISWNSKSNQLYWTLGPELYQADVDSQYLKKDEQAK
FT                   PSIINLGFTEKADVPRGTVAFVGGKVITMENDQVIDKGVVIVKDNHILAVGDANTALPK
FT                   DAQVIDISGKSIMPGLFDAHAHGAQADDEIVPQQNWALYSGLSLGVTTIHDPSNDTTEI
FT                   FAASEQQKVGHIVGPRIFSTGTILYGANAPGYTSHIDSLDDAKFHLERLKKVGAFSVKS
FT                   YNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLTMVADGHTTVEHSLPVANIYNDIK
FT                   QFWSQTKVGYTPTLVVAYGGISGENYWYDKTDVWAHPRLSMYVPSDILQARSMRRPHAP
FT                   DSHYNHFNVSKVANEFNKLGVHSNIGAHGQREGLAAHWEMWMFAQGGMSNMDVLKTATI
FT                   NPATTFGLEHQLGSIKTGKLADLIVIDGDPLADIRVTDKVTYTMVNGKLFDAESMNQLN
FT                   GNKQQRKPFFFEKI"
FT   sig_peptide     complement(16114..16188)
FT                   /locus_tag="Shewmr7_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 25"
FT   gene            complement(16385..16822)
FT                   /locus_tag="Shewmr7_0012"
FT   CDS_pept        complement(16385..16822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41018"
FT                   /db_xref="GOA:Q0I0T7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0T7"
FT                   /protein_id="ABI41018.1"
FT                   /translation="MPKLVAIAYKTVKRGPMNEVLCANVTQHSGVEKDVFGRPGKRQVT
FT                   VLSLQQWQIACQSIDANLPWTTRRANLLVDGYSFGAADVGKQLRIGDLCLEVTGETDPC
FT                   KKMEQAHAGLESALTPDWRGGVTCRVINDAMIHIGDPVTFD"
FT   gene            complement(16858..17103)
FT                   /locus_tag="Shewmr7_0013"
FT   CDS_pept        complement(16858..17103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0013"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: son:SO0019 SirA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41019"
FT                   /db_xref="GOA:Q0I0T6"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0T6"
FT                   /protein_id="ABI41019.1"
FT                   /translation="MNDVFSTAQHKLDALGLRCPEPVMMVRKTVRQMAQGETLLIIADD
FT                   PATTRDIPSFCEFMDHTLIASETSQTPYQYLIKKGL"
FT   gene            complement(17262..18455)
FT                   /locus_tag="Shewmr7_0014"
FT   CDS_pept        complement(17262..18455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0014"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: cvi:CV0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41020"
FT                   /db_xref="GOA:Q0I0T5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0T5"
FT                   /protein_id="ABI41020.1"
FT                   /translation="MLQTEQTLFEQMRITELEIDFRKSLFSFTLADVRALQSFKPVIEA
FT                   NIDKIVDDFYGLQTSVSEIALLIGDSDTLARLRTAQRRYVLDLFNGVYDLEYVNNRLRI
FT                   GLVHKRIGVEPKLYLSAVHTLKELIYAEINNSVKDAAQNERIRIAIDKLVLFDVTLVFD
FT                   TYIRSLVSEIENAKDKAERYAQSMESKVKERTQQLEELSQTDPLTGLLNVRHLQEFATR
FT                   ILRAAQRRAEPVSVIYLDVDDFKHFNDSQGHRAGDEVLRAVAQSIKESTRAEDHCFRYG
FT                   GDEFCIIMPNCREEQARDHFIERFNQNIKRHLNNISLSFGIVDTGPYDYDDANTLIHKA
FT                   DQKMYSYKRARAAKSQLPATAANDLKTDMNNIETLNLDAAESCPHESAAPIIDKIAE"
FT   gene            complement(18689..19852)
FT                   /locus_tag="Shewmr7_0015"
FT   CDS_pept        complement(18689..19852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0015"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: son:SO0020 fatty oxidation complex, beta
FT                   subunit; TIGRFAM: acetyl-CoA acetyltransferases; acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41021"
FT                   /db_xref="GOA:Q0I0T4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0T4"
FT                   /protein_id="ABI41021.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKGLLLRNPQL
FT                   DPNAIEDVIWGCVQQTLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMEAIHQAARA
FT                   IMTGMGDTFIIGGVEHMGHVPMNHGVDFHPGLANNVAKASGMMGLTAEMLGKLHGISRE
FT                   QQDAFAVRSHQRAHAATVEGRFAKEIYAIEGHDANGALIKVLHDEVIRPETSMESLAAL
FT                   RPVFDPANGTVTAGTSSALSDGASAMLVMEESKARALGLPIRARIRSMAVAGCDAAIMG
FT                   YGPVPATQKALARAGITVNDLDVIELNEAFAAQSLPCVKDLGLLDVVDEKINLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEHKDATLGLATMCIGLGQGIATVFERV"
FT   gene            complement(19875..22025)
FT                   /locus_tag="Shewmr7_0016"
FT   CDS_pept        complement(19875..22025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0016"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase / short chain
FT                   enoyl-CoA hydratase"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="4.2.1.17"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   son:SO0021 enoyl-CoA hydratase / dodecenoyl-CoA
FT                   delta-isomerase / 3-hydroxyacyl-CoA dehydrogenase /
FT                   3-hydroxybutyryl-CoA epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41022"
FT                   /db_xref="GOA:Q0I0T3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0T3"
FT                   /protein_id="ABI41022.1"
FT                   /translation="MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDS
FT                   IKQQSNIQALVLTSGKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFP
FT                   TASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNA
FT                   LEWITTGKDQRPEDALKVGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRHRKMSPL
FT                   TLPKLEAMMSFTTAKGMVFAVAGKHYPAPMAAVSVVEQAATKGRSDALQIEHQAFIKLA
FT                   KTDVAKALIGIFLNDQLVKGKAKKAGKLAKDVKSAAVLGAGIMGGGIAYQSASKGTPIV
FT                   MKDIAQPALDLGLGEAAKLLSAQVARGRSTPEKMAKVLNNITPALDYAPVNHADVVVEA
FT                   VVEHPKVKAQVLAEVEQYVSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKM
FT                   PLVEVIRGEHSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEG
FT                   GDFAAIDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGNDAIDVMF
FT                   ENKRLGQKNGKGFYAYSVDSRGKPKKDVDPTSYELLKAAFGEQKAFDADEIIARTMIPM
FT                   IIETVRCLEEGIVASPAEADMGLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRALAANNGSYYQA"
FT   gene            22469..23788
FT                   /locus_tag="Shewmr7_0017"
FT   CDS_pept        22469..23788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0017"
FT                   /product="Xaa-Pro dipeptidase. Metallo peptidase. MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.13.9"
FT                   /note="PFAM: peptidase M24; KEGG: son:SO0022 prolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41023"
FT                   /db_xref="GOA:Q0I0T2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0T2"
FT                   /protein_id="ABI41023.1"
FT                   /translation="MDHLAHHYHAHIAELNRRVAEIVSREALSGLVIHSGQPHRMFLDD
FT                   INYPFKANPHFKAWLPVLDNPNCWLVVNGRDKPQLIFYRPVDFWHKVSDVPEMFWTEHF
FT                   EIKLLTKADKVAELLPSDITNWAYLGEHLDVAEVLGFTSRNPDSVMSYLHFHRTTKTEY
FT                   ELECMRRANQIAVQGHLAAKNAFYNGASEFEIQQQYLSAVGQGDNEVPYGNIIALNQNA
FT                   AILHYTALEHQNPARRLSFLIDAGASYFGYASDITRTYAFEKNRFDELITAMNKAQLEL
FT                   IDMMRPGVRYPDLHLATHGKVAQMLLDFELATGDAQGLVDQGITSAFFPHGLGHMLGLQ
FT                   VHDVGGFSFDERGTHIPAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNELKQDSRG
FT                   QQINWRTVDELRPFGGIRIEDNVIVHQDRNENMTRELGLA"
FT   gene            23804..24418
FT                   /locus_tag="Shewmr7_0018"
FT   CDS_pept        23804..24418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0018"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   son:SO0023 conserved hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41024"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0T1"
FT                   /protein_id="ABI41024.1"
FT                   /translation="MLESYLIPSENVQIEEEIKHSRFISFLFHCTSIEQLKLVLTDIKR
FT                   DFPGASHYCYAFIAGAPNDSITIGSSDDGEPAGSAGRPMLAVLQGANLGEVGAVVVRFY
FT                   GGTKLGVGGLVRAYTSGLRQGLGQLPTRVKQLRYPAKLHCDYTQLRDVEHLLQQLEAVI
FT                   IDKQFAEAVDIHFEIGKQQQGILNESLATLSQGSLRAEFEL"
FT   gene            24496..25953
FT                   /locus_tag="Shewmr7_0019"
FT   CDS_pept        24496..25953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0019"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: son:SO0024 potassium uptake
FT                   protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41025"
FT                   /db_xref="GOA:Q0I0T0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0T0"
FT                   /protein_id="ABI41025.1"
FT                   /translation="MQYKTIIRIIGLLIGLFSITMLPPALIAIWYNDGGGTAFIQAFFV
FT                   SLFIGFWLWYPNRRCKEELRTREGFLIVVLFWTVLGSIGALPFIFSSQPDLSWTDSFFE
FT                   SFSALTTTGATVIVGLDSLPKAILFYRHLLQWLGGMGIIVLAVAILPVLGVGGMQLYRA
FT                   EIPGPVKDSKMTPRIAETAKALWYIYLLLTIACAGAYWLAGMSVFDAVCHSFSTIAIGG
FT                   FSTHDASMGYFDSSVINLICVFFLIVSAVNFSVHFAAFSRRGINFRVYFRDTEFKMLVA
FT                   IQLVLTAICFLTLYHSGIYDSPEETLDHALFQAVSVATTAGFGTESFHMWPLFLPILLI
FT                   FSSFIGGCGGSTAGGIKVIRVILLLLQGSRELKRLVHPKAMFSIRIGSKALPDRVVDAV
FT                   WGFFSAYALVFVLCMLALMAMGLDDITAFSATAACLNNLGPGLGEVASNYASIGDGAKW
FT                   VLVVAMLFGRLEVFTLLILFTPTFWRD"
FT   sig_peptide     24496..24582
FT                   /locus_tag="Shewmr7_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.769 at
FT                   residue 29"
FT   gene            25955..26479
FT                   /locus_tag="Shewmr7_0020"
FT   CDS_pept        25955..26479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0020"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: son:SO0025 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41026"
FT                   /db_xref="GOA:Q0I0S9"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S9"
FT                   /protein_id="ABI41026.1"
FT                   /translation="MQTLIIYSTIDGQTLEICRKIKTLAEQAGEQVSLVTLEQAEALSL
FT                   ADFDKVLIGASIRYGKHRPDLYQFVNRNHAVLDSKINGFFTVNVVARKPLKNTPETNPY
FT                   MQKFLKLSLWQPQQLAVFAGKIDYPKYGLFDRTMIRFIMWMTKGPTDLKGTFEFTDWGK
FT                   VEAFGVHFSKL"
FT   gene            complement(26542..26850)
FT                   /locus_tag="Shewmr7_0021"
FT   CDS_pept        complement(26542..26850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0021"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: son:SO0026
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41027"
FT                   /db_xref="GOA:Q0I0S8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S8"
FT                   /protein_id="ABI41027.1"
FT                   /translation="MQNDIDVNAMVTNAESAAKWLKAIANPYRLMILCLLLDKELSVTE
FT                   LNATVPLSQSALSQHLAVLRAEDLVDTRKSSQIVYYKLKNEEVTQVISILHSRYCAV"
FT   gene            27049..27603
FT                   /locus_tag="Shewmr7_0022"
FT   CDS_pept        27049..27603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0022"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: son:SO0027 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41028"
FT                   /db_xref="GOA:Q0I0S7"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S7"
FT                   /protein_id="ABI41028.1"
FT                   /translation="MTRILVLYFTRGGHTAKIANAIAQQLTLRGAKVDLVDINSAAATK
FT                   INWHDYQLVALGACVLYGTYDKSVFQFIEQHAPALSALPNSFFCVNVVARNPEKRIPEN
FT                   NKYLQKFIALSPWTPADLKIIAGKVDYPSWPWYDRLMIQLIMKITKGPTDPKAVIDYTD
FT                   WEDVKVYADHLLTLAEVTEPA"
FT   gene            complement(27650..29092)
FT                   /locus_tag="Shewmr7_0023"
FT   CDS_pept        complement(27650..29092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0023"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: son:SO0028 potassium uptake
FT                   protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41029"
FT                   /db_xref="GOA:Q0I0S6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S6"
FT                   /protein_id="ABI41029.1"
FT                   /translation="MLNFRPLLFILGLFLSMLTAFMLAPLLLAVFNGEETVGAFMLSAL
FT                   VTGICASLCLHNGQSKTINLNIRDMFLLTSLTWLIVSLFAAMPFTLYHGIGYTDAFFET
FT                   MSGITTTGSTVLSGLDTMDHSILIWRSLLQWLGGIGFIVMAVAILPFLNVGGMRLFRTE
FT                   SSDWSDKAVPRTQSMAKHLFFIYILLTVMCCVAYHLAGMTWFQAINHAMTTLSTGGYST
FT                   SDNSMAAFSNSAHWVGVVFMAAGGLPLLMFVQMIQQRDFTVWNDAQVKGFLFFLTFVSC
FT                   FIGFWLWQTRDIALIDALRLSSFNVVSVVTTTGYGLTDYGAWGAFANIAFLFLMFVGSC
FT                   SGSTSGGIKIFRFQIAGAIMREQLKQQCHPNGIFRERYNNRLISEDIVRSLITFVLLFM
FT                   FVIVGLSVILVLTGLDPMTSFTGAITAVTNVGPGLGPIIGPAGNFSTLPDLAKWALSLG
FT                   MLLGRLEILTVAVLFHPSFWKY"
FT   sig_peptide     complement(29003..29092)
FT                   /locus_tag="Shewmr7_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.569 at
FT                   residue 30"
FT   gene            complement(29104..30513)
FT                   /locus_tag="Shewmr7_0024"
FT   CDS_pept        complement(29104..30513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0024"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: son:SO0029 potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41030"
FT                   /db_xref="GOA:Q0I0S5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S5"
FT                   /protein_id="ABI41030.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDSDKSRLRALQDKYDL
FT                   RVVAGHGAHPDVLKEAGAEDADMLIAVTNSDECNMVACQMAYSLFGTPTKIARIRSEPY
FT                   LAMRDKLFIDSETKNSEGRPRGGFVIDELIAPEQLVTAYIQRLVEYPGALQVLEFAEGR
FT                   LSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   VADSRHIRAVMSEMQKLDNSYRNIMIAGGGNIGLGLAKRLERTHSVKLIEHKFERAETL
FT                   SEQLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMSALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SSTSKVVGKAIGDIKLPPGTTIGAIVRNEEVLMAHDKTVIEQGDHVILFLVNKKFVGEV
FT                   EKLFQPSAFFF"
FT   gene            complement(30529..31818)
FT                   /locus_tag="Shewmr7_0025"
FT   CDS_pept        complement(30529..31818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0025"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: son:SO0030 Sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41031"
FT                   /db_xref="GOA:Q0I0S4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S4"
FT                   /protein_id="ABI41031.1"
FT                   /translation="MMNLRALAAKAIFEVLEKGVSLSVALPEQQKHLASGKDKALLAEL
FT                   CYGVMRTLPQIEKRVAECLAKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAEAC
FT                   RQLKFEGMVKVVNGVLRNIQRQLTPLSTESETLSYNTPGWLIKRLKAAYPDNWQEIILQ
FT                   SHERPPMWLRNNRLSQSRDAYLATLSELEIEASAGLSDDAILLAHPKDVATLPRFHEGA
FT                   ASVQDGAAQWAATLLAPQANELVLDACAAPGGKSCHLLELEPSIQLVAVDFDAKRLERV
FT                   QQNLDRLSLKAEVIHGDAANIDSWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRKNHD
FT                   IEELAELQRQILDHSWKWLKPGGTLLYATCSILPQENRDQISAFLARTADAKLDTLAQQ
FT                   ASSQDIGWQITPGQHNMDGFYYARLLKATH"
FT   gene            complement(31818..32774)
FT                   /locus_tag="Shewmr7_0026"
FT   CDS_pept        complement(31818..32774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0026"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: son:SO0031
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41032"
FT                   /db_xref="GOA:Q0I0S3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0S3"
FT                   /protein_id="ABI41032.1"
FT                   /translation="MKPLNIIFAGTPDFAARHLQALINSHHNVIAVYTQPDRPAGRGKK
FT                   LTASPVKELAVSHDIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRL
FT                   GCINVHGSILPRWRGAAPIQRALWAGDKETGVTIMQMDVGLDTGDMLLKTYLPIEDDDT
FT                   SATLYEKLAQQGPDALLQALEGLANGTLTAEKQDEALANYAEKLSKEEARLDWSKSATQ
FT                   LWQEVRAFNPWPVSYFEHQGNTIKVWQTQISTTSSNAAPGTIISASKKGIEVATGDGVL
FT                   TLLSMQLPGKKPLSVADILNARGDWFTPNTRLNNEAQ"
FT   gene            complement(32790..33296)
FT                   /locus_tag="Shewmr7_0027"
FT   CDS_pept        complement(32790..33296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0027"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: son:SO0032 polypeptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41033"
FT                   /db_xref="GOA:Q0I0S2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S2"
FT                   /protein_id="ABI41033.1"
FT                   /translation="MALLKVLRFPDERLRTQATPVTEFTAELQTQIDDMFETMYQEKGI
FT                   GLAATQVDYHKQLIVMDLQDEVDRPKVFINPEIIASSGDFCNEEGCLSVPGIYAKVDRA
FT                   EFVTVKALDRHGNEFTVEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAA
FT                   RQDAK"
FT   gene            33422..34546
FT                   /locus_tag="Shewmr7_0028"
FT   CDS_pept        33422..34546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0028"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG: son:SO0033
FT                   LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41034"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S1"
FT                   /protein_id="ABI41034.1"
FT                   /translation="MDRTMKRLILLALMTFNCTLVSADTLTLKAGHPESYVVKKGDTLW
FT                   DISATFLNDPWKWPRLWDVNPQIANPHLIYPGDQLTLVFIDGQPRLVRNGANEGKPHIR
FT                   KTPEGRVIAKSNAVPAVDLALIQNYLVQNRVVDADWFAQQPMVLAGESPSRHHVVGDVI
FT                   YIDSELPLNQKLGMYERGRDFFNKQTGEALGQEAILASTGQVIESGKVSKVKILSNYRE
FT                   TKAGFRALPMEDEALMSAYFTPKPAELKTPAAVLAIESKMREAGKLNVVYLDKGTQDGV
FT                   EPGEVFSIYRDGEEIVINNDGQPVPTTERTAYDNVVASLSSDRAIKMPDIYHGKLLVFK
FT                   VFDKASLGLIVSTERSVRVDDKLIAPDSLAFRGE"
FT   sig_peptide     33422..33493
FT                   /locus_tag="Shewmr7_0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 24"
FT   gene            34630..35646
FT                   /locus_tag="Shewmr7_0029"
FT   CDS_pept        34630..35646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0029"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: son:SO0034 DNA processing protein
FT                   DprA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41035"
FT                   /db_xref="GOA:Q0I0S0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0S0"
FT                   /protein_id="ABI41035.1"
FT                   /translation="MDVDDLRQRLEHERHSLPLSDNLLHSLVIDYQRVDAALEWQQQSE
FT                   LHHLVCFTDPLYPPLLKQLPDPPSVLFIKGCVEALLFPSLAIVGSRNASPGGLQVAYQL
FT                   AREMSALGFSICSGMAMGIDGAAHKACVDHGGRTLAVLGTGIDIIYPRRHKQLYEDIQH
FT                   QGCIISEFWPDIGPFAGNFPKRNRIISGLSLGTLVVEACRKSGSLITARLAMEQGREVF
FT                   AVPGSILGGFHQGCHDLLRDGAKLVESAADIVEELVSLTAFHLEEVSTRHHIQQGEICD
FT                   LPFSSLLASVGYETTTIDAVVEHSGKTIDLVLEQMLELELQGWVVAVPGGYVRVKRS"
FT   gene            35649..36125
FT                   /locus_tag="Shewmr7_0030"
FT   CDS_pept        35649..36125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0030"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   son:SO0035 Smg protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41036"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0R9"
FT                   /protein_id="ABI41036.1"
FT                   /translation="MFDILMYLFENYVHSEVELLVDEDELTKELTRAGFHQSEILKALT
FT                   WLERLAELQEGDKPYLCNHDQHSFRIYTKEEMEKLDVECRGFLLFLEQVKVLNVETREM
FT                   VIDRVMELDEPALILEDLKWVILMVLFNAPGHESAYEQMEDLIFEQPEEGRLHS"
FT   gene            36248..36811
FT                   /locus_tag="Shewmr7_0031"
FT   CDS_pept        36248..36811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0031"
FT                   /product="DNA topoisomerase, type IA, zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase, type IA, zn finger domain
FT                   protein; KEGG: son:SO0036 topoisomerase DNA-binding C4 zinc
FT                   finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41037"
FT                   /db_xref="GOA:Q0I0R8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0R8"
FT                   /protein_id="ABI41037.1"
FT                   /translation="MSKIDEQLFSAHEHALEKEFELCPECGSELSVKHSKHGSFIGCNN
FT                   YPTCQYTRPLVQHESIETQVIEGSKCPECGHELAVKSGRFGIFIGCTQYPSCTHIERPD
FT                   QESDKPEVACPECKTGKLEHRTSRFGKSFYACSAYPKCKFIVNYPPVAETCPSCGFGIL
FT                   VERKGAAGMRLECPQKSCKYKRAL"
FT   gene            36950..37516
FT                   /locus_tag="Shewmr7_0032"
FT   CDS_pept        36950..37516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0032"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC, N-terminal domain protein; KEGG: son:SO0037
FT                   Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41038"
FT                   /db_xref="GOA:Q0I0R7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0R7"
FT                   /protein_id="ABI41038.1"
FT                   /translation="MLQLHPSEIKDIVLNGGVIAYPTEAVYGLGCDPDNDTAIQKLLAV
FT                   KQRPWQKGLILVASEFSQLVDYVDESQLSAEQLEFAFSKWPGPFTFVMPIKPHVSRYLC
FT                   GEFDSIAVRVSAHEGVRALCQALGKPLVSTSANLAGEDPALSGDEILNAFEGKIDALVL
FT                   GSLGEQRQPSTIIDARSGKILRNGQ"
FT   gene            37546..38454
FT                   /locus_tag="Shewmr7_0033"
FT   CDS_pept        37546..38454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0033"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   son:SO0038 coproporphyrinogen III oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41039"
FT                   /db_xref="GOA:Q0I0R6"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0R6"
FT                   /protein_id="ABI41039.1"
FT                   /translation="MSVPDATVVKAFLLDLQNRICAGLEQLDGQASFAADSWTRTEGGG
FT                   GTSRVLTQGAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPKNPYI
FT                   PTTHANVRFFIAHKDGADPVWWFGGGFDLTPYYPFEEDVREWHQTAKNLCLPFGDDIYP
FT                   KYKKWCDEYFFLPHRNETRGVGGLFFDDLNQAGFDKSFDFMQAVGNGFLTAYAPIVERR
FT                   KETPYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWQYAYT
FT                   PEAGSPEADLYDNYLKPRDWV"
FT   gene            complement(38496..38933)
FT                   /locus_tag="Shewmr7_0034"
FT   CDS_pept        complement(38496..38933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0034"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: son:SO0039 hypothetical globin"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41040"
FT                   /db_xref="GOA:Q0I0R5"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0R5"
FT                   /protein_id="ABI41040.1"
FT                   /translation="MNWLKKIFSKHTSVPDDRDPNQSNAYDLIGGDKVIRAIAHSFYQK
FT                   MASSEETQALFAIHRAPIAESEQKLYEFLSGWLGGPQLYQQKYGHPALRARHMPFAVDE
FT                   TMRDQWLFCMKFAIEEHIKKPEHRAAIYEAISTLADHMRNQ"
FT   gene            39105..39983
FT                   /locus_tag="Shewmr7_0035"
FT   CDS_pept        39105..39983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0035"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: son:SO0040 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41041"
FT                   /db_xref="GOA:Q0I0R4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0R4"
FT                   /protein_id="ABI41041.1"
FT                   /translation="MTDMPSVTTPALDRYAVFGNPIGHSKSPFIHGQFASITQQPLSYE
FT                   AILAPIDGFEASLRAFFQAGGKGANVTVPFKEQAFALCDSLSAEATLAGAVNTLSLLAD
FT                   GTIYGDNTDGLGLVADLIRHLGSLQHKRVLLVGAGGAARGCILPLLKAEVGQLVITNRT
FT                   QSKAQALVEIFSQVQQGRYSDKLQSMPMPELSGEFDLVINSTSASLAGELPPLPQSIIG
FT                   NKTACYDMMYGAKPTAFNQWAVQQDAAQVIDGLGMLVGQAAKSFALWRGVEPDTSGVLK
FT                   LLRDKLQADAQ"
FT   gene            40004..40279
FT                   /locus_tag="Shewmr7_0036"
FT   CDS_pept        40004..40279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0036"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   son:SO0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41042"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0R3"
FT                   /protein_id="ABI41042.1"
FT                   /translation="MNQSILFPDLQHWDETQKHICFIAQQQGMNIKCYISAQKLAQLND
FT                   FSPQPNSDEAAAMLALFDAVRFDAEEMAEALIEAEEFDEFGAVHLG"
FT   gene            complement(40336..40884)
FT                   /locus_tag="Shewmr7_0037"
FT   CDS_pept        complement(40336..40884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0037"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: son:SO0042 carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41043"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0R2"
FT                   /protein_id="ABI41043.1"
FT                   /translation="MSGPLRTYQGIHPQLGDNVYVDPASVLVGDIALDTDASIWPMVAA
FT                   RGDVNHIRIGKRSNVQDGSILHVTRKSASRPEGHPLLIGDDVTIGHKAMLHGCKVGNRV
FT                   LVGMGAIILDGAILEDDVILGAGSLVPPGKVLQSGYLYVGSPAKQARPLTEAELKFLPE
FT                   SADNYVRLKNEYLAEPQPE"
FT   gene            41406..42940
FT                   /locus_tag="Shewmr7_R0001"
FT   rRNA            41406..42940
FT                   /locus_tag="Shewmr7_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            43248..46140
FT                   /locus_tag="Shewmr7_R0002"
FT   rRNA            43248..46140
FT                   /locus_tag="Shewmr7_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            46362..46477
FT                   /locus_tag="Shewmr7_R0003"
FT   rRNA            46362..46477
FT                   /locus_tag="Shewmr7_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            46514..46590
FT                   /locus_tag="Shewmr7_R0004"
FT                   /note="tRNA-Asp1"
FT   tRNA            46514..46590
FT                   /locus_tag="Shewmr7_R0004"
FT                   /product="tRNA-Asp"
FT   gene            46906..47160
FT                   /locus_tag="Shewmr7_0038"
FT   CDS_pept        46906..47160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0038"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   son:SO0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41044"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0R1"
FT                   /protein_id="ABI41044.1"
FT                   /translation="MNCRLGCGACCIAPSISSGIPGMPNGKAAGERCVQLSDDNLCLIF
FT                   GSPDRPAVCSDFEASLDVCGDSNEEALWLITNLESQTSQ"
FT   sig_peptide     46906..46965
FT                   /locus_tag="Shewmr7_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.770) with cleavage site probability 0.393 at
FT                   residue 20"
FT   gene            47182..47637
FT                   /locus_tag="Shewmr7_0039"
FT   CDS_pept        47182..47637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0039"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   son:SO0045 Rrf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41045"
FT                   /db_xref="GOA:Q0I0R0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0R0"
FT                   /protein_id="ABI41045.1"
FT                   /translation="MQLTRYTDFGVRTLMYLAVQPDRTTLFRIAEITEVFDLSPNHVSK
FT                   IVHHLGKLGYLETIRGKMGGFRLGKPASEINLGQLIRALENSLAPIDCSKPYCRFTPAC
FT                   QLKGVLAQAVQAYLNVLDQYSLQDIVSNRNELLALLPDMTISVLQLD"
FT   gene            complement(47612..48367)
FT                   /locus_tag="Shewmr7_0040"
FT   CDS_pept        complement(47612..48367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0040"
FT                   /product="protein of unknown function DUF610, YibQ"
FT                   /note="PFAM: protein of unknown function DUF610, YibQ;
FT                   KEGG: son:SO0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41046"
FT                   /db_xref="GOA:Q0I0Q9"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Q9"
FT                   /protein_id="ABI41046.1"
FT                   /translation="MRLFYILALWALSIAPSNAAQIALIIDDIGYRHTDEAVLSLPSAV
FT                   TLSVLPHTPLSNKLAKAAHAKGHEIMLHLPMQALNGKALGVGGLTNNMSETQIRSSVLA
FT                   AIASVPFAKGANNHMGSLLTQLDDPMLWVMETLKQKQLYFVDSMTTKFTKAGDKADSLG
FT                   VPLLRRQLFLDNDVSAAALEKQFNLMISQAHSQGSLVAIAHPYPETIHFLKTNLARLKA
FT                   EGIELVPTSSLLPIELAHEKGTNPTVRQR"
FT   sig_peptide     complement(48308..48367)
FT                   /locus_tag="Shewmr7_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.935 at
FT                   residue 20"
FT   gene            complement(48380..49585)
FT                   /locus_tag="Shewmr7_0041"
FT   CDS_pept        complement(48380..49585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0041"
FT                   /product="C-terminal processing peptidase-3. Serine
FT                   peptidase. MEROPS family S41A"
FT                   /note="KEGG: son:SO0047 carboxyl-terminal protease,
FT                   putative; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41047"
FT                   /db_xref="GOA:Q0I0Q8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Q8"
FT                   /protein_id="ABI41047.1"
FT                   /translation="MKQLIRNIVCLGLGLSLGLSISLSSQENAKSYQSDFDYPLLQDVL
FT                   ETVETYYVKTVSKDELVQAAIKGIFEHLDPYSSFLNHQELLDLKDSNRGEYFGFGFEVA
FT                   SDKDHISIIAPFANSPAEQAGIQAGDIIIKLNDTPTTETNLADILNQIKQHSLSNQSIR
FT                   LTLKHRNDAVEFEVSLKPSTITIQSVASKLLDGNIGYVRLSSFQENSTEDMVRSLSQWQ
FT                   NAHLTGLILDLRNNPGGLLDQAIKIADLFLAKGRIVSTSGRFFDANSDYYASPQTMLTN
FT                   VPMLVLINKGSASASEVLAAALQENGRAKLLGETSFGKGTVQSLIPILNDGNAIKLTIA
FT                   QYNTPRGENIHDIGIVPDIKVAAETGSNQKNMAIIDTISARTDVSQDSLVTSAIAWMQH
FT                   HD"
FT   sig_peptide     complement(49496..49585)
FT                   /locus_tag="Shewmr7_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.526 at
FT                   residue 30"
FT   gene            complement(49634..50767)
FT                   /locus_tag="Shewmr7_0042"
FT   CDS_pept        complement(49634..50767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0042"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: son:SO0048 peptidase,
FT                   M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41048"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Q7"
FT                   /protein_id="ABI41048.1"
FT                   /translation="MSTRLPVKASIIAGFMMLSFSVYASDLEKRQSELKSIQAQINQQQ
FT                   SALKNTSKQREKLLALLRSDEEAIAAAAKKVNSTKNSLAQIDTKLAELKQRQEELETLK
FT                   VSQQKTLSKQLSSAYLAGNHDYTKMMLNQQSPATIERMLAYYQYLNKARMNSINELKKT
FT                   ITELDEIKVSQTSKQKQLTKLMAEQQVQSKRLNQEQDQRQLTLKELQRTLNTKGAELEQ
FT                   LQIEEASLKRVVEQALKAMRDNPSMEGFDKQGGKLKWPTKGRVSASFGSPRSGQVVWKG
FT                   TMLSAPEGQNIRAVSGGKVIYADWLKGFGMVMVIDHGKGYMSLYGHAQALLKSPGDMVK
FT                   TGEAIALVGRSGGQTEPGLYFEIRYKGQAVDPAKYCR"
FT   sig_peptide     complement(50693..50767)
FT                   /locus_tag="Shewmr7_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(50778..52322)
FT                   /locus_tag="Shewmr7_0043"
FT   CDS_pept        complement(50778..52322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0043"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: son:SO0049 phosphoglycerate mutase; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41049"
FT                   /db_xref="GOA:Q0I0Q6"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Q6"
FT                   /protein_id="ABI41049.1"
FT                   /translation="MTTTKRPIALLILDGWGYRENTHMNAIYHANTPVLDRLNAQYAHG
FT                   LISGSGLDVGLPDGQMGNSEVGHINLGSGRIVYQELTRISKAIADHEFEQNPALCDAVD
FT                   AAVKAGGAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAK
FT                   GSLSHFDDLFTTLGHGRIASIIGRYFAMDRDNRWDRVSQAYDLITQGKAKFQYDNAVTA
FT                   LEAAYERNENDEFVSSSAITDSEGKVASLNDGDALIFMNFRADRARQITRSFINADFDG
FT                   FERAVTPKVNFVTLTEYAADIKAPIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHV
FT                   TFFFNGGKEEPFNGEDRILINSPKVATYDLQPEMSSTELTDKLVAAIESAQYDVIICNY
FT                   PNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAKVGGECIITADHGNAEQMTDETTGQ
FT                   AHTAHTSELVPFVFVGRDATIDEGGKLSDVAPTILHLMGETIPAEMTGKPLIHVKE"
FT   gene            52588..53022
FT                   /locus_tag="Shewmr7_0044"
FT   CDS_pept        52588..53022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0044"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: son:SO0050
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41050"
FT                   /db_xref="GOA:Q0I0Q5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Q5"
FT                   /protein_id="ABI41050.1"
FT                   /translation="MQEYIEFFKAHTLLSLAWVGLFVMLVVSVIKSSFSKIKNVTHQEL
FT                   TIMVNRQDAKVVDVRSNDEFRKGHIVDAVNVTLADIKNNQVSALEKFKGSPIILVCNAG
FT                   MTSSQAAQLLSKQGFENLYNLKGGMGEWQAANMPVSKSKR"
FT   gene            53284..53769
FT                   /locus_tag="Shewmr7_0045"
FT   CDS_pept        53284..53769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0045"
FT                   /product="protein translocase subunit secB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: son:SO0052 protein-export
FT                   protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41051"
FT                   /db_xref="GOA:Q0I0Q4"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Q4"
FT                   /protein_id="ABI41051.1"
FT                   /translation="MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKL
FT                   DLDTRSAKLADDVYEVVLSLTVTAQNAGETAFLCEVQQAGIFSIAGLSEPQLAHSLGAY
FT                   CPNILFPYAREAVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAAAAPAAEEANA"
FT   gene            53774..54790
FT                   /locus_tag="Shewmr7_0046"
FT   CDS_pept        53774..54790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0046"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; Ketopantoate reductase
FT                   ApbA/PanE, N-terminal domain protein; KEGG: son:SO0053
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41052"
FT                   /db_xref="GOA:Q0I0Q3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Q3"
FT                   /protein_id="ABI41052.1"
FT                   /translation="MKNSADITVLGAGSYGTALAISLASNGHKTLLWGHDPAHMQTLAQ
FT                   DKCNQAFLPGIAFPECLHIEADLAKALAASNNVLVVVPSHVFGSVLAQAKPLLRQDARI
FT                   VWATKGLEPETGRLLQDVARDVLGEQYPLAVLSGPTFAKELAMGLPTAISVAGTCPKFT
FT                   AELVELLHSPKRLRVYANDDFIGLQLGGAVKNVIAIGAGMSDGIGFGANARTALITRGL
FT                   VELTRLGEALGASTATFMGMAGLGDLVLTCTDNQSRNRRFGLALGKGCDVDTAQAEIGQ
FT                   VVEGYRNTKEVFTLAKRMGVEMPITEQIYQVLYQGKAPLDAAKELLSREKKSETPAQ"
FT   sig_peptide     53774..53857
FT                   /locus_tag="Shewmr7_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.407 at
FT                   residue 28"
FT   gene            55029..56213
FT                   /locus_tag="Shewmr7_0047"
FT   CDS_pept        55029..56213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0047"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: son:SO0054
FT                   conserved hypothetical protein TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41053"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Q2"
FT                   /protein_id="ABI41053.1"
FT                   /translation="MKHHDVIIIGAGAAGLMCAATAGYRGRDVLVLDNAKQAGRKILIS
FT                   GGGRCNFTNLKVEPANFICGNPHFVKSALARYPSQQFIELVERHGIEYHERDHGQLFCN
FT                   DSAKEIVTMLLTECEWAGVSIKLRTDILAVSKTEAGRFELNTSNGELSCDSLVIATGGL
FT                   SMPKLGATPYGYQLAEQFGLKVLPTHAGLVPFTWHSEDKIRFEPLSGIAVPSRITAKDG
FT                   TAFSEALLFTHRGLSGPAILQISNYWKAGETIEINLLPNMDVAQALEQQLATHPKQSLR
FT                   NTLSQWLPKRLVEVLFDEALLNKALNQLVHAERAKLVDDLHRWTVLMNGTEGYRTAEVT
FT                   LGGVDTHELSSKTMEAIKVPGLFFIGEVMDVSGWLGGFNFQWAWASGVAAGRVV"
FT   sig_peptide     55029..55097
FT                   /locus_tag="Shewmr7_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.575 at
FT                   residue 23"
FT   gene            complement(56438..59131)
FT                   /locus_tag="Shewmr7_0048"
FT   CDS_pept        complement(56438..59131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0048"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   son:SO0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Q1"
FT                   /protein_id="ABI41054.1"
FT                   /translation="MSNYDVKDLAEYMRRAKRDNKPFVLFTGAGCSKSAGIPLASELVN
FT                   EINEKHALDLKALSATDRHDYGRCMAALTKDDRRELLQDYIQKARINWAHIVQALLLEK
FT                   GYIQRVLTFNFDNILSRSCGLLGLYPSIYDFTSANLDLLSLIIDPSIVHLHGQSHGFVQ
FT                   LNTEEETKRHAEKLSQFVANTLNQSPSIFIGYSGNADAFFPLLKDKFTDQKRLFWVGRS
FT                   EKAPHHVNENLIAPNNVAHYLHHEDADRFFIELAQELECFPPKAFDDPYGHLLDQLEPV
FT                   LDFPTQPHNELDILASTRSMLKKSQEEREQRARPNFERLLMKGNYNELIVLAKDTELDE
FT                   EEKAVVAWAEIALGDQLVEQAKKAQQQKLFEQSFEKYQAALAIKPDMYEALNNWGIALS
FT                   ELAQLKQEPALFEQSIEKYQAALAINPDDHEAINNWGIALSDLAQLKQEPALFEQSFEK
FT                   YQAALAIMPDDHQTLFNWGIALSELAQLKQEPALFEQSAEKYQAVLAIKPDKHEALFNW
FT                   GNALSELAQLRQEPALFEQSFEKYQAVLAIKPEKHTALFNWGIALSELAQLKQEPALFE
FT                   QSIEKYQAALAIKPDKHEALLNWGNALSELAQLKQEPALFEQSIEKYQAALAIKPDKHT
FT                   ALNNWGNVLSELARLKQEPALFEQSIEKYQAVLAIKPDEHKALFNWGIALSELAQLKQE
FT                   PALFEQSFEKYQAALAIKPDEHEALFYWGIALSELARLKQEPALFEQSFEKYQAVLAIK
FT                   PDEHEAFFNWGIALSELAQLKQEPALFEQSAEKYQAALTIKPDKHQALNNWGIALSELA
FT                   KLQQKTELFEEAKSKFIQARSLTNQPNYNLACIYSLLHDDFNCREELLACYKTKILPDK
FT                   NHLNTDSDLDFVRGKEWFKELLDTLP"
FT   gene            complement(59421..60782)
FT                   /locus_tag="Shewmr7_0049"
FT   CDS_pept        complement(59421..60782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0049"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: son:SO0057 potassium uptake
FT                   protein, Trk family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41055"
FT                   /db_xref="GOA:Q0I0Q0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Q0"
FT                   /protein_id="ABI41055.1"
FT                   /translation="MVQWHPSLTLEHTPKSGKKLFGAPPFILSVSFALLILVGTCLLKL
FT                   PIATESPITWLQSLFTVTSAVTVTGLVVVDTGSVFTPFGQVIIALLIQCGGLGLMTFAI
FT                   VTLIALGGKIGFLQQTVAKEAFNQTDTSTLVSTAKAVLVFSLLVEAVGMLILSVYWSGE
FT                   LGWQTSLFHGFFYTVSAFNNAGFALSPDSLIPYVADPVVNLTITGLFIVGGLGFSVWID
FT                   LKRNKRWSKLTVYSRMMITGTILINAVAVIAIYLIEYNNPNTLAPLSELGKWLASWFQA
FT                   VTPRTAGFNTLPIDQLEDGSTLLILVLMFIGGGSLSTASGIKVVTFMVLTLATYGYLRR
FT                   DEAVYVFKREIPKDTISKALALTMISIGVTWLAIFALVLTEKAPIMDIAFEAVSALGTV
FT                   GLSRGLTGNLSSAGQGIIIFMMFMGRLGPLMLAYFLANPRVKKLRYAETKLAIG"
FT   gene            complement(60784..61482)
FT                   /locus_tag="Shewmr7_0050"
FT   CDS_pept        complement(60784..61482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0050"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: son:SO0058
FT                   potassium uptake protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41056"
FT                   /db_xref="GOA:Q0I0P9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P9"
FT                   /protein_id="ABI41056.1"
FT                   /translation="MAHFTVIGLGRFGVAASLELIHLGHTVTGVDSDPKIVEKYVESLT
FT                   EAVICDCADEASLRELDLTNCEAVLVAIGEDMQSSLLCTLALKNLGVQTIWVKASTKAH
FT                   HTIVSKLGVARIIHPEEEMGIRVAQSLNYPMVNNFLAIGDGLYIVEIHIKAQLHHTTVG
FT                   QLLGSLQEHSADEQTNVPRNPKGKVAALMVKREHNVFSKIDSDFSLHTEDALFLCGSRA
FT                   ELKQLAPRLV"
FT   gene            complement(61527..62216)
FT                   /locus_tag="Shewmr7_0051"
FT   CDS_pept        complement(61527..62216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0051"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO0059 transcriptional
FT                   regulatory protein KdpE"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41057"
FT                   /db_xref="GOA:Q0I0P8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P8"
FT                   /protein_id="ABI41057.1"
FT                   /translation="MAYKVLVVDDEPQIHTFMRISLEAEGFEYLSATSIATALKQYQSH
FT                   QPHLIVLDLGLPDGDGIELLHGLRQQDKTPVLVLTARDQEEEKIRLLEAGANDYLSKPF
FT                   GIRELIVRIKVLVRDLVDTSSTIDMLQFGPLTLQKSSHQCWLNQQEVALTKKEFALLAQ
FT                   LMSHPGQLLKQSELLRNIWGETHQEDSHYLRILVRQLRKKLNDSDEQQLIKTEPGLGYR
FT                   LTDLGPP"
FT   gene            complement(62217..63263)
FT                   /locus_tag="Shewmr7_0052"
FT   CDS_pept        complement(62217..63263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0052"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: son:SO0060 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41058"
FT                   /db_xref="GOA:Q0I0P7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P7"
FT                   /protein_id="ABI41058.1"
FT                   /translation="MTFANTASINQYWRTHPALFTAMLLVIALLTSYLIDYFSGSAIAV
FT                   LLILQLAVVAVALQCSANYAYFVAVFGAVSFNFLFTTPRYSLQMFNVEDIVNLSVFLLV
FT                   ALTSSKLAEHYRRQQQALEQAQLRNSILLSVSHDLRTPLATIIGTLTTLKEYQAKLSPE
FT                   QNEELIDSAAAESHRLHQYIENLLQATKLQHGALKFSLDEANLREVLQRTIARFQTAQP
FT                   RIQIHSEPELPPLMICSSLIEQAIFNVLDNALRYSPAELPVTVNLYRHQQLLRIDIQDL
FT                   GQGIAPADAEAIFELFYRQHPSTDGGAGLGLAVAKGIITAHRGSIGAESVAQGSLIRIA
FT                   LPITTEAA"
FT   sig_peptide     complement(63129..63263)
FT                   /locus_tag="Shewmr7_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.665) with cleavage site probability 0.614 at
FT                   residue 45"
FT   gene            complement(63491..64414)
FT                   /locus_tag="Shewmr7_0053"
FT   CDS_pept        complement(63491..64414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0053"
FT                   /product="Pirin domain protein domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein; KEGG: csa:Csal_1778 pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41059"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P6"
FT                   /protein_id="ABI41059.1"
FT                   /translation="MSEVQAQFYGGPRECPVEDGRIQIQHIAPKISDVGGIPVARAIPQ
FT                   KPRRLIGPWCFLDHIGPVTDGPLMNVGEHPHIGLQTFTWMLEGEIMHRDSLGSAQVIRP
FT                   KQVNLMTAGHGIAHTEESVEGHRTMHAVQLWIALPLEHKDTAPRFDHYPQLPTWQEAGV
FT                   EFTLLIGSWKDKQAPTLHFSPIVALDIFAAEATQLTLRLDPRFEYGLMPLEGRFDIDDE
FT                   TFDNNNLAYLGMLRESLTLDLHPGARILLIGGAPLADTVSIWWNFVGHSKEDIASAQAD
FT                   WEAKSPRFATVPGYNGKRLMPPPIPW"
FT   gene            64899..66572
FT                   /locus_tag="Shewmr7_0054"
FT   CDS_pept        64899..66572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0054"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase internal region; 5TM
FT                   Receptors of the LytS-YhcK type, transmembrane region;
FT                   KEGG: cvi:CV1771 probable sensor kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41060"
FT                   /db_xref="GOA:Q0I0P5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P5"
FT                   /protein_id="ABI41060.1"
FT                   /translation="MLENQMMLLAVFERAALMLMTLFFLTRTRPFQRLFQKRNHTPAEL
FT                   VSVAAIFCLFAVFSTYTGIEVEGALVNVRIIAIISGGILFGPWVGIPAGVLSGLHRYLI
FT                   DMDGDTSIPCLIASIIAGLMATWIYYKCPKSKLWIYGIAAGMLCETLTMLLIWLLTEPH
FT                   EVGVEIVSHIAYPMIAGTVCIGLIIKLVQDLDDEKELIAAKQAKLALDIANKTLPFFRK
FT                   IDRQALEQVCAVIRNEIHADAVAITDTRDVLAYMGVGKDYYEVDGHQAISEMTQRAIEL
FT                   DQNIINNDLRQYHLSDFHSVIIIPLRENGTVSGTLKIYYRNNYRITSSLREMAVGLSQL
FT                   ISTQIEVSRIEQLQEMTRKAEFTALQSKINPHFLFNALNAISSLIRIRPQQARELIANL
FT                   ADYLRYNLDKGDELIDIQEEVKQVRDYVAIEQARYGDKLEVVFDVDDVHFCVPCLLLQP
FT                   LVENAILHGIQPRSAPGRVTIEVKKLDAGIRVAVRDTGYGISQEVIDGVAAGRIESSSI
FT                   GLTNVHQRVKLLYGEGLQLKRLNPGTEVSFYLPENEAQVC"
FT   gene            66566..67297
FT                   /locus_tag="Shewmr7_0055"
FT   CDS_pept        66566..67297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0055"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: cvi:CV1770 probable two-component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41061"
FT                   /db_xref="GOA:Q0I0P4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P4"
FT                   /protein_id="ABI41061.1"
FT                   /translation="MLKAIIVEDEYLAREELEYLVKSHSEIDIVASFEDGLEAFKYLQD
FT                   HEVDVVFLDIQIPSIDGLLLAKNLHKSTHPPHVVFVTAHKEFAVEAFELEAFDYILKPY
FT                   NEPRIISLLQKIEQVGRQAPKPQHEAASNASRTVNLVKGERIIVTPCEQIYYAEADEKL
FT                   TYVYTRTDRYVMQMTISEFVSRLPAEGFFRCHRSYCVNINKIREIVPWFNSTYLIRLHD
FT                   LSFEVPVSRSNIKAFRQLMRL"
FT   gene            67405..68649
FT                   /locus_tag="Shewmr7_0056"
FT   CDS_pept        67405..68649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0056"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cvi:CV1769 probable resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41062"
FT                   /db_xref="GOA:Q0I0P3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P3"
FT                   /protein_id="ABI41062.1"
FT                   /translation="MTKEMNRTRYLTLVGTIITQFALGSVYTWSLFNAQLAAKLDEPVS
FT                   QVAFVFGLLSLSLAVASSMAGKLQERFGVRNVTLGAGVLLGLGFLLTAQASNLMMLYLC
FT                   AGILVGFADGTGYLMTLSNCVKWFPERKGLISALAIGAYGLGSLGFKYINMLLLENTGL
FT                   ETTFQLWGLIAMALVLCGGMLMKDAPAQSAASQQAESRDFTLAEAMRKPQYWMLALMFL
FT                   SACMSGLYVIGVAKDIGEKMVDLPVLVAANAVAVIAMANLCGRLVLGILSDKIPRIRVI
FT                   SLAQIITLVGMVLLLFIPLNANLFFVAVACVAFSFGGTITVYPSLVSDFFGLNNLTKNY
FT                   GVIYLGFGIGSIIGSIVASLFGGFIATFNVILVLLVVALVMSLTIRLPEPKTPASAKKA
FT                   TKGTTRLVNMTAESA"
FT   sig_peptide     67405..67479
FT                   /locus_tag="Shewmr7_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.663) with cleavage site probability 0.596 at
FT                   residue 25"
FT   gene            complement(68739..69359)
FT                   /locus_tag="Shewmr7_0057"
FT   CDS_pept        complement(68739..69359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA1645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P2"
FT                   /protein_id="ABI41063.1"
FT                   /translation="MFKNTAKFFVIFSVLFLSGCAQVLTAEQSAPEINFSAAEKPLTIA
FT                   VIDKREYVIDNDKTPAFEGLIRSGFGIPYSYNTPTNEAMSVYLSNRLVAGFNKKGIKAE
FT                   SVETSPKMSIDAAVTQVSNKGNKSIIFILNEWKYDYHTLSDNSWYNLDLMIIDENGTEK
FT                   LVKNFTGENDIPEGVIVNEMQLIYKQRFEAIFKDAEVIQALNL"
FT   sig_peptide     complement(69282..69359)
FT                   /locus_tag="Shewmr7_0057"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.737 at
FT                   residue 26"
FT   gene            69785..70522
FT                   /locus_tag="Shewmr7_0058"
FT   CDS_pept        69785..70522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0058"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rfr:Rfer_1586 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41064"
FT                   /db_xref="GOA:Q0I0P1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P1"
FT                   /protein_id="ABI41064.1"
FT                   /translation="MLTDPLFWLVAIPAVLITGISKSGFAGGVGGLTVPLLALAISPAT
FT                   AAAIMLPLLIYMDFLSVRSWWGQHNPRQLWILLPAAIVGIGIAYWLFDRLNEDYLRAIL
FT                   GCVSLGFGLYGLILGDKTQATPSPLVGRLCGLTAGFTSFVAHAGGPPLNAYLLPLRLAK
FT                   PEFLATAVVFFAVVNLVKLVPYSLLGQINQGNILISLLLAPLAWLGVKLGLAIQDKISD
FT                   RLFKRIILILMVLVGIRLLWTAL"
FT   gene            70622..71101
FT                   /locus_tag="Shewmr7_0059"
FT   CDS_pept        70622..71101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0059"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: son:SO0061 lipoprotein,
FT                   NLP/P60 family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41065"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0P0"
FT                   /protein_id="ABI41065.1"
FT                   /translation="MSFTLMKRLLIVILALGLGACASAPEPKPVVKQVEPVSVWNDSNI
FT                   ADFHSEWRGVPYRLGGGTKKGIDCSAFVSVAYQKMLGMTLPRTVEEQQALGKPVARDQL
FT                   RKGDLVFFKTGWSTHHVGIYVGGNNFLHVSTSQGVKISSLLNSYWASKYWNARRI"
FT   sig_peptide     70622..70690
FT                   /locus_tag="Shewmr7_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.553 at
FT                   residue 23"
FT   gene            71126..72574
FT                   /locus_tag="Shewmr7_0060"
FT   CDS_pept        71126..72574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0060"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vch:VC1597 multidrug transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41066"
FT                   /db_xref="GOA:Q0I0N9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N9"
FT                   /protein_id="ABI41066.1"
FT                   /translation="MTPASASSQHEPLPTSVFLAIFSAVFLPMFLAAVDQTLLATATPA
FT                   IVEDLGGLRQASWITIGYMLAMAASVPIYGWLGDNFGRAKILMIALVVFALGSIVSASA
FT                   STMDHMIAGRILQGLGGGGLMSLSQSLVGELVPIRQRARFQGYFAAMFTLASVGGPVIG
FT                   GFVVHAYSWHWLFWANIPLVMLAVWRLNRLHKQSVKPVRQGRFDLLGVLLFPTIITALL
FT                   YWLSVAGQDFAWLSTTSLGFMGFICVGALVLLWWERRRESPFLPLDLLANKAIYMPLFT
FT                   AALFAACLFAMIFFLPIYLQVGLHTNPAKTGLLLMPMTFGIVTGSTIAGRLLSRDVAPK
FT                   WLPTFGMGLAFIGLLLIGLVPPNANLIGALGVLVGIGLGTVMPSVQLVVQSVSGKARLS
FT                   QITAMVSLSRSMGAAIGTALFSLLLYGLLPLDGAQVGIAAIKQLPIEVVHHAFQWGFIA
FT                   AALVALSSAIVGYFSPATALRDHE"
FT   sig_peptide     71126..71227
FT                   /locus_tag="Shewmr7_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.747 at
FT                   residue 34"
FT   gene            72663..73691
FT                   /locus_tag="Shewmr7_0061"
FT   CDS_pept        72663..73691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0061"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein, LacI;
FT                   KEGG: hch:HCH_04796 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41067"
FT                   /db_xref="GOA:Q0I0N8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N8"
FT                   /protein_id="ABI41067.1"
FT                   /translation="MTTKNWTLKSIANELGVSNATVSNAFNRPDQLSEKRRNEILAACS
FT                   KLGYFGPNKAAQSLRRGKFDTVALVLSDSVEYMVSDPVASKFMKGVASVLEREKLNLLL
FT                   FSGSSDSVNAVADFVDGFICYGRPRNALLAEQLKQVKKKVVTVDFDIHRNASVSIDNKL
FT                   AAYEVAKLALKSPTDQVAILGLRLLDTHLTCRVYDLNLLEIDMSIAHQRLQGYLQAIEE
FT                   TGVTLGNDRIWNIPESNAEYARIAAKEALNSTPRPNVFLCMSDLIALSVLGEVQAMGLA
FT                   IPEDIRVVGFDGIDEATRSNPPLTTVYQYSEQKGQMAAQMFIDDAVHAQVLGYELRLGK
FT                   SC"
FT   gene            complement(73751..75235)
FT                   /locus_tag="Shewmr7_0062"
FT   CDS_pept        complement(73751..75235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0062"
FT                   /product="Sucrose phosphorylase"
FT                   /EC_number="2.4.1.7"
FT                   /note="KEGG: atc:AGR_pTi_251 sucrose phosphorylase SplA;
FT                   PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41068"
FT                   /db_xref="GOA:Q0I0N7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N7"
FT                   /protein_id="ABI41068.1"
FT                   /translation="MKNQVQLITYVDRITGAGLKQLKALLDNELDGLFGGVHLLPFYYP
FT                   IDGSDAGFDPIDHVQVDSRLGDWDDVKNIGEAFDIMADLIVNHMSAESPEFKDVLKHGK
FT                   QSVYWDLFLTKDKVFPEGLSEQDQKAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQID
FT                   IDVNSAAGKDYLNRVLARFNHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQ
FT                   ANELGMTTLAEIHSHHMTQIDIAKRVDMVYDFALPPLILHTLFSQDCSALSHWLDMAPR
FT                   NCITVLDTHDGIGIIDVGPMDGLRGLLDEKQIDNLVETIHDNSKGESLQATGAAASNVD
FT                   LYQINCTYYDALGQNDLDYLMARAIQFFAPGIPQVYYTGLLAIPNDMTLLNQTHVGRDI
FT                   NRPYLNREKVQQALQKPVVKALIQLIKLRNSSAAFNGRFSMAASGKTLTLTWSAQNASA
FT                   SLSLDFVHKQGLITLLDEQGIETQIALADLLTQAQA"
FT   gene            75492..76712
FT                   /locus_tag="Shewmr7_0063"
FT   CDS_pept        75492..76712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0063"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ccr:CC1133 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41069"
FT                   /db_xref="GOA:Q0I0N6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N6"
FT                   /protein_id="ABI41069.1"
FT                   /translation="MVSDSNSVENRHHTRIRVLTYLMFFMFAMTSDAVGVIIPQLISEF
FT                   GLSLSQASAFHYMPMIFIAISGLFLGFLADKIGRKLTILLGLLLFAIACFLFALGESFY
FT                   YFLLLLALVGLAIGVFKTGALALIGDISRSTKQHSSTMNTVEGFFGVGAMVGPAIVSYL
FT                   LISGVSWKYLYFGAGVFCLLLCWLAFRADYPQVKRSSTETINLTNTFSMMKNPYALGFS
FT                   LAIGLYVATEVAIYVWMPSLLQEYQGDYTVLAAYALTIFFTLRAGGRFLGGWILNHFSW
FT                   QQVMFWFSLAISLCYLGSMLYGVEAAVILLPLSGLFMSMMYPTLNSKGISCFPVAQHGS
FT                   VAGVILFFTAVSAALAPLCMGLVGDIFGHVKYGFYLATGFSVLLCLLAGVNLIKDPSQA
FT                   LLSRETA"
FT   gene            76972..79368
FT                   /locus_tag="Shewmr7_0064"
FT   CDS_pept        76972..79368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0064"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: ccr:CC1136 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41070"
FT                   /db_xref="GOA:Q0I0N5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N5"
FT                   /protein_id="ABI41070.1"
FT                   /translation="MINRTSQQFLLSTIAVLVSSQLWAADAPAQEETKKDALGLERITV
FT                   TGVARGTRVMDSSVSVSSVSLAELEVSTPRSSAEAFRIIPGMKVESTGGEGNANIAVRG
FT                   LPVASGGAKFLQIQEDGLPILQFGDIAFGNADIFLRLDSTVQTIESIRGGSASTAASNA
FT                   PGGIINVISKTGSSDAGSVSTTFGLDYDTFRTDFEYGTSINDSLRFHVGGFVRTGEGPR
FT                   QAGYDANKGGQVKANITKEFDSGYVRLYFKHLDDKSIGYLPMPMYSDGSSVPGFNAKSD
FT                   AIQSAYFLSTLSLGADGERRRGDMRDGMNPEVNSVGLEASFDLGNDWQVENRFRFSDVS
FT                   GNFMAPFPAEVANGADIAASIAGTGAKLIYANGPDAGNPMDGLAMRIHTFDVKMNDFGS
FT                   IVNDLKLTKTFDDTSVTLGYYNATQNINMTWMWNSYLMEVKGDNAALLDVVAADGTAYS
FT                   DAGLYGYGVPYWGNCCQRNYDTEYNIKAPYLAVASSFGDLSLDASVRYDSGDASGYYAG
FT                   NVQSQVDMNLDGVISIPEQSVSSIDNANPQPVNYDWSYTSYSLGANYQFDSDLAAFGRL
FT                   SHGGRANADRLLFGKVRADGSVAKEDAVDNVDQYELGVKYRYDDLSVFATAFYSETEEQ
FT                   NFEATSQRFFDRKYKAKGIEIESAYFIGDFDFRGNVTWTDAEIAKDALTPDVVGNTPRR
FT                   QADFIYSLMGRYNFDQGSVGINLIGTTDSYAQDNNDLKFDGYNQVNAFATYNLTQALSV
FT                   SLNVNNLFDATGITEAEEGSIPDNNIIRARTINGRTTSATLRYEF"
FT   sig_peptide     76972..77046
FT                   /locus_tag="Shewmr7_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            79461..80420
FT                   /locus_tag="Shewmr7_0065"
FT   CDS_pept        79461..80420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0065"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: csa:Csal_0931 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41071"
FT                   /db_xref="GOA:Q0I0N4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N4"
FT                   /protein_id="ABI41071.1"
FT                   /translation="MTVLLSFGEVLVDLLPTDISGKSHQAIAGGAPANVAVGYAKLGGK
FT                   SYFAGGISTDDYGAMLKQALANEGVVTDYLTQVPEAPTATVVVNLDEHGERTFEFNRQG
FT                   TADLCYSQRHFDAIPWQQMDIFHLCSNTFTEAAIFNASLYGARCANSFNKIVSFDVNLR
FT                   LSLWPDIALLAERVEQCFRYTQVLKMSREEAEYLALTRNKSFEDYLQFCLAQGVEVILI
FT                   TDGANPVQCITVNERFSVPVPQIKAVDTTAAGDSFMAGFLFALGSELAFDLEHLTLKHR
FT                   LACQTQLRKAIEFAVRCGAVTCGQKGAFPALPTLSQVS"
FT   gene            80626..81159
FT                   /locus_tag="Shewmr7_0066"
FT   CDS_pept        80626..81159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0066"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: son:SO0065 molybdenum
FT                   cofactor biosynthesis protein Mog"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41072"
FT                   /db_xref="GOA:Q0I0N3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N3"
FT                   /protein_id="ABI41072.1"
FT                   /translation="MSKAKIGIVTVSDRASAGIYEDISGKAIIDTLNDYLTSEWEPIYQ
FT                   VIPDEQDVIEATLIKMADEQDCCLIVTTGGTGPAKRDVTPEATEAVCDRMMPGFGELMR
FT                   AESLKFVPTAILSRQTAGLRGDSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMEGPYLE
FT                   CNEAVIKPFRPKAK"
FT   gene            complement(81193..81414)
FT                   /locus_tag="Shewmr7_0067"
FT   CDS_pept        complement(81193..81414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41073"
FT                   /db_xref="GOA:Q0I0N2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N2"
FT                   /protein_id="ABI41073.1"
FT                   /translation="MTQRTLSQFKRLLAFGLLSLIWTLLLWLNFSIAPNAFAHFVAIPV
FT                   LFIATGVSALLITSKQSAPNNKPIKNPS"
FT   sig_peptide     complement(81298..81414)
FT                   /locus_tag="Shewmr7_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 39"
FT   gene            81566..82609
FT                   /locus_tag="Shewmr7_0068"
FT   CDS_pept        81566..82609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0068"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_B1553 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41074"
FT                   /db_xref="GOA:Q0I0N1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N1"
FT                   /protein_id="ABI41074.1"
FT                   /translation="MKRITILATDNTVASGIIGFLDVFSFCNTYWRRVNPQAEQDLFEC
FT                   QVVSSHGGDILTNQGIKVPAVGLNTPSDILHSDAVILASAMVTNKNEFQTYLNDFESLF
FT                   EPLRLFAASGKPLAAYCSGTLILAATGLLDGREATTVWWLNEMFQRHFAKVNLRMDKLV
FT                   VSDGHLHTAGATTSNMSLALHLVHILVGEQLASQMAKILLIDPNRQSQQPFMTMDLMTS
FT                   SHKDEVIWNVQQWMQHHLTEPLLLDDIADKFALGKRTLIRRFKKALNETPASYVQRLRV
FT                   DEAKRLLETTSLGLEEVVTRVGYEDVSSFRKLFIQLTSLTPRAYRQRFNTQQYEFDSDN
FT                   CCEAELH"
FT   gene            complement(82613..82873)
FT                   /locus_tag="Shewmr7_0069"
FT   CDS_pept        complement(82613..82873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41075"
FT                   /db_xref="GOA:Q0I0N0"
FT                   /db_xref="InterPro:IPR009554"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0N0"
FT                   /protein_id="ABI41075.1"
FT                   /translation="MENEYVLMVIMVTFVVGVSATEMFKHYLKIRQLGGGNERQLEDKL
FT                   TQLSLQNQVLTERVQVLERIVTDAENDTAKTSLAQQIDALK"
FT   gene            complement(82923..84062)
FT                   /locus_tag="Shewmr7_0070"
FT   CDS_pept        complement(82923..84062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0070"
FT                   /product="transport protein, putative"
FT                   /note="KEGG: son:SO0069 transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41076"
FT                   /db_xref="GOA:Q0I0M9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M9"
FT                   /protein_id="ABI41076.1"
FT                   /translation="MNKIIAMVRKELIDAARDKRSVMAGLYYAIGTPLIICGLFMVLIG
FT                   QLTSPDDLKISITNPDKAPDLVRFLSNKGITQGEAGAKDLKAIELIINPDYAKQMNQGK
FT                   GAEITIVADNSEEKLQNSIRRLEKQLQAYSAEMGSLRLIARGIDPRVVQPLKVNVHDQA
FT                   TTDSKGGMILGIAIFTMIYSVFISGMNLAIDTSAGERERNSLALLLSHPLTTRQLVLSK
FT                   IIAVGLFALLGLVLILLVSKVAYTFVPWQELGFSVSITNEFMALMLLVGIPVALMAACL
FT                   QLFVSFMAKTFKEAQSYLTMVLFVPLALSMAASYNIAPDILQWLPVSGQQQALMDFIKG
FT                   KDMSMLQLLVSTLGTLAIALVLALGMEKSLKSEKVVFGL"
FT   gene            complement(84151..84885)
FT                   /locus_tag="Shewmr7_0071"
FT   CDS_pept        complement(84151..84885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0071"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: son:SO0070 ATP-binding transport protein NatA"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41077"
FT                   /db_xref="GOA:Q0I0M8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M8"
FT                   /protein_id="ABI41077.1"
FT                   /translation="MIKVSHLSKRIGEVQALNDLSFVAENGQITGLLGPNGAGKTTCLR
FT                   TIFGLLKPDTGTAEIEGIDVAIDPIGAKQQLGLFPDPFGLYERLTPREYIRYFAELSGL
FT                   SASDAKAATDNVIAKLRLEDISDRRCKGFSQGQRMKTALAQAIVHSPSNIILDEPTRGL
FT                   DVMSTRLLRDILIDLKNQGHCVLFSSHVMQEVAALCDQVIVMAQGRVVAIGSPEQLCAQ
FT                   TGKSSLEDAFIQLIGTDEGIAA"
FT   gene            complement(84888..86495)
FT                   /locus_tag="Shewmr7_0072"
FT   CDS_pept        complement(84888..86495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0072"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: son:SO0071 hydrolase, alpha/beta hydrolase fold
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41078"
FT                   /db_xref="GOA:Q0I0M7"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M7"
FT                   /protein_id="ABI41078.1"
FT                   /translation="MIDSMIHRKSHNASADVAMKRIDTHQHSGKLSKSIISLSALMLAM
FT                   GSATAWASDNSVKPTEPANTCYVEGVSDRLNCGFVTVPENPNKPDGKQIQVHYVVLPAV
FT                   KNVNHEEALLAIAGGPGQSAIDNAAGFDSMLNKVRQQRDILLIDQRGTGRSNPLNCDSG
FT                   PQSPLAIDEDNVDTLVEAQKCRDQFPDTDVTQYGSLNAVQDFEAVRAKLGYKKLHLYGI
FT                   SYGTRMAQLYMRLYPEHLATVTIDGIVPMQQSVLEIGSAIERGFDLLFKDCQDTAACHA
FT                   EFPELKAEFDQVVAKLSQGPVMEQVHDPVTGEKTLLTMTRSKFYGAIRMALYQTNVRAL
FT                   VPHAIHQAAKGNYQPLLGLFALTTDNAGMAMGMHASVVCGEDMHRITPAMREQAKNSYV
FT                   GKTMLESLETSCSVWKVPAVDANFSEPIKSDIPTLLLSGEIDPATPPSWGELAMEKLTN
FT                   AKHFVAPYATHGVAYQSCANNLIAELVRTGSVKDLDGECLKKDVRRSFYLNASSVEPLA
FT                   TEAATQSAKDKPSTGAKE"
FT   sig_peptide     complement(86337..86495)
FT                   /locus_tag="Shewmr7_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.978 at
FT                   residue 53"
FT   gene            86588..86953
FT                   /locus_tag="Shewmr7_0073"
FT   CDS_pept        86588..86953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0073"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG: son:SO0072
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41079"
FT                   /db_xref="GOA:Q0I0M6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M6"
FT                   /protein_id="ABI41079.1"
FT                   /translation="MLELLNVNPSSGEPIYKQLHEQIVRLIVGGQLQEEDVLPSVRQIA
FT                   EYLAVNPMTVSRAIQQLVDQGWLERRRGQATRVAARTEAMESGVSLLEPQLDALLAQAK
FT                   QLGVSLPELLQLINERW"
FT   gene            87000..87863
FT                   /locus_tag="Shewmr7_0074"
FT   CDS_pept        87000..87863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0074"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: son:SO0073 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41080"
FT                   /db_xref="GOA:Q0I0M5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M5"
FT                   /protein_id="ABI41080.1"
FT                   /translation="MDQDCTPILEFSNVNKVFRGKGASEKRALKDLTLRLSAGMVVGLL
FT                   GQNGAGKSTLMRCALGILSPDSGEIRTLGETPGQLSSAAKERLGYVPQQPFGYEGFTVE
FT                   RALDLHRSFYPHWDMQLEQDWLTRFELDVTQQVQRLSVGQRQSLALIMAMAYRPELLIL
FT                   DEPVASLDPIVRRKFMVDLFDLALESGSAVLFSSHITSDLERVASHVALIKQGELVLFK
FT                   EIDALREEVRLVKLAEGAELPEQVRILSRDGDSVLVDRGDVELNLPGVQRSEALNLEQL
FT                   FVELHK"
FT   gene            87860..89170
FT                   /locus_tag="Shewmr7_0075"
FT   CDS_pept        87860..89170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41081"
FT                   /db_xref="GOA:Q0I0M4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M4"
FT                   /protein_id="ABI41081.1"
FT                   /translation="MSAAKPIAESTTRIGNSHSLNPFNGMLRLWFFDVGSVSFIGTGIF
FT                   GLALSVLAGWAGQKASFDIFVTMGLVSTSAAVAWQLIRLMASECSILIPRYRQNIFIQC
FT                   EVMLIGAFSLAVLQCVLFDLTDTLSLLVFAQGISLGFILLCLRQTQWFYSSFLLFILVP
FT                   FSNELAEQVPLWLSIIVLFVLAALIWRRCLVLPWRVEARSVYLNGLEMGWFWLPSLQSI
FT                   RILTRLERYLHPVNFFIGPMLTVLLLLLPVLTIGLGIVSHELHWNFPVLLLLAQFSVIS
FT                   CSLVHWSRVQRSRATEMLLLMPSFDGRAGLVKAFGRGQQRLLLLLSLSVLICSLFVTWL
FT                   DGDLSLPLLAHIVMSTYWACALVLGLGCLCRRVLQVSLTMLVVLGHSLWVSISLAALQH
FT                   EGSLLYWSLGNLVLLILGQIALIWGSKKLWQGDITGL"
FT   gene            89299..91092
FT                   /locus_tag="Shewmr7_0076"
FT   CDS_pept        89299..91092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0076"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   son:SO0075 AMP-binding family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41082"
FT                   /db_xref="GOA:Q0I0M3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M3"
FT                   /protein_id="ABI41082.1"
FT                   /translation="MSLEQYHVIRLLQQQSQSLKDAIALEGFEMAAPWHQVSWQAFDQI
FT                   SHKIAQVLIELGVQVQDRCVILSQNCPQWTCADIGTLKSRAVVVPIYPTSTLEQASFII
FT                   NDAAAKVIFVDDAKQYALACELQKQCPTLEHVIVFDASVELARDKAQHQHLDSLLAKEY
FT                   GQSAELEQRLKDANLDDLLTLIYTSGTTGDPKGVMLDYRNMASTVRQHDQILPFTTGDV
FT                   SLAFLPLSHVFERGWSFYVLCRGGHNVYLQNTQRVKEAISAVRPHTLCVVPRFLEKVYS
FT                   AVQDKVAKSAEGRKKLFAWAMGVGERQFEVSQGRAKGGLWLSLQWRLAHKLVYSKLQAV
FT                   LGGRLKFMPCGGAALDLNVASFFHAIGIPVLCGYGMTETNATVTCNTLDNRVAGSNGKV
FT                   LPEIEVKLGKDDEILVRGDTVMRGYYNRPEDTAAAFEDGWLKTGDAGRLDANGNLFITD
FT                   RIKELMKTSNGKYIAPQRVEGTVGRCPFIEQVAVIADARNYVTALIVPAFESLEAWAKD
FT                   KGLKYESPIELLRHSHVVEHFEQRLKHLQQELAGFEQIKKFTLLPEAFSMEAGLITPTL
FT                   KLRRKMIYHKYAHEINAMYNN"
FT   gene            91233..93722
FT                   /locus_tag="Shewmr7_0077"
FT   CDS_pept        91233..93722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0077"
FT                   /product="MORN variant repeat protein"
FT                   /note="PFAM: MORN variant repeat protein; KEGG: son:SO0076
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41083"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M2"
FT                   /protein_id="ABI41083.1"
FT                   /translation="MELSIRRLCAAVGAVLLSSFAVIPAALAAEYDKMVHGPVDLPNGQ
FT                   WLNFYQKDQQVWGEMLYGDAPGVRIDDYGRAEIVAVFYYDFDKGGTKEVIVMLKDADGQ
FT                   HLRGYGFEGEELTKLPRLQAVLDEVAPTISTFTVGGVRKVLSQLPPQQYRMTYEAEGVQ
FT                   DPDIKAILDGTSKLKPTLIGYRNSEGTATDVKTAVEYKLRYPLTRTDKDAEGRERKYSL
FT                   VATFDRSAYVEEDGSFMLVAIGYEVDDIDWLKNGSEKIPRTGPFYEFMSMGSTWAGVAS
FT                   EAHYVQGKLDGHFAAYDARNGSVMYAGDYKLGEQVGKWIEADSRETYWEGEYLDGKKQG
FT                   KWVLQSMMDDADNYGFIHYNKGVPDGPSEIYTPDYDSSTEGAKKLSEKGIYLNGVKDGE
FT                   WLESDGSKGQYQKGVKQGAWVEKVTQGDYRFQTGEGGYLDGKRSGTWVYIRTPDENDAF
FT                   TTKQSVTYLYKTEVNYENGLRQGEAKLFNKDNFMFALKHYDKGRLHGESLWYSAPNIVS
FT                   NVANYRQGELDGPQMWLEPNGDLNELSQYKFNDAVKLKPSQDECMMRKEPYAGDCEGVL
FT                   SSKNAETSSIKDGEHRVYRGGQLSELTYYTNGAVDKEYRFDSNGRLMSLQTYKAGKEYG
FT                   PSIRYSTDGGYSLVQYGHLINNRLSGPHYTFYPNGQLKSLWNYCQQEGETWNGEPYFWD
FT                   NAIARCGIQREYFDNGAVNCIEELDSNYAVDKVCYDRNGKLANEMLRIDEQHVVHKRYI
FT                   NGVIYQEEPGFSDFSHVTKGRKIYHLENPKSHGVFKSYDSSGKLKYEKIFDMGKAGCMK
FT                   KYDANGKQTPETASCQF"
FT   sig_peptide     91233..91319
FT                   /locus_tag="Shewmr7_0077"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            93830..94240
FT                   /locus_tag="Shewmr7_0078"
FT   CDS_pept        93830..94240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0078"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   son:SO0077 hypothetical 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41084"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M1"
FT                   /protein_id="ABI41084.1"
FT                   /translation="MSVTEYSLEIHPRFTETDGLGHINNTVIPVWCEAARTPIFEIFNP
FT                   ELDLHQWNLIVAGFTVAFIAPTYYGKSVTVKTYVSRIGNSSFELTQTCWQAGNKTAEVK
FT                   TTLVHYDYSCEKSRPIPEDIREILASLNGEAA"
FT   gene            94358..94906
FT                   /locus_tag="Shewmr7_0079"
FT   CDS_pept        94358..94906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0079"
FT                   /product="HPP family protein"
FT                   /note="PFAM: HPP family protein; KEGG: tdn:Tmden_1127 HPP"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41085"
FT                   /db_xref="GOA:Q0I0M0"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0M0"
FT                   /protein_id="ABI41085.1"
FT                   /translation="MRFYFTRMRSKDICPPRQPLKKIVWSWIGAFCGIYLVASLATYMG
FT                   EHLLGTMFVIGSFGASAVLVYGAPLAEFSQPRNLIGGSVLSALIGVAVYQVFADYMVLA
FT                   SALAVSLAIALMYLTRTLHPPGGATALIAVIGGENVHQLGYLYALMPVFLGTLLLLLVA
FT                   LVVNNLSTDPKRHYPVYWI"
FT   gene            complement(94927..95190)
FT                   /locus_tag="Shewmr7_0080"
FT   CDS_pept        complement(94927..95190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41086"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L9"
FT                   /protein_id="ABI41086.1"
FT                   /translation="MSEKAPIEVVVEHQQDQQRFVIPVDGHEAVLEYRLNGQHIDFNRT
FT                   FVPDELRGKGLAERLVRHGLKWAKAQDFEIAASCWYVQKFLK"
FT   gene            complement(95250..95714)
FT                   /locus_tag="Shewmr7_0081"
FT   CDS_pept        complement(95250..95714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0081"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   son:SO0080 hypothetical 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41087"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L8"
FT                   /protein_id="ABI41087.1"
FT                   /translation="MSNAMESPTLSPMEKFLAQHPIVTEIPVAWGEMDALQHVNNVVYF
FT                   RYFETARIDFFNRLFPLDALYKSGVGPVISENQARYKRPVTFPDTLLVSVSISDIQSDR
FT                   FTMHYQAFSKQQQAITTLGTSVAVMFNFKTGQKAELPTELLAILKQHEQA"
FT   gene            95862..96215
FT                   /locus_tag="Shewmr7_0082"
FT   CDS_pept        95862..96215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0082"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: sdn:Sden_1798
FT                   regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41088"
FT                   /db_xref="GOA:Q0I0L7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L7"
FT                   /protein_id="ABI41088.1"
FT                   /translation="MYIGAVAKQTGLSIKAIRLYEEWGLISAPIRKGRYRTYSATDIKQ
FT                   LLLIKEAKTLGIKLSQLKDLFTEGEQAAQLESVQQFLLNIKADFQRQISELEDKLVRLD
FT                   ACIDGLDTCESRA"
FT   gene            96287..96865
FT                   /locus_tag="Shewmr7_0083"
FT   CDS_pept        96287..96865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0083"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: sdn:Sden_1799 NAD(P)H
FT                   dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41089"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L6"
FT                   /protein_id="ABI41089.1"
FT                   /translation="MTKKILVVSGHPKPDSLCEHLADTYAKAAGESHSVRLLKLSELEF
FT                   EPNLEQGYHQEQPLEADLQRFQQAILWAEHVVIVVPIWWGSVPAKFKGLIDRTFLPGFA
FT                   FQYQQGKTFPNRLLEGRTSRIIMTMDTPPWYYKWFQGAPALKQLDIATLAFSGFKRAKS
FT                   QMLGPVINAKAQQVQNWQAQVERHGRLGR"
FT   gene            96881..97276
FT                   /locus_tag="Shewmr7_0084"
FT   CDS_pept        96881..97276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0084"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating,
FT                   GFA; KEGG: vpa:VP1790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41090"
FT                   /db_xref="GOA:Q0I0L5"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L5"
FT                   /protein_id="ABI41090.1"
FT                   /translation="MIKQVGNTQIQAKHLASCHCGAVVLELSLPNGIEKPRRCDCSICR
FT                   RKGAIVGSVPLAGLKIIKGETVLKCYEFNTKTAKHYFCSVCGIYTHHQRRSNPNEYGYN
FT                   LGCLEGVNPYELGDVPVCDGVNHPADR"
FT   gene            complement(97339..98019)
FT                   /locus_tag="Shewmr7_0085"
FT   CDS_pept        complement(97339..98019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0085"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: son:SO0084 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41091"
FT                   /db_xref="GOA:Q0I0L4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0L4"
FT                   /protein_id="ABI41091.1"
FT                   /translation="MGIRAIVVDTAGTTTDLTFIQDVLFPYSVKALPDFLAQNQHNVLV
FT                   ENCICDTRDIALEPDADLARVTEILQQWVHEDRKATPLKTLQGLIWKQGYAHGEFTGHI
FT                   FPDFIEAVNRFSAQKLRIYSFSSGSVEAQKLLFSHSDGGDLTEMFSGHFDTRTGNKLDK
FT                   QAYANILNTISLSPKQVLFVSDVVEELKAAEAAGMMTCQMVRDSKQRTGDFRTINSFDE
FT                   LVID"
FT   gene            98383..98817
FT                   /locus_tag="Shewmr7_0086"
FT   CDS_pept        98383..98817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41092"
FT                   /db_xref="GOA:Q0I0L3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L3"
FT                   /protein_id="ABI41092.1"
FT                   /translation="MRLFMKYLPAFGLGILLAVLSFVSFALVATAGYMYALLGSVDNLS
FT                   HTSPVYLGLGAHDAGLLLLLSGLMLFSYQRLFPRLPFDWYSAVAMQLPLGSLVLWADGV
FT                   SFNLTDFYGVARALTLFSATFGVLIIFGLLQRRSRRLARA"
FT   sig_peptide     98383..98463
FT                   /locus_tag="Shewmr7_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.532 at
FT                   residue 27"
FT   gene            98910..99923
FT                   /locus_tag="Shewmr7_0087"
FT   CDS_pept        98910..99923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO4661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41093"
FT                   /db_xref="GOA:Q0I0L2"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L2"
FT                   /protein_id="ABI41093.1"
FT                   /translation="MSSIEFDIPEDHRIPFQKYYKQKIAPKCAPFEAKREGVNQRRREN
FT                   AKFTTPIYYICITVILVAFAGLLGVQFMLVPMDYFVPLMIGAFLPTPVIALVAIASGKE
FT                   SNELYNAAFEKLYPISLKYFGNDYALTREPKVDFSTFLELGLLPKTDKQYAQNCLKGTY
FT                   NKVPFQFYEVDAYNTKSNNNGSVERETIFNGVLLVCNIPKRFNGTTLLVTDKGSLKNRI
FT                   EGFKTKLSRVKLEDVRFERCFEVYSSDQVEARYLLNPLMMENLLALGRELNAEVEACFY
FT                   QKQLLIKIPTKHHFFINQLDLDRPIDFKLNIERMFTELGYTFSIIDTLKLDKHTGL"
FT   gene            100052..100783
FT                   /locus_tag="Shewmr7_0088"
FT   CDS_pept        100052..100783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41094"
FT                   /db_xref="GOA:Q0I0L1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L1"
FT                   /protein_id="ABI41094.1"
FT                   /translation="MMNTIFTLSQFVHITAGALALVLFWMPAMLKKGSANHSRFGRYYV
FT                   YAMYTVAATGVMMATAGLIDPLAVIKQPAASADALAAQIADRKNAWIFLIYISLLTLVT
FT                   VRHGVLVLRYKAQRQQLKSPLHLSLMLSLTLLGPVMAIWGYQEKLILAMIFGLLGTTVG
FT                   AGFLRYSVKATLTKLEWWIEHLGAMIGSGIACYTAFFAFGGSRLFIDHGNLRLLSWTLP
FT                   GVIGFVVIRYLSGKYQRRFAD"
FT   sig_peptide     100052..100144
FT                   /locus_tag="Shewmr7_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.739) with cleavage site probability 0.564 at
FT                   residue 31"
FT   gene            complement(100874..102781)
FT                   /locus_tag="Shewmr7_0089"
FT   CDS_pept        complement(100874..102781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0089"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   cps:CPS_3202 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41095"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0L0"
FT                   /protein_id="ABI41095.1"
FT                   /translation="MSNPMKRIINALMLAMLATGCSDPNPTQTNQTAEQAKAEKAVQVL
FT                   NLKQQLAPITQRYFALRPEIATYYGVAENEAGKDVLSKLTDYSPSGENHRRKALKAILT
FT                   ELNAIDASQLSASEQVSLGSIKSEIAGALLPAETVAYGTMLGEYGVWFLPYVVNHLSGL
FT                   HVEFPGYMEDKFAVTTPEQAKAYLNRLTMYPAAMGTVIDKLDQDVQMGVIPPDFIIDKT
FT                   IAVLQQQLVHHANEHPLVSSFKAKLTAAQVPESEALVNSAAELVETKYYPATRQLISAL
FT                   QAVRLKATHVAGLGHQPQGAKLYKAMIKHLANSEMTPDEIHQLGLDEVARITAEMDVLL
FT                   KQVGYRKGTVGERMQRLLKDPKYIYPNTAEGKQQLMSDIHGYLAKVNAKLPLWFGLLPN
FT                   QEVAVEAVPDSRAAATSGAFYDAPSQDGSRKGTFWISLYDMAALPSYSLQTLTYHETNP
FT                   GHHLQTLIGLSDTLPLLSTIFYSNAAGEGWALYAERLAAEMGMYQDNPINDLGRLQSEL
FT                   HRAVRLVVDTGMHAKDWSREKAIDYAVATEGIHLSEATGEIERYVVWPGQALGYKLGEL
FT                   KIIELRTKAKKALGDKFDIKVFHDRLLENGALPLDLLEQKMDQWLESAKAANAAAETKV
FT                   "
FT   sig_peptide     complement(102692..102781)
FT                   /locus_tag="Shewmr7_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.632 at
FT                   residue 30"
FT   gene            103052..103480
FT                   /locus_tag="Shewmr7_0090"
FT   CDS_pept        103052..103480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0090"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: hch:HCH_03311
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41096"
FT                   /db_xref="GOA:Q0I0K9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0K9"
FT                   /protein_id="ABI41096.1"
FT                   /translation="MSATSLGETLHRLVHAYKKQLRADIAAQQIELPVTHIRALKGICR
FT                   HPEATAQSIALRMQRDKAQITRVLNELQQAGYILKVDNPKDGRSQLLRPTAQGEQLMTQ
FT                   IIAAEKATVAHMTQALDQDEIAVFIRIANQISDSVAES"
FT   gene            103515..104267
FT                   /locus_tag="Shewmr7_0091"
FT   CDS_pept        103515..104267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0091"
FT                   /product="FAD-binding 9, siderophore-interacting domain
FT                   protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding
FT                   9, siderophore-interacting domain protein; KEGG:
FT                   rba:RB11489 vulnibactin utilization protein VIUB"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41097"
FT                   /db_xref="GOA:Q0I0K8"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0K8"
FT                   /protein_id="ABI41097.1"
FT                   /translation="MNRPAPRELTVIGKTQVTPHMLRITLGGAGFAGFPADQESAYIKL
FT                   LFPQPGDERPLMRTYTIRQQRMNEIDVDFVLHDTDGPASRWAKSTEIGDAIQIGGPGLK
FT                   KLINLDAEWFLLAGDMTALPAISVNLAQLPSNAVGYTVIEVLSEADIQPLVHPSNVQLH
FT                   WVINPEADPEGKPLAERIAQLPKLEGQGAVWLACEFSSMRALRKLLKQTYDLPKSHFYT
FT                   SSYWKIGCNEGEHKLVKQQDEQLENGAQ"
FT   gene            complement(104334..105560)
FT                   /locus_tag="Shewmr7_0092"
FT   CDS_pept        complement(104334..105560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0092"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: son:SO0095 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41098"
FT                   /db_xref="GOA:Q0I0K7"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0K7"
FT                   /protein_id="ABI41098.1"
FT                   /translation="MSWDQVWIDVNVATMDPSISAPYGAITNAAIAVKDGKIAWLGPRS
FT                   ELPAFDVLSIPVYRGKGGWITPGLIDAHTHLVFAGNRANEFELRLKGATYEEIARAGGG
FT                   IISTVNACREADEAELFDLGRQRLNALAKEGVTTVEIKSGYGLDTETELKILRVARELG
FT                   QHHHVDVKTTFLGAHAVPPEFKDNSDGYVDLIINKMLPAVIAENLADAVDVFCENIAFN
FT                   LEQTERVLSAAKAAGLQVKLHAEQLSNMGGSELAARLGAKSVDHIEYLDEAGVKALSES
FT                   GTCAVLLPGAFYFLRETQKPPIDLLRQYGVPMVLASDFNPGSSPICSTLLMLNMGCTLF
FT                   RLTPEEALAGLTLNAAKALGIEENVGSLVVGKQADFCLWDIATPAQLAYSYGVNPCKDV
FT                   VKNGKLVHQ"
FT   gene            105758..106465
FT                   /locus_tag="Shewmr7_0093"
FT   CDS_pept        105758..106465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0093"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR, HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG: son:SO0096
FT                   histidine utilization repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41099"
FT                   /db_xref="GOA:Q0I0K6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0K6"
FT                   /protein_id="ABI41099.1"
FT                   /translation="MATPKFAEIKQYIIGCIESGEWEENARVPSENQLAELFVCSRMTA
FT                   RRALTELTDNGVLERSQGLGTFVAGRKSQSSMLAIRNIADEIKDRGHGYSVQQLALRQV
FT                   NATAPIAIALALELGSPVFHSVLVHCEQGVPLQVEERYVNPAFAPDYLEQDFSEQTPHE
FT                   YLSQVAPLTEAHHTIEAIIASGELQQRLAIPATEPCLQISRRTWSRQGVVSFAKLVHPG
FT                   SRFKLGGHLTFNK"
FT   gene            106589..108259
FT                   /locus_tag="Shewmr7_0094"
FT   CDS_pept        106589..108259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0094"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: son:SO0097 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41100"
FT                   /db_xref="GOA:Q0I0K5"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0K5"
FT                   /protein_id="ABI41100.1"
FT                   /translation="MDKRHDPSRRIIAPHGSQLSCKSWLTEAPMRMLMNNLHPDVAERP
FT                   EDLVVYGGIGRAARDWDCYDKIIEVLKRLEDDETLMVQSGKPVGVFRTHADAPRVLIAN
FT                   SNLVPHWANWEHFNELDKQGLAMYGQMTAGSWIYIGTQGIVQGTYETFVAVAKQHFGGV
FT                   AAGKWILTGGLGGMGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEAL
FT                   AMINDANASGKPVSVGLLANAADVFAELVKRGITPDVVTDQTSAHDPLNGYLPQGWTMA
FT                   QAADMRKTDEAAVVKAAKASMAVQVQAMLDLQAAGAATLDYGNNIRQMAFETGVKNAFD
FT                   FPGFVPAYIRPLFCEGIGPFRWVALSGDPEDIYKTDAKVKELIPDNPHLHNWLDMARER
FT                   IAFQGLPARICWVGLKDRARLAQAFNEMVKNGELSAPIVIGRDHLDSGSVASPNRETES
FT                   MMDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGVVIVCDGTEAAAKRV
FT                   GRVLWNDPATGVMRHADAGYEIAKNCAKEQGLDLPMLKD"
FT   gene            108309..109850
FT                   /locus_tag="Shewmr7_0095"
FT   CDS_pept        108309..109850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0095"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: son:SO0098 histidine ammonia-lyase; TIGRFAM:
FT                   histidine ammonia-lyase; PFAM: phenylalanine/histidine
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41101"
FT                   /db_xref="GOA:Q0I0K4"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0K4"
FT                   /protein_id="ABI41101.1"
FT                   /translation="MKSVNHLVLTPGSLSLAQLREISRHKLTLELAPEAINDINTSAQI
FT                   VQKVLDEGRTVYGINTGFGLLANTKIAPEDLQLLQRSIVLSHAAGTGQYMQDATVRLMM
FT                   VLKINSLSRGFSGIRLEVINFLISLVNAEVYPCVPEKGSVGASGDLAPLAHMCLPLLGE
FT                   GEMSYQGQIISAAEGLEIAGLKPIDLAAKEGLALLNGTQASTALALEGLFHAEDLFAAS
FT                   SVIGAMSVEAAMGSRSPFDPRIHAARGQKGQIDAAMVFRHLLGEESEISLSHINCEKVQ
FT                   DPYSLRCQPQVLGACLTQIRQAAEVLGTEANGVTDNPLVFQDTGDIISGGNFHAEPVAM
FT                   AADNLAIAIAELGAIAERRIALLIDSSLSKLPPFLVKNGGVNSGFMIAQVTAAALASEN
FT                   KTYAHPASVDSLPTSANQEDHVSMATFAARRLRDMSENTRGVLAVELLAAAQGLDFRAP
FT                   LMPSKAVAQAKAELREVVAYYDKDRYFAPDIDAATDLLYTASFNAYLPQGVLPSL"
FT   gene            110459..111040
FT                   /locus_tag="Shewmr7_0096"
FT   CDS_pept        110459..111040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0096"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="1.2.1.2"
FT                   /note="KEGG: son:SO0098.1 formate dehydrogenase-N,
FT                   nitrate-inducible, alpha subunit; TIGRFAM: Twin-arginine
FT                   translocation pathway signal; PFAM: molybdopterin
FT                   oxidoreductase Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41102"
FT                   /db_xref="GOA:Q0I0K3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0K3"
FT                   /protein_id="ABI41102.1"
FT                   /translation="MNRRQFFKLCAAGAATSAISALGLMSEKAYAAVREFKLIGAKETR
FT                   NNCPYCSVGCGLLMYSQGSGGKNSEHAIFHIEGDADHPVNRGALCSKGAGLVDYVNSPH
FT                   RLQYPEYRAPGSNKWERISWHDAFKRIARLMKDDRDANLIEKNADGVTVNRWLTTGMMT
FT                   SSGMANESGLATQKFARALGLVAIDTIARN"
FT   sig_peptide     110459..110554
FT                   /locus_tag="Shewmr7_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 32"
FT   gene            111089..113473
FT                   /locus_tag="Shewmr7_0097"
FT   CDS_pept        111089..113473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0097"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="KEGG: son:SO0101 formate dehydrogenase, major
FT                   subunit (formate dehydrogenase alpha subunit); TIGRFAM:
FT                   formate dehydrogenase, alpha subunit; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41103"
FT                   /db_xref="GOA:Q0I0K2"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0K2"
FT                   /protein_id="ABI41103.1"
FT                   /translation="MTNHWIDIKNSNVVIIMGGNAAEAHPVGFGWVTEAMQHNNAKLIV
FT                   VDPRFNRSASLADHYAPIRSGTDIAFLLGVIRYLISTNQVNFDYVKAYTNASYLVRDDF
FT                   DFHDGLFSGFDEAKGEYNKESWFYQLDEDGYAKVDETLEHPRCVWNLLKQHVERYDFAT
FT                   VSNITGTPTADYQVVCDAIASTHTKDRVATFMYALGWTHHSKGAQNIRSMAMIQLLLGN
FT                   IGQLGGGVNALRGHANVQGSTDMGLLAQSLPGYLKLPNDKEPTLAAHLAANTPKPLRPG
FT                   QTNYWQNYPKFYVSLLKAFWGENATPENEFGYQWLPKWDQMYDFGKHLDMMYRGKVNGC
FT                   IVQGVNAINSMPNRNKNIKALSNLKYLVVLDNLSSETATFWQNEPGFNEVDTASIQTEV
FT                   FRLPATVFAEEEGSIVNSGRWMQWHYKGANPPGEAMSDSEIVSGLLQELKHLYREEGGK
FT                   LPEPIEAINWNYIDPHNPSSIELTKELNGYDVATKRQISSFAELKADGSTASACWIYAG
FT                   SWTEAGNQMARRDNHDPSGKGITPGWAFAWPLNRRVLYNRASCDVNGKPWDEHRKIVEW
FT                   KDGKWEGIDVPDFNAKLNPQESAHPFIMQADGVGRFFALKLLKEGPFPEHYEPVESPIG
FT                   TNPLHPNVVHSPVLRWFEGVKDTIGTKEEYPYACTTYSLTEHFNFWTTHCRLAAIAMPE
FT                   TFVEMNEQLAAEKGIKNGDWVKVSSKRGHILTKALVTKRMRPLQVNGQTVHTLGIPRHG
FT                   SHNALTRKAYSCNVLTTEMGDANTGVPEYKAFLVNVEKAEV"
FT   gene            113476..114390
FT                   /locus_tag="Shewmr7_0098"
FT   CDS_pept        113476..114390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0098"
FT                   /product="formate dehydrogenase beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein;
FT                   KEGG: son:SO0102 formate dehydrogenase, iron-sulfur subunit
FT                   (formate dehydrogenase beta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41104"
FT                   /db_xref="GOA:Q0I0K1"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0K1"
FT                   /protein_id="ABI41104.1"
FT                   /translation="MATQDIIQRSGTSQATPPAQARVGGVKQIAKLFDATKCNGCKACQ
FT                   VACSEWNDLREEVGSFQGTYQNPASLSPECWTLMKYNEIEDQGKLRWQFTHSACMHCAD
FT                   PACLKACSTSGAIVQHANGTVDFDSDKCIGCGYCASACPFDIPKISAVDNKAYKCTMCS
FT                   DRLAVGLEPSCVKSCTTGALRFGTREDMLFYSEKRVNELKERGFAKAGLYNPEGVGGTG
FT                   MLMILHDVTQPETYEMPKDPQIPLSVTLWQDWVKPLGTVGLLATAAVACLHKITVGRNI
FT                   VEEDQPGYQPPEDKAQAEEEAKK"
FT   gene            114387..115028
FT                   /locus_tag="Shewmr7_0099"
FT   CDS_pept        114387..115028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0099"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   son:SO0103 formate dehydrogenase, cytochrome b556 subunit
FT                   (formate dehydrogenase gamma subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41105"
FT                   /db_xref="GOA:Q0I0K0"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0K0"
FT                   /protein_id="ABI41105.1"
FT                   /translation="MSKHNKQEMVVRHKLFDRICHWFIVAVGLVTFLTGFSFFYPSFQW
FT                   LGAIAGTPQLAKFIHPIAGLMMCLPLMLMLVRYYHHNKWEKHDLAWMLAIKDVMFENEE
FT                   KIPPIGHYNPGQKVLFRAFVLTSITLTVTGFIMWQPYFAPYFSATVVGWAIVLHAICAL
FT                   IMLMFVMVHFWMATWVEGSITGMLYGKVSKAWCRKHHPLMLDEHSDVEKH"
FT   gene            115028..115936
FT                   /locus_tag="Shewmr7_0100"
FT   CDS_pept        115028..115936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0100"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   son:SO0104 fdhE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41106"
FT                   /db_xref="GOA:Q0I0J9"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0J9"
FT                   /protein_id="ABI41106.1"
FT                   /translation="MSHTAEIPMVPGSESPLELKPLKAVDPKTVYHRRAQRLLSLAKDS
FT                   PLADYFELCRRVVAIQARLAAEADFGQLLAWGKDEAIPLSHLGSEADSYWQGLLQQLLS
FT                   DLLPQVDEDMARVLRLLMQQSPEQLTSWGSALRQGHMSEVPARFSLFIWAAMGVYWSHW
FT                   APMVIKRIDQRKVVQQNLCPICGCHPVASVIVDQPRAGLRYLHCSLCESEWHYIRAHCT
FT                   SCGQDKGTTLWSFDDAKAQVRIESCDECHGYTKMLFVEKSPLMDVAADDLATLMLDSEL
FT                   NAKGFGATTVNPLLLAHETEQ"
FT   gene            115994..117415
FT                   /locus_tag="Shewmr7_0101"
FT   CDS_pept        115994..117415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0101"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="KEGG: son:SO0105 L-seryl-tRNA selenium transferase;
FT                   TIGRFAM: L-seryl-tRNA selenium transferase; PFAM:
FT                   L-seryl-tRNA selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41107"
FT                   /db_xref="GOA:Q0I0J8"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J8"
FT                   /protein_id="ABI41107.1"
FT                   /translation="MMTLVPDTPQALYRALPSMDSLLADAILAPLLQSYGKAAVKAALD
FT                   SQLRTARELIAQERRLPAWCANPSLLNGYLVDQLSKDYSHSLKPVWNLTGTILHTNLGR
FT                   AQQSEAAIRAVTSVMRYPTPLEFELAAGERGHRDNAISGLIQRLTGAEACCVVNNNAAA
FT                   VLLMLSAVAAGKEVIVSRGELVEIGGAFRIPDIMRQAGCTLVEVGSTNRTHLKDYEQAI
FT                   TENTAAIMKVHTSNYHISGFTASVDEARLGQLCRERGVALISDLGSGSLTDLRRFGLKQ
FT                   EPTPQAMLADGVDLVSFSGDKLLGGPQSGLIVGKQTLINKLQSHPLKRALRCDKLILAA
FT                   LEATLIHYLNPETLDRELPIMAKFARSQAELRQIGERLQRALAPLFAPSYGIELVECQT
FT                   QVGSGSQPDTFLPSIALCFNAQEGGSLTLLEQHFKQAQRPVIGRMTQDQLRLDLRGIDD
FT                   EAELLAELSTLGVQL"
FT   gene            117412..119433
FT                   /locus_tag="Shewmr7_0102"
FT   CDS_pept        117412..119433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0102"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein; KEGG:
FT                   son:SO0106 selenocysteine-specific translation elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41108"
FT                   /db_xref="GOA:Q0I0J7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J7"
FT                   /protein_id="ABI41108.1"
FT                   /translation="MIMVTAGHVDHGKSTLIRALTGMNTDRLPEEKRRGMTIDLGYAFM
FT                   PLQDGTRLAFIDVPGHEKFINNMLVGVSHVRHALLVLACDDGVMPQTREHLQILALLPL
FT                   NSLTLVLTKRDLVDDQTAAKLTLEGMALLAEYGIEASGVFEVCGNDAGDAGVDTLKQHI
FT                   LEIAEQQSTQAEDASSFRMTLDRAFSVKGAGCVVTGTVISGSVCVGDSLYSSGQKAKLR
FT                   VRGIHCQGMEVHRALSGTRVALNLTGVDNHRAPARGDWLSSLPQAELCARPVVQIRSFE
FT                   PLTHWQNVHCHHGADHTLGRVSLLDEADEQGRYLAEIVLDKPLLLCQDDPIVLRHVGGK
FT                   QTLGAGRVLALKVPNRKKRTPERVSKLQQLAKLSNPVNVLALLGQSEALSIDEIRWRWQ
FT                   LTDEGLAAMLAQAGLTRLGAYGLSTQLLEQEKQQFIELLREYHQQHPDQLGLGRNRLQR
FT                   MSHNVLPSELANKVLDSLCQDGQMVLRGALLQLADHRIVLDSEAQQCWQRLAPWLALQT
FT                   SPVWVTEMGEYLELEPAKLRLLCFQLVQQGFITAVVKDRYLLSEQLCHYANLVREHVET
FT                   HGKLETAEFKDLIGLGRKVSIQLLEFFDRSGFTRRKYRSNSREIRDGELFYSHENWRKN
FT                   IGVEPTQDCWQPYPDLKSGRLTGDDVLPFEDRPIVENA"
FT   gene            complement(119309..119399)
FT                   /locus_tag="Shewmr7_R0005"
FT                   /note="tRNA-SeC(p)1"
FT   tRNA            complement(119309..119399)
FT                   /locus_tag="Shewmr7_R0005"
FT                   /product="tRNA-Sec"
FT   gene            119541..120377
FT                   /locus_tag="Shewmr7_0103"
FT   CDS_pept        119541..120377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0103"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: son:SO0107 formate dehydrogenase accessory protein
FT                   FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41109"
FT                   /db_xref="GOA:Q0I0J6"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J6"
FT                   /protein_id="ABI41109.1"
FT                   /translation="MEYHSHAVVTERKVTLLEQGQASELTDYVANEVRVALVYNGIAHT
FT                   VMLASPENLEEFAIGFTLSERIVSHVNEIKGVDLEFTPEGVLIQVEITQRCFMELKQQR
FT                   RNMAGRTGCGLCGVAQLEEAVKPVIRVDSDARFNIDHLQLALEQIKENQHHFKLTGATH
FT                   AAMGLDEEGQIIAAFEDIGRHIALDKLIGGFSMRKAERPVAVLLTSRASFEMVQKAASA
FT                   NIQILFAMSAVTSLALELAEKSNITLIGFCRNGRATLYTHSYRLLGINRGCLAKAI"
FT   gene            120502..121716
FT                   /locus_tag="Shewmr7_0104"
FT   CDS_pept        120502..121716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0104"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE;
FT                   KEGG: son:SO0108 hypothetical transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41110"
FT                   /db_xref="GOA:Q0I0J5"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J5"
FT                   /protein_id="ABI41110.1"
FT                   /translation="MTWQQFKLQYLVRFWAPMPAVIAAGILSTYYFGLTGTFWAVTGEF
FT                   TRWGGHLLQLVGANPETWGYFKVIGLQGSPLDRIDGMMIIGMFGGCIAAALWANNVKLR
FT                   MPQSRIRIAQALIGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSYFGA
FT                   RFTLLPMFRIPVKLKKVDKATSVKQDENQARRRFRIGMLVFAAIIGWGLLTMFNAPKLG
FT                   IAMLCGVGFGLLIERAQICFTSAFRDMWITGRTHMAKAIILGMAVSAIGIYSYVQLGVP
FT                   PKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQVHFWWVGLGNVLGSTLLAYY
FT                   WDDLAQPLATSWGKVNLLSSFGDKGGLLLTYLLLALSFAAMLLWEKRFFARKAKRDEQL
FT                   IVEAA"
FT   gene            121716..121949
FT                   /locus_tag="Shewmr7_0105"
FT   CDS_pept        121716..121949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0105"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: son:SO0109
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41111"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J4"
FT                   /protein_id="ABI41111.1"
FT                   /translation="MSQYIPDYQLDMVGEPCPYPAVATLEAMPTLKPGEILEVISDCPQ
FT                   SINNIPLDAKNHGYKVLEIEQNGPTIRYLIQR"
FT   gene            complement(122011..123354)
FT                   /locus_tag="Shewmr7_0106"
FT   CDS_pept        complement(122011..123354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0106"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: son:SO0110
FT                   hypothetical protease"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41112"
FT                   /db_xref="GOA:Q0I0J3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J3"
FT                   /protein_id="ABI41112.1"
FT                   /translation="MEQAISTGNDNPIQMADTVYSKEKSLFTILAIISGLIWAVLILAT
FT                   KGLALIYVLMFFIIYLFTHSAFISYLKGTAVEISPEQFPDLHKQYLTCCECLEVKEPPR
FT                   AYLLAADGMLNALATRFLRRNYIVLFSSIVDALESDKDALNFYIGHELGHIRRNHIGKE
FT                   PLLVFATWLPLVGAAYARACEYTCDLHGLRCCNSLRSATNAVAVLAAGVEQWKRMNVDQ
FT                   YIRQTQESSGFWMSFHELNSSYPWLTKRMARVQATAQGKVYSAPSRSVFAYLFSLFMPR
FT                   MGTAGGGIIILAAIIGVAAAVAIPAYKEYQEKAGAASINYDDANYATSTPQMDTESAKV
FT                   PDVALAIEHIDQLHQSLAPITEVLTQYYQSHKAWPTEIEPLGFTDEQLTTFNLYSEGIV
FT                   GFVAGEALGDYQGFDVYLSPQVDEQNNVTWVCSSNDIPDEYLPADCQG"
FT   gene            complement(123471..124085)
FT                   /locus_tag="Shewmr7_0107"
FT   CDS_pept        complement(123471..124085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41113"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J2"
FT                   /protein_id="ABI41113.1"
FT                   /translation="MNTHTKVFGGLLILALIPCGIWAAQQASTQSSSDTQISINSRNYP
FT                   DFSWIYVRQDGELTIGAGESQDWNKLKRQGNAYQTDYLWVKTGGNRYVITDPALVNQVK
FT                   EAVRPMQIQGEKMQRLGEQMQVKGDAISAETSKLVANIASGEKDAEVNAQIESLGASMD
FT                   VMGKEMEQLGEEHQALVDVAEKQVYELAQNAIKNGTAVLAP"
FT   sig_peptide     complement(124014..124085)
FT                   /locus_tag="Shewmr7_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.874 at
FT                   residue 24"
FT   gene            124416..125036
FT                   /locus_tag="Shewmr7_0108"
FT   CDS_pept        124416..125036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41114"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J1"
FT                   /protein_id="ABI41114.1"
FT                   /translation="MKVTKIINMQTAAVAGIFAMTLGTPAMAAEKPSFDCSKVRAGSIE
FT                   ELVCQDEGLIKLDQQLAEVYTKATEKAKNEQPPTLKAMQRGWVKGRDECWKSEDKRACV
FT                   ESTYQTRIAELQAQYRLVEMTGPVFYACDGNPANEVVVSYFKTEPATLIADRGDQTSLM
FT                   FVQPSGSGAKYQGRNESLWEHHGEAKIVWGYEAPEMTCVVKPQ"
FT   sig_peptide     124416..124502
FT                   /locus_tag="Shewmr7_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(125039..126028)
FT                   /locus_tag="Shewmr7_0109"
FT   CDS_pept        complement(125039..126028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41115"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0J0"
FT                   /protein_id="ABI41115.1"
FT                   /translation="MPKRNLNLSLALLLCALSYPAIADTVFLTNGDKITGEIKALDEQN
FT                   LVIKPSYAPQITIERSAVRSFETREPQPWSINRSIKEVTVQVSELDSFVLIDDKQTPIS
FT                   ELIYSELLSDSDWRYSGSVEAAIDVTHNSKNTQKLHAKGDVTAETLNWRHNLKSEVRYE
FT                   TEDKTTKRNTLEAHYSLDYLISDHWLVRQEDYYQEDKLNLDIRSYYAALGPGYRFWGVN
FT                   RDKLDFVLTYNHFWLDYQVFTYELNAWAATINYKQYWFDGVLETYADLQIAFPDIPTIE
FT                   YISDSTFGLKYLLTQQIYLSFKYDINETKSTVQHSRDISYTLGLGVNF"
FT   sig_peptide     complement(125957..126028)
FT                   /locus_tag="Shewmr7_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(126152..126772)
FT                   /locus_tag="Shewmr7_0110"
FT   CDS_pept        complement(126152..126772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41116"
FT                   /db_xref="InterPro:IPR021501"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I9"
FT                   /protein_id="ABI41116.1"
FT                   /translation="MPSSFRLSALSSLLLLSSSVMAADVATITLENGAQVRLKDDFTWE
FT                   YIITETKVAEAPAVATVAAAPSVAAVASTPVAVEAAKPVTTLTANAIARPELLGSTAKD
FT                   GIKVTFRESQWKGDKLGLTFELASTSGEHVTLVEVETSFFADDGTLLKTEKLDIWEAIF
FT                   RMPETYLRKGEQRKSPVIWVEGVDKSRWQKQLLNLKITEINSR"
FT   sig_peptide     complement(126704..126772)
FT                   /locus_tag="Shewmr7_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            126965..127348
FT                   /locus_tag="Shewmr7_0111"
FT   CDS_pept        126965..127348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0111"
FT                   /product="protein of unknown function DUF1090"
FT                   /note="PFAM: protein of unknown function DUF1090; KEGG:
FT                   son:SO0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41117"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I8"
FT                   /protein_id="ABI41117.1"
FT                   /translation="MFCRYGCLIALLCSGIATAQEDAPKGCGAKIAAIEAQLAEAKASG
FT                   NQNKVNGLTTALEAVVADCEDDALYAERLVKVEAKQAKLVERQNELSEAIASGQSMEKI
FT                   SKKRQKVAEAQAELHQAEAELEQ"
FT   sig_peptide     126965..127024
FT                   /locus_tag="Shewmr7_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 20"
FT   gene            127581..128849
FT                   /locus_tag="Shewmr7_0112"
FT   CDS_pept        127581..128849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0112"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   son:SO0121 hypothetical small-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41118"
FT                   /db_xref="GOA:Q0I0I7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I7"
FT                   /protein_id="ABI41118.1"
FT                   /translation="MDQEIRLQISNWLSSIGIDSQPSDGISTSIMLLACVLVAAIAYFI
FT                   MRRGVIRAVNMVILRSKATWDDVFMRYRVLEKLAMLVPAIVLNLLVPITLTEHPVLSSL
FT                   VDRLLSIWLVILMIRAIYAGLDAVNEISDVNLVSRRLPVKSFVQLIKLFLFFVGLIVSI
FT                   SVLADQSPVYFLSGLGVATGFVMLVFRDTILGFVAGIQLAANRMVSKGDWIQMDKYGAD
FT                   GAVEEVSLTTVKVRNWDKTITMIPAYALVSDAFRNWRGMSESGGRRIKRAVNIDINSIK
FT                   FLTEEERSRLSKINCLKEYFPAKISEIQESNAKVSDLDMKVNGRHLTNVGTFRAYLQEY
FT                   LQRHDKVHKDMTLMVRQLAPTTEGLPIEIYIFTNDTRWAFYEAIQADIFDHIFAVLPEF
FT                   GLQAFQAPTGNDIRSLKSVKVEG"
FT   gene            complement(128846..129469)
FT                   /locus_tag="Shewmr7_0113"
FT   CDS_pept        complement(128846..129469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0113"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   son:SO0122 transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41119"
FT                   /db_xref="GOA:Q0I0I6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I6"
FT                   /protein_id="ABI41119.1"
FT                   /translation="MQTETWLLYLFAIVLIGISPGPIAMLSMSHGIHFGKKRSIATGLG
FT                   SVSAALVLMAASAAGLGAIISASEYGFSLLKWCGAAYLVFLGIKLVLTKSQGQKLEVAK
FT                   TEGKGTAKQLYKQAFLVGISNPKDLLFFAALFPQFIDLTAPQMPQLTILALTWALVDFS
FT                   FVMLYASMANVLAPSLKASNKLHWFDRTSGGVFLTLAAILVSRD"
FT   gene            complement(129495..130055)
FT                   /locus_tag="Shewmr7_0114"
FT   CDS_pept        complement(129495..130055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0114"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   son:SO0123 acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41120"
FT                   /db_xref="GOA:Q0I0I5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I5"
FT                   /protein_id="ABI41120.1"
FT                   /translation="MFTHLCRWLLKISGWQIQGELPNQAKYIVIVAPHTSNWDFIIGVL
FT                   ARGALNTRIHFLGKHQLFIPPWGWFFRAIGGSPVDRRKNNNLVDAAVQLFATQPDYKLA
FT                   LAPEGTRSPVTRWKCGFYHIASKAQVPIVPVGLDFARKAVVIQPPLQPREIEQDMAEIL
FT                   RFYRSIKGRHPKTIPDYTPDNRR"
FT   gene            130185..130634
FT                   /locus_tag="Shewmr7_0115"
FT   CDS_pept        130185..130634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41121"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I4"
FT                   /protein_id="ABI41121.1"
FT                   /translation="MLRQGLMKKHILQCFAVLMLLFAGQASAVPTDDIAQMLKGQEDAW
FT                   NRGDLDAYMQGYWKNEQLRFVSNGKFRYGWEETLAAYKKNYPNKEALGELKFTIKEIKM
FT                   LSNYAAMVVGRWDLKRQKDAPSGVFTLLVEKIDDRWVITMDHSSD"
FT   sig_peptide     130185..130271
FT                   /locus_tag="Shewmr7_0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(130658..131458)
FT                   /locus_tag="Shewmr7_0116"
FT   CDS_pept        complement(130658..131458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0116"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   son:SO0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41122"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I3"
FT                   /protein_id="ABI41122.1"
FT                   /translation="MCILFVALNTHPQYPLIICANRDEFHHRPTAPAQFWPPEENILAG
FT                   KDLQAGGTWFGVNKQGQIAGVTNLRVAQKSQEPMRSRGELIIKALSSGSLICPNWLEEH
FT                   AEDYQPFNLVFGQGTNLYCFNSLKRNTVKLTAGFHAISNGALDDIWPKMAKGQRSLEAL
FT                   IQQAGPLELESLIQLMQDDSRPQDNELPDTGVGLEWERRLAAIYIRHPDYGTRSTSILL
FT                   QNAQGEVQFTEVRYDGKGRRLGQQDFHFTLPPQLPKEPDCLAHF"
FT   gene            complement(131521..133179)
FT                   /locus_tag="Shewmr7_0117"
FT   CDS_pept        complement(131521..133179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41123"
FT                   /db_xref="GOA:Q0I0I2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I2"
FT                   /protein_id="ABI41123.1"
FT                   /translation="MLYLLASCIALLIGPLFYRYFSSGSGLQKGLDGFIFVSLGGLVLI
FT                   HILPELLEHGGLLAIVFVVLGLWGPTASERLFHRYSEITHNLTLSLGIGGLLLHTITDG
FT                   GAMVLAQQDGNSTLLALGVILHRLPVGLAIWWLLKPQVGTRWASLVLVAMMLLTGVGYF
FT                   AGEQLLSQLSLDNTVYLQAFVTGSILHVVLHQPHGQHDTDKQGQYEYQAGIGSLLGIGL
FT                   LMVLLLMDSGGHEHAHHDHSTEQLTTWLMTIAPVLLLSYAAAALRFKLGLTPQDSSLAR
FT                   RWFQRLAGPEALVLTALLLGPWLALFQLLVVFIMSAYLAHARVEITDPHSKLPNNALRF
FT                   GFAHLVDRSAPWVLLSLVLVNLIGHPSVPLSNPMLQIAVLLLVFLPMRFCNLGAAVLSI
FT                   ALAYSGWSPLAIILPLIAAPVLNFAQLKLMSWPQRGILLAIIAVSLVAALKLPMWFSMI
FT                   TLPEAINLAALFILSALFAASLLRLGPRKFLRRLMLLKPAAHGHHHGHAHAHAHTQAAE
FT                   ASHGHGHSHTQSHTHSQNHSHDHDHSHGDGNKHHH"
FT   gene            133476..134069
FT                   /locus_tag="Shewmr7_0118"
FT   CDS_pept        133476..134069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0118"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   proteins"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: son:SO0129 conserved hypothetical protein
FT                   TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41124"
FT                   /db_xref="GOA:Q0I0I1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I1"
FT                   /protein_id="ABI41124.1"
FT                   /translation="MDIFSAAVMLFLIMDPLGNLPIFASILRHIDPKKRRRVLIRELIF
FT                   ALVIMLAFLYAGEAILSFLNLRSESVSIAGGIILFLIAIRMIFPQPGGVVGLAAGEEPF
FT                   IVPMAIPLMAGPSILAALILLAHTDSTRMGDWTIALVSAWGASAVILMFYKLFTRMLGE
FT                   KGLTAVERLMGMVLVMISVQMFLDGVSNYMKTAS"
FT   gene            134368..137178
FT                   /locus_tag="Shewmr7_0119"
FT   CDS_pept        134368..137178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0119"
FT                   /product="peptidase M6, immune inhibitor A"
FT                   /note="PFAM: PKD domain containing protein; peptidase M6,
FT                   immune inhibitor A; KEGG: son:SO0130 protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41125"
FT                   /db_xref="GOA:Q0I0I0"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0I0"
FT                   /protein_id="ABI41125.1"
FT                   /translation="MRSSKSITALGLMLALLSGASIAAPNHTPADAGVINKERILYWLI
FT                   KRGEVSADASDSVKQAAVEAYIARASLAQPKEPRMVIEAEHDRLQKVKSTAMMRAPAQR
FT                   VLADADVTKTVKVLTVLIDFPDLKYNNNGLTASDTDMYYSSYPASHYKNLLFSTTGFTG
FT                   PQGQTLDSAYQYYQAVSGKTFFFTGDVKGWYTASQNADYYGANNAGRGSDANVTELVKE
FT                   AVSQAVANMSAAELATYDIEDPYDLNNNGNLDEPDGIIDHVMIFHSSIGEETGGGKLGD
FT                   NAIWSHRYYVDQTTQGYSLPGSTKKLFGYTIQPIDAATGVCTHEFGHDLGLPDEYDTTE
FT                   NTNKDGSPVGAWSLMSSGSWTGAIPGTKPSGFSPYARSYLQEKYKGKWLNEREISLDSI
FT                   PKSGMEVTLNQASNQEVVNQVSIPLPATQIAFKTPYQGSYQYYSGQGNMLSNSMSFTAN
FT                   LPATSDKLTLAMQASWEIEADYDYMQVKVNGVAIAGNYTKSVNAINSARHIITGKSSSI
FT                   SAAVGSDAWVGLEYDLSAYAGKAVTIEFTYVTDEGVSESGITIDNISIKQGAAELYADN
FT                   AEVAGQATLAGYSRITNTRPGAASRYLIQLRSHNGVDAGLKNEGFDPGVLLWLEDFSYY
FT                   DNNVSDHPGRSLIGVIDADQNMIGNNSTDVQIRDAAFSLVRQTAYTGDTNLEPTSLFDD
FT                   SFDYSAPLQPQSGMVLQKLGLTMQVVSQASDNSTAVIRLANANADPALTPLTAAINLSQ
FT                   NGLTASVTAVVDGGEGAYTYAWDFGVAGATSTSASATYTYANAGTYTLTLTVTDAKGTI
FT                   ATATKTLVMSLPLTAGFSASANQLTVNFSNTSAGGVGSRSYTWNFGDGTSSTSVSPSHT
FT                   YTRAGTYLVTLTVKDTQNATASSSSSVTVSEPTTPGETPSSGGGGSLSWLSLMLLGGFA
FT                   WRRQRQ"
FT   sig_peptide     134368..134439
FT                   /locus_tag="Shewmr7_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(137238..137807)
FT                   /locus_tag="Shewmr7_0120"
FT   CDS_pept        complement(137238..137807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0120"
FT                   /product="chorismate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /note="PFAM: Chorismate lyase; KEGG: son:SO0131 putative
FT                   chorismate--pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41126"
FT                   /db_xref="GOA:Q0I0H9"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0H9"
FT                   /protein_id="ABI41126.1"
FT                   /translation="MSVTSLSFPYGESIQWFCADNAKNLPSSPLKEWLLAPGSLTQKLK
FT                   GCCDKFEVKILGEGQCVPLEGEYPKQNAVWVREVLLCLDSVPWVFARTLIPQSLLSTRQ
FT                   ADFLGLGTRPLGELLFSQDSFVPGRIEIARFTTDSRLAQLAQSLAQNVEHELWGRRRYF
FT                   HHDEEEMFVSEMFLPAAVQAMARLQP"
FT   gene            137909..138319
FT                   /locus_tag="Shewmr7_0121"
FT   CDS_pept        137909..138319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0121"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: son:SO0132 flagellar protein FliL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41127"
FT                   /db_xref="GOA:Q0I0H8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0H8"
FT                   /protein_id="ABI41127.1"
FT                   /translation="MKKLLSACLILFSVVLSAYAADEKEATPAGDYAYYGFEPEIVTNY
FT                   ISNRKKLGFVKISVELMVKNPDDLVIVERHDPLLRAAIIEVLGNQAEEKIKSLTGREEI
FT                   RRECFDMVNNLLTKEAGKPLVVNLLFTSYLYD"
FT   sig_peptide     137909..137971
FT                   /locus_tag="Shewmr7_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            138379..139473
FT                   /locus_tag="Shewmr7_0122"
FT   CDS_pept        138379..139473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0122"
FT                   /product="protein of unknown function DUF890"
FT                   /note="PFAM: protein of unknown function DUF890; KEGG:
FT                   son:SO0134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41128"
FT                   /db_xref="GOA:Q0I0H7"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR016909"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0H7"
FT                   /protein_id="ABI41128.1"
FT                   /translation="MPKPAIKTAAKPATSSAGKRGKPNTPKSVAKPKTAKPKTASKPKV
FT                   KPGEKKRLHPRNLHINGYDFPALMASYPKLKAFVRPTPYGALSIDFADPLAVKTLNAAL
FT                   LLHHYGLAFWDIPKGALCPPIPGRVDYLHYLADLLFEGGKVKRAAAIRALDIGTGANGV
FT                   YAILGHQVYDWQFVASDINPQSLTNVQRIIDNNPSLQGHLSLRRQQDDKAVFKGIIQAS
FT                   DRFELTLCNPPFHGSLKEASEGSLRKVRNLQLNRGEQPKATSATLNFGGQAAELWCQGG
FT                   EKQFLATMIRESQAFAEQCLWFTSLVSKQENLKPCYQALEKLGVDTVKTIEMQQGNKFT
FT                   RVLAWSFHSQAKRLQWRNQIVSGT"
FT   gene            complement(139517..139813)
FT                   /locus_tag="Shewmr7_0123"
FT   CDS_pept        complement(139517..139813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0123"
FT                   /product="protein of unknown function DUF333"
FT                   /note="PFAM: protein of unknown function DUF333; KEGG:
FT                   son:SO0135 hemolysin protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41129"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0H6"
FT                   /protein_id="ABI41129.1"
FT                   /translation="MKLTSPLLIGLIMCGSLVGCGDKTEPATQAPAEVKTEAKAATKVK
FT                   IANPAAEYCVSLGGTSEIQKTAEGEQGVCTLPSGEKIDEWALFRRDHPQEKAQ"
FT   sig_peptide     complement(139754..139813)
FT                   /locus_tag="Shewmr7_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.677 at
FT                   residue 20"
FT   gene            complement(139839..140501)
FT                   /locus_tag="Shewmr7_0124"
FT   CDS_pept        complement(139839..140501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41130"
FT                   /db_xref="GOA:Q0I0H5"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0H5"
FT                   /protein_id="ABI41130.1"
FT                   /translation="MDSGDSVFDRRTTNDTLIGAGLYNLVIGLTLLWGFAVNYMMVSHI
FT                   DPEAIASVNPWIFFIGYFASCFFGIYLFQRSSNPLVSFIGYNFVVVPFGLIINIVVSQY
FT                   DPELVTEAIRITGLVTIAMMCLGTLFPAFFQKIVGVLTMALLLVIVIELIEIFIFNTHH
FT                   GILDWIVVLIFCGYIGYDWGRANQIPKTVDNAVDSAAALYMDIINLFLRILRILGRK"
FT   gene            complement(140539..141300)
FT                   /locus_tag="Shewmr7_0125"
FT   CDS_pept        complement(140539..141300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0125"
FT                   /product="[molybdopterin synthase] sulfurylase"
FT                   /note="TIGRFAM: molybdopterin synthase sulfurylase MoeB;
FT                   PFAM: UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB
FT                   domain protein; KEGG: son:SO0137 molybdopterin biosynthesis
FT                   MoeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41131"
FT                   /db_xref="GOA:Q0I0H4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0H4"
FT                   /protein_id="ABI41131.1"
FT                   /translation="MNEQLEILSDGELTRYSRQISIKAMDIDGQERLKLAKVLMIGAGG
FT                   LGCAAGQYLTVAGIGELTLVDFDTVELSNLQRQVLHQDATIGQPKVESAKQSLNRLNPH
FT                   VKINTINAVLDDHEIDALVASHSIVVDCTDNVSVREQLNQSCFKHKIPLVSAAAIRMEG
FT                   MVTVFDYQAQTPCYHCFSSLFGEQQLSCVESGILAPVVGMVGCLQAVEAIKVIAGMGKT
FT                   LAGRILMIDAMTMEFREMKLPKQPHCKICSQ"
FT   gene            complement(141312..142646)
FT                   /locus_tag="Shewmr7_0126"
FT   CDS_pept        complement(141312..142646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0126"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: son:SO0138
FT                   molybdopterin biosynthesis MoeA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41132"
FT                   /db_xref="GOA:Q0I0H3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0H3"
FT                   /protein_id="ABI41132.1"
FT                   /translation="MQIIAKQAQRGIIAPIFAQSFAHKEDPMSVKADPCSQPSLMHPDQ
FT                   AIPLLLEQVSPVSDTEVVTLPHALGRVLAEDLASCIDLPPFDNSSMDGYAFRFADLATE
FT                   THQTTLTLIGSSFAGHGFEGEITPNSCVRIMTGAPVPAGYDTVQMQEETQAQGNQIQIN
FT                   HPKAKGANVRCRGEELLQGTKVLKAGIEIKAAELGVLATIGVSQVRVYRQLKVAFFSTG
FT                   DELRPVGSDLAPGQIYDSNRYSIQGLLSRANVEWLDLGVIADDPEAIRHAFRHAASQAD
FT                   MVLTSGGVSVGEADFTKQILDEEGKITFWKLAIKPGKPFAMGRIGKAVFCGLPGNPVSS
FT                   MVTFYKLVWPILNKMQGLTPKAPLMLSATLTTPVRKQPGRVEYQRGILSRNAQGELEVA
FT                   ITGSQGSGMLTSMSLANCFVLLEQFQGDTAVGTQVTVEPFNSVLC"
FT   gene            142894..143430
FT                   /locus_tag="Shewmr7_0127"
FT   CDS_pept        142894..143430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0127"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG: son:SO0139
FT                   ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41133"
FT                   /db_xref="GOA:Q0I0H2"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0H2"
FT                   /protein_id="ABI41133.1"
FT                   /translation="MLSATMIEKLNEQINMEFFSSNLYLQMSAWCEDQGFEGAAKFMRE
FT                   HADEEMGHMRRLFTYVSETGGLPLLGAIEAPQSQFDSLLALFELTYEHEQLITSKINAL
FT                   AHAAFSNQDYSTFNFLQWYVAEQHEEEKLFKSIVDKIRLVGEDGKALFFIDKDLAKLAS
FT                   KGGESIMNPQSQPQA"
FT   gene            complement(143509..146742)
FT                   /locus_tag="Shewmr7_0128"
FT   CDS_pept        complement(143509..146742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0128"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: son:SO0141 sensory box protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase,
FT                   HAMP region domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41134"
FT                   /db_xref="GOA:Q0I0H1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0H1"
FT                   /protein_id="ABI41134.1"
FT                   /translation="MPSMLQHLSLKQKLILFSLLPLLMMSIFVLSRMYVLVKEYRSANQ
FT                   NHLAIQATAQTTELLFQLHNEYGLSAQLSGPASPQEETRLLQQQQITSDALDALLNGSA
FT                   LSNLMPALGRNQLAAVQLQEQLNTLTLLSHRLASGRQEALDQHPKAFIDLYNQFNTELV
FT                   KLIQQLQLQTNDISQSRAYTDLLNLLMVQQLAVKERSAINHMLLSQVLNINDYRAISTI
FT                   MYEYGQAIEHASNASISNRQSLIRKMQTSPENLRILKISQQIEQQIRVSTLVQNINAHL
FT                   GYGGLIDSFQDYLIKGDNAALDKFTKALSIIQLNLDELNHEIRNIPDLKPAVKTIEDGI
FT                   DQYQFCMNQLQQLKRQQLSLEEISALIHVNDNDLSAAINKLLMPPHPVSSKHWWSLTSD
FT                   RINKLHTISDEITANMAHQSEVEQTKSLTLLGLYLFSALFTAAITLWLGRKIIRSFMVK
FT                   ITRIANDMQRMAADPQLNINIDASGSDELARMAQAMNRMISERQKANHALSRAAAVFNY
FT                   SAEGIMVTDADNHIELVNPAFSQITGYSLEEVKGRSPSLLSSNRHPSHFYTAMWEALQK
FT                   EGKWEGEIWNKRKDGQVYPEYLAITVVRNERGEIIQHIGLFMDISKRKQYEQDLWYQAN
FT                   FDTLTGLPNRKLFNERLQHEIQLAQHDSRKLAILLIDLDQFKYINDVQGHATGDLLLQD
FT                   VAKRLENIAGKNDFLARIGGDEFVLILPRVTNEFAIEHMASRIIETLAAPFNLNEREIQ
FT                   ISASFGIGVYPEDGLDVSSLTRNTEMAMYQAKDAGRNNFKYFTSGMNQAMFARMELEQR
FT                   LRRAVAQNEFTLHYQPIVDMKTGQICSVEALIRWQDPDLGLIPPDQFIGIAEETGLIEP
FT                   MGEWVLNQAMHDLRQWQHMGLNLNVAINVSSRQCINTRGLGFDQVLQECFNRHHINPRN
FT                   VHIEITESMLMGDASHCLSTLESIRHLGSQIYIDDFGTGYSSLSYLKKFPISVIKIDRS
FT                   FVENALDNSSNANLVKAIVMMGQSLEMELVAEGIETEAQWKFLRDLGCHYAQGYLISKP
FT                   LPFDEITPLLNQTLPKILCLAPQEKSINT"
FT   sig_peptide     complement(146647..146742)
FT                   /locus_tag="Shewmr7_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.558 at
FT                   residue 32"
FT   gene            complement(147104..147757)
FT                   /locus_tag="Shewmr7_0129"
FT   CDS_pept        complement(147104..147757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0129"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; KEGG: son:SO0142 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41135"
FT                   /db_xref="GOA:Q0I0H0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0H0"
FT                   /protein_id="ABI41135.1"
FT                   /translation="MNQSLLAPFGTAIERVEAGLEALRQGQGVLVVDDEDRENEGDLIF
FT                   AAESLTNAQMAMLIRECSGIVCLCLPDEKVKALELPPMVENNSSQYGTAFTVSIEAKVG
FT                   VTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPGGVLTRRGHTEGTIDLMQL
FT                   AGLKPAGVLCEVTNPDGTMARLPEIIAFGAAHNMPVLTIEDIVVYRKSLLANVG"
FT   gene            complement(147970..148204)
FT                   /locus_tag="Shewmr7_R0006"
FT   misc_RNA        complement(147970..148204)
FT                   /locus_tag="Shewmr7_R0006"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 56.67"
FT   gene            148445..150580
FT                   /locus_tag="Shewmr7_0130"
FT   CDS_pept        148445..150580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0130"
FT                   /product="oligopeptidase B. Serine peptidase. MEROPS family
FT                   S09A"
FT                   /EC_number="3.4.21.83"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; peptidase S9A, prolyl oligopeptidase
FT                   domain protein beta-propeller; KEGG: son:SO0144 protease
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41136"
FT                   /db_xref="GOA:Q0I0G9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G9"
FT                   /protein_id="ABI41136.1"
FT                   /translation="MRTLLLTLGLAMLLPGCSTPKGQVYAPVAEKIPHVMTLHGVTRTD
FT                   DYYWMRDDKRQDPKVLAHLNAENRYTQAYFKPIKSLQDGLFNELTQRLVADESSVPYQW
FT                   HQHSYYRRYQEGGEYPLIARKGSDGVEQMMLDVNERAKGHEFYGLGGVSVSPDETMLAF
FT                   GEDVLSRRVYNIYFKDIESGAMITDVLENTEGRIVWGNDNRHVFYIAKDLQTLLGYRVY
FT                   RHELGTPQSSDVLVYEEQDDAYYISLGKSLDESQIVLFHESTTTSEVSVLDANDPLSLF
FT                   KPVLAREEGHEYSVSKLGDSYYILTNWQATNFRLMKVVIKDAADKSKWQEVVAHNPNAR
FT                   IEDELVLKDYLVIQTRENGLTRIKVMPFNGQKPFELSFDEPAYVLGLDVNAQQDSDKLR
FT                   IFYSSLTTPEAIYEYHLSNPDRRDLLKQEQVLGGFDASQYRAERLFVTARDGAKVPVSL
FT                   VYRKDKFKKDGTNPLYQYGYGSYGYTVEPDFSSSVISLLDRGFVYAIAHVRGSEMLGRP
FT                   WYDAGKLLNKKNTFNDFIDVTTALTEQGYGDKNKVVASGGSAGGLLMGAIANMAPEKYF
FT                   AIGAHVPFVDVVTTMLDESIPLTTNEYDEWGNPNEKTYFDYMLSYSPYDNVADHEYPHL
FT                   LVTTGLHDSQVQYFEPAKWVAKLREVQNKWYKLDDKVLLFHVDMDAGHGGKSGRYRQYQ
FT                   DTAQEYAFFLSLLGMTK"
FT   sig_peptide     148445..148513
FT                   /locus_tag="Shewmr7_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.851 at
FT                   residue 23"
FT   gene            150603..151028
FT                   /locus_tag="Shewmr7_0131"
FT   CDS_pept        150603..151028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0131"
FT                   /product="Excinuclease ABC, C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein;
FT                   KEGG: son:SO0145 hypothetical URI domain endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41137"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G8"
FT                   /protein_id="ABI41137.1"
FT                   /translation="MIEAANSTPSASPPKGASQTEAVNQAQLSSKPEALGAEQAITSEQ
FT                   GATSEIEQISTWYLYLIRCANGHLYTGITTDVARRFNEHQSSSPKAAKYLRGKGPLTLM
FT                   YQETVGSRGDALRREIAVKKLSRAQKLALIESGRETA"
FT   gene            151673..152239
FT                   /locus_tag="Shewmr7_0132"
FT   CDS_pept        151673..152239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41138"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G7"
FT                   /protein_id="ABI41138.1"
FT                   /translation="MHFYIPTNVPKDFLKDLGYQPVESVPVEPLEQGVTMHCLDNVRKY
FT                   LSCNEGEPQFGWMFSMLGKFILKLHAHVVVRLPDQKLLCVTPPEKPLRYVNFIKDSSIS
FT                   SMITNNRLPTKSFALVNAAIIKQFVQLENDEDTARLIGDLVATSNIYLQKANLEHEFLQ
FT                   YVRVNTGRNDVCFCGSEKKYKYCCG"
FT   gene            152365..152700
FT                   /locus_tag="Shewmr7_0133"
FT   CDS_pept        152365..152700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41139"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G6"
FT                   /protein_id="ABI41139.1"
FT                   /translation="MKMNHEEYIKKKRERAVEVASGMLDGSIHYLEGAIELSSLRYEVG
FT                   IPEDDKDFLVFIGIASEVDHLPLGSSRQCWSQEALDRHEYEIRESIEWAKEVSLSECKS
FT                   IVVRFDA"
FT   gene            complement(153085..153942)
FT                   /locus_tag="Shewmr7_0134"
FT   CDS_pept        complement(153085..153942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0134"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: ilo:IL1611
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41140"
FT                   /db_xref="GOA:Q0I0G5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G5"
FT                   /protein_id="ABI41140.1"
FT                   /translation="MTMQVSLQALKAFEAAARLGSFKLAALELSLSPTAISHHINNLEQ
FT                   RLDVALFQRQARRISLTPAGERLSTVTTQGFQAINQTLDDIASTGRHIKVATTSSLAAL
FT                   VLIPALQQFYAAHPQTQVEVATGEDMQHDAFTLPLRFGDLRHQHPDDVLKTEFFNMFAT
FT                   PAAASLPAGPKPLTIYTTRWKNNNLPPPPLTDWLAQQGLQDSRLDIKYYDQELFGIQQA
FT                   LAGQAWVFSPTTLTQQYVQAGILQAVSPNAVKSSLCYYIPNKALLSNRHNAHFIDWLQA
FT                   TLNT"
FT   gene            154071..154760
FT                   /locus_tag="Shewmr7_0135"
FT   CDS_pept        154071..154760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0135"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   ilo:IL1610 acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41141"
FT                   /db_xref="GOA:Q0I0G4"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G4"
FT                   /protein_id="ABI41141.1"
FT                   /translation="MTHILHIDSSVRAVLNDNPAHNSISKQLAERFIASFKTHYATAEY
FT                   TYRDVGMNPPDFINQQWIGAVFTPEAKRSAAQRQQLALSDQLIAEVSAADLIVISAPMY
FT                   NYGMPAQLKAWFDQIVRINKTFDFDLNRGDTPLAPLLSGKTLVILTSCGEFGFEEGGVN
FT                   ERHGHLVPHLRTLSKYLGVEQIFEVASEYQEFADNRHRQSLQLALAKSAAMGLQLAQHY
FT                   AGEATDV"
FT   gene            154753..155226
FT                   /locus_tag="Shewmr7_0136"
FT   CDS_pept        154753..155226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0136"
FT                   /product="CMP/dCMP deaminase, zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding; KEGG:
FT                   sco:SCO4974 deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41142"
FT                   /db_xref="GOA:Q0I0G3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G3"
FT                   /protein_id="ABI41142.1"
FT                   /translation="MCNHFLPAVNHTLALAQKEVEGTGLPFSAVIVDESGRIVAEGVNR
FT                   VQALHDCTAHAEIQAIRMATLLLKQVSLEGMTLIASGEPCGFCYMAIQLAKISRVIVLV
FT                   DRHEACQYGFDYRWTYQLLQESKLQIEISKWPQLNHRLQPFRQSSIGLASIGM"
FT   gene            complement(155212..155715)
FT                   /locus_tag="Shewmr7_0137"
FT   CDS_pept        complement(155212..155715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41143"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G2"
FT                   /protein_id="ABI41143.1"
FT                   /translation="MDQFSEYQQEIESLSLSDNPREIMEGLGDICLDGETFYQNGNTAL
FT                   AKHIFEHIYALDAHSDYFSHARSVAKTFLINLGEIPPIFLEETILQMQHEYAALSQQQL
FT                   NLLIAKRIFREFSHHQDAIRTTLEYLNKAEALAPLSKSDLRFKALVNAASHAAANHTTD
FT                   LHAD"
FT   gene            complement(156004..156780)
FT                   /locus_tag="Shewmr7_0138"
FT   CDS_pept        complement(156004..156780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0138"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: son:SO0150 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41144"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G1"
FT                   /protein_id="ABI41144.1"
FT                   /translation="MSLRPFIFTLGFVALFTVGVSLTGCIINVNAAGMPDLDHQQRELS
FT                   LDAQDLQALVAETGAGSLEIIGVEGLTQIKLVADIYSNDDSKVILTLEKKANKAQLKAD
FT                   FESHSSFSNYSPYIDLKLQVPAGLALDIDDGSGAILINKMTADIKVKDGSGELAIHGGN
FT                   NVSIDDGSGAIEVSQVNGNLAIVDGSGGIQVNDIKGSITIDDGSGEINVANVQNTVTIN
FT                   DGSGDINVVNTKGLTILSAGSGDVSFDKIDGPVSKH"
FT   sig_peptide     complement(156685..156780)
FT                   /locus_tag="Shewmr7_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.951 at
FT                   residue 32"
FT   gene            157051..157818
FT                   /locus_tag="Shewmr7_0139"
FT   CDS_pept        157051..157818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0139"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: son:SO0151 hypothetical SAM-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41145"
FT                   /db_xref="GOA:Q0I0G0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0G0"
FT                   /protein_id="ABI41145.1"
FT                   /translation="MDYLTTNKIAWDARTRVHLTSDFYDVEGFLSGNTSLTEIELNELA
FT                   VAGKSLLHLQCHFGLDSLSWARMGAKVTGVDLSEVAIAEARKLALQTELSAEFICSDVY
FT                   SVAGKVEPQDIVFTSYGAIVWLPDLTLWAQTIAACLKPGGQFYMAEFHPAQQLFDGYSY
FT                   FNRGEPDIEQEGTYTENASDEQQTLMCWSHSLSEVINALLQAGLVLEFFHEFAFSPYNC
FT                   FEGLEAQADGRYVLTHQGQQVPLVYSISARKPA"
FT   gene            complement(157843..159840)
FT                   /locus_tag="Shewmr7_0140"
FT   CDS_pept        complement(157843..159840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0140"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="PFAM: peptidase M14, carboxypeptidase A; KEGG:
FT                   son:SO0152 hypothetical carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41146"
FT                   /db_xref="GOA:Q0I0F9"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0F9"
FT                   /protein_id="ABI41146.1"
FT                   /translation="MRLFSPSVIAIACLSAGSLFTAQLAVAANTEVAQPEVTTTGAANA
FT                   EVANTEAAKTDAVDASADSSASPAAEATPAAAVAATPTRANTFVNDAILPPSITWHGAS
FT                   ESLLLSADNEWATPFEQSNGNESPSYEDTITWLDRLAAETTKLQKVSLGKSPQGRDIWM
FT                   YVASSEGINESARLKQNTKPTILVQAGIHAGEIDGKDAGMMLLRDIIKGDKSDLVEKAN
FT                   LLFVPMFSVDAHERSGEFNRVNQRGPVNMGWRTNANNLNLNRDYAKADTLEMQHMLRAI
FT                   NVWQPDLYIDVHVTDGIDYQYDITFGYNLAQGLSPASFRWLENSYRPAVEAALTAQGHI
FT                   PGPLIFAVDNTYITKGMSLWNPSPRFSNGYGDARHLPTILIENHSLKPFKQRVLGTYVM
FT                   LEQTLKTVGDQATKLKSAIQEDKYRASPLITLTWKSAPLAKGWDFKGIDYKLEQSPISG
FT                   TEVVRWTGEPKLYPNLPVIAETVPDIKVTRPSAYYIPAQWTQVIDRLNLHGIRMTRLSK
FT                   PTELKLQQYSLSNPVFNTKAFEGRLTVKADSTLAKLTTTLPAGTVKISTDQPLGDLAIL
FT                   LLEPQSPDSLLQWGFFNPIFTRTEYIEDYAVEPLAAKMLKEDPKLQAEFNKALENPEFA
FT                   ADPEARLRWFYERSPYYDNQYLKYPVYRSR"
FT   sig_peptide     complement(159757..159840)
FT                   /locus_tag="Shewmr7_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 28"
FT   gene            complement(159972..161090)
FT                   /locus_tag="Shewmr7_0141"
FT   CDS_pept        complement(159972..161090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41147"
FT                   /db_xref="GOA:Q0I0F8"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0F8"
FT                   /protein_id="ABI41147.1"
FT                   /translation="MSVFAPASPFADFIYRHFRAIHALKLGLALLIAVTINAIWSPPHF
FT                   IWSMVTIVIIMMSLPQVGGAIEKSLQRAVGTCLGSAYGVMLVATIDSYWLIMGLLILGV
FT                   TLICFISAGRYSYAYLVAGFTIIIVVGDANHDTSEALWRTANILLGCVIAILVSLFIFP
FT                   IKAKQDWRSQLANAIDSMAKVLTQHLQAPANHDLDFRAELEAAMKAVLTQKKLFFSLEW
FT                   ESQTLKKHKVLLAELVNKQVRLITLLELLPLSRWQEADKEAYHQINRVAAELTAYLHRL
FT                   SEFVAGKTATLPTLPNSLEQELQHRLQLSLAAQTPNSAPLANEVAQGFALTGYGWLIYQ
FT                   LAIAVEALYADIEIIEIAYSGQTVLHKTAKPS"
FT   gene            complement(161354..162583)
FT                   /locus_tag="Shewmr7_0142"
FT   CDS_pept        complement(161354..162583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0142"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   son:SO0157 proton/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41148"
FT                   /db_xref="GOA:Q0I0F7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0F7"
FT                   /protein_id="ABI41148.1"
FT                   /translation="MKSKSLLGNIGVQVVIAMIIGALVGFTMGESASIFAPLGTIFIHL
FT                   IKMLVIPLVLVSIISGAASLGDSPSAGKIGVGTFGFFIVTSGIAVALALVMGKVFTPGA
FT                   GVDFTAHSSSGLMEVTAEHGALPGVMDTFIGMIPTNVFESLTGGNILQILVFSIFFGIA
FT                   LTKVKGDGAKPIMAALNTVVDAFVWMINCVMVIAPIGVFGLMADSVGTFGFDALEVVFK
FT                   LFAVFVAAILIYGFVFFPLVVQLFSKVSARQFISAMKKPQVMALSTASSMATLPVNMET
FT                   CEEDLKVSKATTAFVLPLGATINMSGNAIYYGLVAMFFAQMYNVDLSMTAYAAIIFTST
FT                   LGAIGQAGVPGPSFLVVAVLLAAGIPIDGLPLLFALDRVFDMIRTALNITGDAACAIIM
FT                   DKYTAEPSSN"
FT   gene            163044..163400
FT                   /locus_tag="Shewmr7_0143"
FT   CDS_pept        163044..163400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41149"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0F6"
FT                   /protein_id="ABI41149.1"
FT                   /translation="MNISSFFGQPESLQRWIRKCIEQPGLSYWLVYQDLEQGESLQLTT
FT                   LLFPIVADMRDLSDDEIDAFEDGLGRSDYGYLLNTDQIEDVIDNLKQQKAQPSEQELLE
FT                   AIIFYYEQDAFICL"
FT   gene            complement(163483..165216)
FT                   /locus_tag="Shewmr7_0144"
FT   CDS_pept        complement(163483..165216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41150"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0F5"
FT                   /protein_id="ABI41150.1"
FT                   /translation="MFKPKLLSLLIATSLLTACSGSDDKDDTTTTPEPTPPTEYTHKVT
FT                   GQVTYIGAIAGANVCVDLNQDLSCSEGEPSTTTDTDGKYQIDWKSETEKPNYYLLANWI
FT                   DNAASSARSALAMSSAAANTNATTGGMNIVALPDHAGHINALTNIEFSRYRKMIEADLT
FT                   PQQVIEFRAKLKSLYATGFKQVEADLFSLSPEITLQPTFLDTLLLHDYLLNLTNERTVE
FT                   ILAAIEVLIAAFEAFENLILGYGFGTEAYLQTNPVAVTNKVESTLVSFGYMEAPVDDKA
FT                   MNSTDWDTVFSSMLNHTDASHVLNIATVRNSHFVSLDYGTADQTLTGVFSGDAVMIFDN
FT                   TSGEEVPTECWNEPMKKWINASRNDQGYVLKEPVIEGNQLKTVYAGTEVPVEINFHKYQ
FT                   NTAADWQDLLANLPSDLKLASLSWPAQIYRMDIKQTADVLCREEDPTTYETGVETASEL
FT                   STGLIVELLWPFAYPESYVEDSTNKFTILDSFGQPESQHEWSISTSPNGGKLLTITEIV
FT                   EDPIASQMVQPSYYLVTSNLLTEVELNTAFDTTDNKQLYRFTYDQSFSNTLHNHFKSLA
FT                   K"
FT   sig_peptide     complement(165148..165216)
FT                   /locus_tag="Shewmr7_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.386 at
FT                   residue 23"
FT   gene            165622..167085
FT                   /locus_tag="Shewmr7_0145"
FT   CDS_pept        165622..167085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0145"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: hch:HCH_01122
FT                   outer membrane protein and related peptidoglycan-associated
FT                   (LipO)protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41151"
FT                   /db_xref="GOA:Q0I0F4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR032608"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0F4"
FT                   /protein_id="ABI41151.1"
FT                   /translation="MRVSKRSYLVGLLAMSTSLLPLSLMAADEGLFTPFPTAKLKDELT
FT                   RHYAEYPFIISAGEQRSDYRFKPIFGQVHQQKYKLAPEYSPAHILDNYREQIKKLGGEV
FT                   LFECLLEACGDSRLLEEQIALLDGVIGVESGYLFARVKNEQKEFYTAIQAANLKSSAGI
FT                   HITTLEVIPEPLDLVTVNAAFLQQAPKQIEFKDNQKKDKNGAEDHPLISRLKGSYIQDF
FT                   KRQGFASTVFVSSMDASNKPVLVERAGKLTQNGYSIPKEYSGYEVFTNYKVALTKLGFE
FT                   TQFECQGKACGREDRFIKAIDSLVNIGNEDSQFYAWYILTRPEGNVHVSTYTLGYIGGL
FT                   WTDLRVLEETELKDDRVGINLEALTDQIEAKGHVALEGLLFEYDSDKLLPEAQPVVEVL
FT                   ASYLKANPKRAFYVVGHTDDKGNQAYNQGLSQRRAVAIVKLLTSSHGIQTQQLEAVGIG
FT                   EHAPVASNSDEAGQQQNRRVELVLRSDTK"
FT   sig_peptide     165622..165702
FT                   /locus_tag="Shewmr7_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(167205..168764)
FT                   /locus_tag="Shewmr7_0146"
FT   CDS_pept        complement(167205..168764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0146"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; short chain fatty
FT                   acid transporter; KEGG: son:SO0160 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41152"
FT                   /db_xref="GOA:Q0I0F3"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0F3"
FT                   /protein_id="ABI41152.1"
FT                   /translation="MENHKPVTGFQRFLNGVEVVGNKLPDPAVLFAMFLGLVWLISWGL
FT                   SGVSFDEIDPRTGNPIQVVNMLEGGALTAFTSNIVSTFVTFPPLGVVLVAMLGLGVAEH
FT                   TGFINAGLRSILSVTPKMLLTPVLIAVGILSHVAVDAGYVLVIPLGAVIFYAAGRHPLA
FT                   GIAAAFAGVSGGFSATVGVPSSLDPMLAGLTQAAARLSADPAAATLTINPLNNIFFTSA
FT                   SAVLIILVGWFLTDKVIEPRLKSTAVNGDPSTLPTLDELALHERRGLKFAMGAMLLCAL
FT                   GLVFTAYGDNSAWRGTDGALTSASAPLMRSIVAIIFVFFLVPGIVYGYVAGTANNHRAI
FT                   IQGMSKSMSGMGYYIVMAFFCAQFIYAFGQSNLGALMAIKGALALKELALPMGVTLVGI
FT                   VFLTAFVNLLVGSASAKWALIGAIMVPMLMELGVSPDLTQAAYRVGDSSTNIITPLMPY
FT                   FPLIVVFCQKYVKESGIGTLVALMLPFSISFLLLWSGFLLAYWALGLPLGIGSSLSFPA
FT                   LS"
FT   gene            complement(169011..170552)
FT                   /locus_tag="Shewmr7_0147"
FT   CDS_pept        complement(169011..170552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0147"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="KEGG: son:SO0162 phosphoenolpyruvate carboxykinase
FT                   (ATP); TIGRFAM: phosphoenolpyruvate carboxykinase (ATP);
FT                   PFAM: phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41153"
FT                   /db_xref="GOA:Q0I0F2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0F2"
FT                   /protein_id="ABI41153.1"
FT                   /translation="MADGLNRVHYNPSTAQLVEFALLRGEGELTANGALVAKTGTRTGR
FT                   SPGDRFIVKEPSSAADIEWGPVNQAFEPGAFEGLWARVEAFLADKELFVSDLEVGADPE
FT                   HYQPVRVTTQYAWHQLFARNLFIIPEEFNRQDKPVWEIINAPDFVCVPERDGTNSDAAV
FT                   ILNFAERKVLLAGLKYAGEMKKSMFSVQNFLLPAQGVLPMHCSANVGKDGDTTLFFGLS
FT                   GTGKTTLSADPKRFLIGDDEHGWAPGGVFNIEGGCYAKCIDLSQKNEPVIWDAIRFGTV
FT                   LENVVMDEHRVPNYKDSSLTENTRAAYPLEHIAQRKEDNRGAEPHAVVFLTCDVSGVLP
FT                   PVSILSKEQAAYHFLSGYTAKVGSTEIGSTSAIQSTFSTCFGAPFFPRPAGVYAELLMK
FT                   RIESFGSQVYLVNTGWTGGPHGIGKRFDIPTTRAIVDAIVSGELKNVETVHLDTLNLAV
FT                   PVAVPGVDTNLLNPVNTWSDKALYAEYAQKLAEAFTKNFAKYQVSDAIRNAGPKA"
FT   gene            complement(170753..171613)
FT                   /locus_tag="Shewmr7_0148"
FT   CDS_pept        complement(170753..171613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0148"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: son:SO0163 chaperonin
FT                   HslO"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41154"
FT                   /db_xref="GOA:Q0I0F1"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0F1"
FT                   /protein_id="ABI41154.1"
FT                   /translation="MIQDILHRYLFDNADVRGELVQLQDSYQQVIGSHAYPPVLQILLG
FT                   ELLAATSLLTATLKFSGDISVQLQGNGPVSLAVINGSNQQQLRGIARWDGELADDASLA
FT                   DLFGQGYMVITLTPDEGERYQGVVALDKPTLAACVEDYFNQSEQLPTALWLFADGKQAA
FT                   GMFLQVLPSQEDHNADFEHLCQLTATIKAEELFTLEAQEVLHRLYHQEDVRLFDPIEVC
FT                   FKCTCSRERSAAAIKTIDQAEVEAILAEDGKVEMGCEYCNAKYVFDGIDIAAIYANGTA
FT                   SNTQQ"
FT   gene            complement(171650..172048)
FT                   /locus_tag="Shewmr7_0149"
FT   CDS_pept        complement(171650..172048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0149"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   son:SO0164 heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41155"
FT                   /db_xref="GOA:Q0I0F0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0F0"
FT                   /protein_id="ABI41155.1"
FT                   /translation="MAQSSGDSDSVRLDKWLWAARFYKTRAIAKEMINGGKVHYNGART
FT                   KSSKNAEIGAVLKIRQGYDDKEIVIKKLSEIRQSAAIAQELYEETAASIAKRAVNAEAR
FT                   RLNILNNPAPDHKPDKKQRRALIRFKEC"
FT   gene            172300..173226
FT                   /locus_tag="Shewmr7_0150"
FT   CDS_pept        172300..173226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0150"
FT                   /product="general secretion pathway protein C"
FT                   /note="TIGRFAM: general secretion pathway protein C; KEGG:
FT                   son:SO0165 general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41156"
FT                   /db_xref="GOA:Q0I0E9"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E9"
FT                   /protein_id="ABI41156.1"
FT                   /translation="MDLLDKVIAKAAGIPHKPLSQIVFWFGFILSLLLAAQITWKLVPT
FT                   TSSPTAWSPTAVTTTGKGAGQIDMAGLQQLALFGKADAKSDKPKVEVVETVTDAPKTSL
FT                   SIQLTGVVASTADQKGLAVIESSGSQETYSLGDKIKGTSASLKEVYADRIIITNAGRYE
FT                   TLMLDGLVYTSQSPANQQLQKAKGEKAEVVSRVDQRKNTEISQELAESRSELLADPSKI
FT                   TDYIAISPVRQGENVVGYRLNPGKDVNLFKQAGFKPNDLAKSINGYDLTVMSQALEMMS
FT                   QLPELTEVSIMVEREGQLVEIMFSLPQ"
FT   gene            173251..175353
FT                   /locus_tag="Shewmr7_0151"
FT   CDS_pept        173251..175353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0151"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: son:SO0166 general secretion pathway protein
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41157"
FT                   /db_xref="GOA:Q0I0E8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E8"
FT                   /protein_id="ABI41157.1"
FT                   /translation="MNNKRIRRKLIAGVVAGATMLTSQFVWSEQYAANFKGTDIQEFIN
FT                   IVGKNLNKTIIVDPTIRGKINVRSYDLLNDEQYYQFFLNVLQVYGYAIVEMENNVIKVI
FT                   KDKDAKTAAIRVANDNDPGLGDEMVTRIVALYNTEAKQLAPLLRQLNDNAGGGNVVNYD
FT                   PSNVLMLSGRAAVVNKLVEIVRRVDKQGDTSVQVVPLEYASAGEMVRIIDTLYRATANQ
FT                   AQLPGQAPKVVADERINAVVVSGDEKSRQRVVELIHRLDAEQASTGNTKVRYLRYAKAE
FT                   DLVEVLTGFAQKLEGEKDPSAQAGGKRRNEINIMAHTDTNALVISAEPDQMRTIESVIN
FT                   QLDIRRAQVLVEAIIVEVAEGDNVGFGVQWAAKAGGGTQFNNLGPTIGEIGAGIWQAQG
FT                   EDGTTVCTENGTCTENPDSRGDVTLLAQALGKVNGMAWGVAMGDFGALIQAVSADTNSN
FT                   VLATPSITTLDNQEASFIVGDEVPILTGSTASSNNSNPFQTVERKEVGVKLKVVPQINE
FT                   GNAVKLAIEQEVSGVNGNTGVDISFATRRLTTTVMADSGQIVVLGGLINEEVQESVQKV
FT                   PFLGDIPVLGHLFKSSSSKKTKKNLMIFIKPTIIRDGVTMEGIAGRKYNYFRALQLEQQ
FT                   ERGVNLMPNTQVPILEEWNQSEYLPPEVNDILDRYKEGKGLDTQMRETDSTLKSLDENK
FT                   NKDKTQ"
FT   sig_peptide     173251..173337
FT                   /locus_tag="Shewmr7_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 29"
FT   gene            175350..176915
FT                   /locus_tag="Shewmr7_0152"
FT   CDS_pept        175350..176915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0152"
FT                   /product="type II secretion system protein E (GspE)"
FT                   /note="KEGG: son:SO0167 general secretion pathway protein
FT                   E; TIGRFAM: general secretory pathway protein E; PFAM: type
FT                   II secretion system protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41158"
FT                   /db_xref="GOA:Q0I0E7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E7"
FT                   /protein_id="ABI41158.1"
FT                   /translation="MSEIQVTQVEDLSLVSNELGLEAEGDEVFRSSSKERLPFAFAHRH
FT                   EVILAFGEDGALSLFYTAKTPLAAMLEARRYSGVDLPLVLLEPGKFEAKLTQAYQANSS
FT                   EAQQLMEDIGNEMDLFTLAEELPQTEDLLEGDDDAPIIKLINALLSEAIKEEASDIHIE
FT                   TYEKQLVVRFRIDGVLKEVLKPNRKLSSLLVSRIKVMARLDIAEKRVPQDGRISLRIAG
FT                   RAVDVRVSTMPSSHGERVVLRLLDKNAGNLDLKQLGMTDSIRAKFDELIRRPHGIILVT
FT                   GPTGSGKSTTLYAGLTEINSKDTNILTVEDPIEYELEGIGQTQVNTKADMTFARGLRAI
FT                   LRQDPDVVMIGEIRDLETAQIAVQASLTGHLVISTLHTNTASGAITRLQDMGVEPFLVS
FT                   SSLLGVLAQRLIRTLCPKCKTEHVPDVRERELLGIAADDHRHIYRANGCKACGNSGYRG
FT                   RTGIHELLLVDDNVRELIHGGRGELAIEKYIRQSVPSIRHDGMSKVLSGITTLEEVLRV
FT                   TREE"
FT   gene            176919..178142
FT                   /locus_tag="Shewmr7_0153"
FT   CDS_pept        176919..178142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0153"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   type II secretion system protein; KEGG: son:SO0168 general
FT                   secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41159"
FT                   /db_xref="GOA:Q0I0E6"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E6"
FT                   /protein_id="ABI41159.1"
FT                   /translation="MPAFEYKALDAKGKQLKGVIEADTARHARSQLRDQRMMPLEILPV
FT                   TEKEAKAKGTGFSPFKRGISVAELALITRQIATLVAAGLPIEECLKAVGQQCEKARLAS
FT                   MIMAVRSRVVEGYSLADSLAEFPHIFDDLYRAMVASGEKSGHLEVVLNRLADYTERRQQ
FT                   LKSKLQQAMIYPIMLTIVAIGVVSVLLAAVVPKVVGQFEHMGAELPATTRFLIAASDFV
FT                   QSYGLLVVLIIGILLVVFQRLLKSPIFKMKYHTFLLKMPVVGRVSKGLNTARFARTLSI
FT                   LSASSVPLLDGMRIASEVLQNVRVRAAVDDATARVREGTSLSTALTNTKLFPAMMLYMI
FT                   ASGEKSGQLEDMLERAADNQDREFESNVTLALGVFEPALVVSMAGVVLFIVMAILQPIL
FT                   ALNNLISG"
FT   gene            178218..178652
FT                   /locus_tag="Shewmr7_0154"
FT   CDS_pept        178218..178652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0154"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   methylation site containing protein; Bacterial type II
FT                   secretion system protein G; KEGG: son:SO0169 general
FT                   secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41160"
FT                   /db_xref="GOA:Q0I0E5"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E5"
FT                   /protein_id="ABI41160.1"
FT                   /translation="MQMNKKHKGFTLLEVMVVIVILGILASMVVPNLMGNKDKADQQKA
FT                   VSDIVALENALDMYKLDNGIYPTTEQGLEALVQKPTISPEPRNYRDEGYVKRLPQDPWR
FT                   NNYLLLSPGENSKLDIFSAGPDGQPGTEDDIGNWNLQNFQ"
FT   gene            178714..179226
FT                   /locus_tag="Shewmr7_0155"
FT   CDS_pept        178714..179226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0155"
FT                   /product="general secretion pathway protein H"
FT                   /note="KEGG: son:SO0170 general secretion pathway protein
FT                   H"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41161"
FT                   /db_xref="GOA:Q0I0E4"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E4"
FT                   /protein_id="ABI41161.1"
FT                   /translation="MGLTAAAVTMSIGNSGPQQALEKTAQQFIAATELVLDETVLSGQF
FT                   IGIVVEKTSYQFVYYKDGKWNPLEKDRILSEKQMEPGVVINLVLDGLPLVQEDEQDESW
FT                   FDEPLIEPSAEDKKKHPEPQILLFPSGEMSAFELSFMTKSDKGPLDVLVVGDALGRLTL
FT                   GRPDEIR"
FT   sig_peptide     178714..178776
FT                   /locus_tag="Shewmr7_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.911 at
FT                   residue 21"
FT   gene            179213..179581
FT                   /locus_tag="Shewmr7_0156"
FT   CDS_pept        179213..179581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0156"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J; methylation site
FT                   containing protein; KEGG: son:SO0171 general secretion
FT                   pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41162"
FT                   /db_xref="GOA:Q0I0E3"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E3"
FT                   /protein_id="ABI41162.1"
FT                   /translation="MKYAKGMTLLEVIVALAVFAIAAVSITKSLGEQMANMPILESRTL
FT                   AQWVADNQMVDARLDPQFPEIGKKEGQVELAGKDWYWRKEVVKTTDDNFRMIRISVSED
FT                   ERYQRIAAQVSSYVLKTN"
FT   sig_peptide     179213..179308
FT                   /locus_tag="Shewmr7_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.389 at
FT                   residue 32"
FT   gene            179562..180323
FT                   /locus_tag="Shewmr7_0157"
FT   CDS_pept        179562..180323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0157"
FT                   /product="general secretion pathway protein J"
FT                   /note="TIGRFAM: general secretion pathway protein J; PFAM:
FT                   methylation site containing protein; KEGG: son:SO0172
FT                   general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41163"
FT                   /db_xref="GOA:Q0I0E2"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E2"
FT                   /protein_id="ABI41163.1"
FT                   /translation="MSLKQTNAQKGFTLLEMLIAIAIFAMLGLAANAVLSTVLTNDEVT
FT                   KNFSVRLKALQQGFGAIERDLGQMVARTPRLLEGGRGTTVFQTGNDILDSESEALVFYR
FT                   LGWLNPDGILPRGSIQSVAYVVREGRLERWYFPYPEPEFGAEPMKTVIIDKVLSVEYSF
FT                   FMEDKWERKVEATKLPKAIAMEIEIEGLGKIQRKFMLPLGAAAPEKSNEEDNKNDNADD
FT                   NKDDNGDQDNNGDGSGNGDPDKGDPDNEDGA"
FT   sig_peptide     179562..179663
FT                   /locus_tag="Shewmr7_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.808 at
FT                   residue 34"
FT   gene            180320..181318
FT                   /locus_tag="Shewmr7_0158"
FT   CDS_pept        180320..181318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0158"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   son:SO0173 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41164"
FT                   /db_xref="GOA:Q0I0E1"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E1"
FT                   /protein_id="ABI41164.1"
FT                   /translation="MIRRNPAKQRGVALIVVLLIVAMVVIIATNITSRNQLSMRRTLNL
FT                   AQYDQAYWYAISAEELAKKILKQDLDDSEGRVHKQQYWAMSDVVFPAEYGEIAGKITDM
FT                   RSCFNLNALSVTTKDVENGQPKLPLAAKQYKALLVSLGMDDFTADHLTQTLKDYIDEDT
FT                   VASPYGAEDAEYEARNVPYRAANTLMNHRSELRAVIGYTQDIYLKLLPYICVIPGSDRQ
FT                   LLNVNTIEVEQAALLAAMLDNQISVGEAESIINQRPGDGFAKIDDFYESSSLGSIKWED
FT                   AMKSSFVVDSQYFLLASGAKVDNAIFRMESVLKKSSGNKMDVLTRQFGGQK"
FT   sig_peptide     180320..180406
FT                   /locus_tag="Shewmr7_0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.827 at
FT                   residue 29"
FT   gene            181367..182554
FT                   /locus_tag="Shewmr7_0159"
FT   CDS_pept        181367..182554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0159"
FT                   /product="general secretion pathway protein L"
FT                   /note="TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway L; KEGG: son:SO0174 general
FT                   secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41165"
FT                   /db_xref="GOA:Q0I0E0"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0E0"
FT                   /protein_id="ABI41165.1"
FT                   /translation="MSERLFIRLGRTAEQACSWLVWSEQEQEIIASGELANAQGLSTLT
FT                   ERAGNRPIDVLVPASAMTLTSVNLPEKGQRQALKALPFMLEETIADDVDAMHFTVGPRN
FT                   GDALSVVAVAHEQMQTWLSCLAEAGLKVKRIVPDCLALPLQECQWAAMRFGNELLLRTG
FT                   LGTGHSLPLPWLPVAMKQLTAQADEVSVASYTEMELDGVELKPQPLDLPMLVLARGILH
FT                   APINLLTGVYTPKREYSKHLLQWKNAAIVLGVAIVLSLVNKGLTIHQVNGQIADLKAQS
FT                   EAIYQQVVPGNSRIVNLRSQMESQLRSLQGQGSGAEFFAMLDGLQDAFKQVPELKPNTL
FT                   RFESARNEIRMQVTAKNYAQIEKFKEIVGRRFQMDGGTMNSGEDQVTSTLTLRSK"
FT   gene            182556..183032
FT                   /locus_tag="Shewmr7_0160"
FT   CDS_pept        182556..183032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0160"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   son:SO0175 general secretion pathway protein M"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41166"
FT                   /db_xref="GOA:Q0I0D9"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D9"
FT                   /protein_id="ABI41166.1"
FT                   /translation="MDNLRTWWQGLASREQQIVGFGAVFLVIGVFYWGIWTPIANAEAN
FT                   ALRNLTAQQQTLTYVKQTANKIAGLKQSGAKPTMSGSLSSVVNQTAGTYGLVITRMQPQ
FT                   GDKIQVWMDDVPFDALLNYLSDLVQKKGLSLESVDLAEADAAGYVKVRRIQLAQ"
FT   gene            183047..183808
FT                   /locus_tag="Shewmr7_0161"
FT   CDS_pept        183047..183808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0161"
FT                   /product="type II secretion system protein N"
FT                   /note="PFAM: type II secretion system protein N; KEGG:
FT                   son:SO0176 general secretion pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41167"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D8"
FT                   /protein_id="ABI41167.1"
FT                   /translation="MSLIKKIIIGVLVYLVFLLALFPASVAVRLAPLPANVGISGVSGS
FT                   IWSGSIETLNLQQRQLEQVRWELSPWALFLGKVKLDFQVGSRATPVSAKGLITWSMGGI
FT                   SAQGLRFEAPDSFLIGNAKLPFRTEINGEVSLLVETLEQGKPWCEQLSGKLFLNQTNVK
FT                   NQFGNYPLGNIELGLSCVEGKAQLATDESKNQLGIIGTLQLDEGNMVKVAAKIKETNEQ
FT                   PEDMRKSLGMLGKRGSDGYFPVVYQGRIPGL"
FT   sig_peptide     183047..183130
FT                   /locus_tag="Shewmr7_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.360 at
FT                   residue 28"
FT   gene            complement(183873..184535)
FT                   /locus_tag="Shewmr7_0162"
FT   CDS_pept        complement(183873..184535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0162"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: son:SO0177 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3 protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41168"
FT                   /db_xref="GOA:Q0I0D7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D7"
FT                   /protein_id="ABI41168.1"
FT                   /translation="MFDWKKIDTVLLDMDGTLLDLHFDNHFWLSLVPQELSKQRGLSQS
FT                   QAQQLVEEAYGRVAGTLDWYCLDYWQSELQLDIMGLHRNLVDRIQLRQDSMPFLDALAA
FT                   AGKKRILVTNAHPKSLALKLEHTELASGLDAMISSHETGYPKEHPQFWQTLFEKFALVP
FT                   ERCLFIDDSEPILNAARLAGVGHQLGISNPDSQKPAKAFHDFPAISDYRLLFADLAG"
FT   gene            184817..185224
FT                   /locus_tag="Shewmr7_0163"
FT   CDS_pept        184817..185224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO0189 fibronectin type III domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41169"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D6"
FT                   /protein_id="ABI41169.1"
FT                   /translation="MISKYKGLNDDSLAFYFGFTSFRANITCGSFESKPIFPYFTTAIS
FT                   CPDANGGGGGLQHQGWRFEVPVGLFHWQADISSTMGNITIKTDLDGTDWYAGVRFSYQF
FT                   SDAWSVGLGYQYIDIEPNDLLSYQLNLRYQF"
FT   gene            185462..186013
FT                   /locus_tag="Shewmr7_0164"
FT   CDS_pept        185462..186013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0164"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: son:SO0190 MutT/nudix
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41170"
FT                   /db_xref="GOA:Q0I0D5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D5"
FT                   /protein_id="ABI41170.1"
FT                   /translation="MSQRHHKPEILHTEVVAKSRLFQIEQVHLKFSNGVERQYERMKGG
FT                   SRGAVMVVPIHQGNMLLAREYAAGTDNYELGFPKGLIDPGEQAIEAANRELQEEIGFGA
FT                   RKLTLLKELSLAPGYFSSKMQIFIAEDLYESRLEGDEPEPIDVVPWALVEWEALLDNSD
FT                   FSESRSVSALFLAQKHLQLK"
FT   gene            186084..186896
FT                   /locus_tag="Shewmr7_0165"
FT   CDS_pept        186084..186896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0165"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: son:SO0191 cysQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41171"
FT                   /db_xref="GOA:Q0I0D4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D4"
FT                   /protein_id="ABI41171.1"
FT                   /translation="MKPEELIDEVIAIATDAGRTIREIYLKGNFERETKSDNTPVTSAD
FT                   LAANKLICERLAALTPDIPILSEEAADIPLSVREGWKRYWLVDPLDGTGEFIAGSGDFS
FT                   VIIALVEHNRPVMGVVYVPMTQVCYYAIAGLGAYKRTDKQEVRISSRQIEHREQVSLRL
FT                   AVSRRQDPQSVLTLFNQPKHCELVVMGGAALKSCLVAEGRADCYVRVGPTGEWDTGAAQ
FT                   IIIEEAGGQLMDTELQPLTYNERETLENPNFIVVGAPNLEWDKILIGE"
FT   gene            186903..187346
FT                   /locus_tag="Shewmr7_0166"
FT   CDS_pept        186903..187346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0166"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   son:SO0192 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41172"
FT                   /db_xref="GOA:Q0I0D3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D3"
FT                   /protein_id="ABI41172.1"
FT                   /translation="MQSIRPVLKSELADVFQLEQAIFGDHCYPDFFFRQGFDCWPEQFL
FT                   VAVDDGGELLGYLLCAQSSDPACMWILSVAVSEQARGQGIGKQLIQQCLTQLPPQVKRV
FT                   DLTVDPHNPAHGLYQRLGFVDTAFEVDYFGAGADRVVMSYHCR"
FT   gene            187576..188187
FT                   /locus_tag="Shewmr7_0167"
FT   CDS_pept        187576..188187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO0193
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41173"
FT                   /db_xref="GOA:Q0I0D2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D2"
FT                   /protein_id="ABI41173.1"
FT                   /translation="MARRKEHSHDEIRAMAIEAAMALLQQQGTQELSLRKIASQIGYVP
FT                   STLINIFGSYNYLLLAVSEATLQAMMHELSEVNAENSRNQIISMAQKYAEFAHAQRQCF
FT                   KLVFELQLLDCEPLPESQGQLIAGLFRLIERELALLFPNKTATQQLQMSRVLWGGIHGL
FT                   TALSLDNKLFADTASLPALLESHVTGYLQGMGYQREASCC"
FT   gene            188178..190040
FT                   /locus_tag="Shewmr7_0168"
FT   CDS_pept        188178..190040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0168"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   son:SO0194 acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41174"
FT                   /db_xref="GOA:Q0I0D1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0D1"
FT                   /protein_id="ABI41174.1"
FT                   /translation="MLLTRRFLPYFATQCLGALNDNIYKNVLLLLITFSQVNDLPISVD
FT                   MFVNLAAGVFILPFFLFSAHAGVVADNMDKAKLIRRLKLLEVIIMFSAAAAIVSENYMM
FT                   MLLLLFLTGSQSAYFGPVKYSLLPQALKEDELVTGNAWVEMGTFLSILIGTLSAGILVS
FT                   ENNATLWSAITVASLALAGYLSSRAIPALPPQGTVQKIQFRPLSGTWRTIKKARQTPSI
FT                   WMAILAISWFWFLGATYLTQFPNFAKLHLHSGATVVSLLLGMFSIGIAVGSFVCERFSF
FT                   GHVELGLLPFGVLGLTVFGVDLLWAIPPAPADAQFVYGLQTFIAEPKHYRVMLDFFMIG
FT                   VSGGLFIVPLYAFIQARSAKGECAQAIAANNIMNSLFMVASALLSMLLLGGAGWSIPQL
FT                   FLLLAVMNFVVALYVYSQVPEFTQRFISYLLSHVMYRVTVTGREKIPKEGAGIIVCNHV
FT                   SYVDALIIMGASTRPIRFVMDKSISEIPVLKYLFRHAGVIPICSPRQSEATYNQAFESI
FT                   HEALANGELVCIFPEGRLTPDGELGEFRPGIDKILARDPVPVIPMALNGLWGSYFSHKD
FT                   GHALTTLPKRFWSKVSVSLTDVVDGQNADRHSLRDRVAELLNNA"
FT   gene            complement(190093..191202)
FT                   /locus_tag="Shewmr7_0169"
FT   CDS_pept        complement(190093..191202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0169"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="SMART: Rhodanese domain protein; KEGG: son:SO0195
FT                   YbbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41175"
FT                   /db_xref="GOA:Q0I0D0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0D0"
FT                   /protein_id="ABI41175.1"
FT                   /translation="MTTKLIPAQQYHDIFIAGQPLIDLRAPIEFDRGAFPSSVNLPLMV
FT                   DKEREKVGTCYKEQGQQAAIALGHSLVHGVVKQQRIDAWLNFLSAHPQAYLYCFRGGLR
FT                   SQLTQQWLQEAGVTVPYVQGGYKGMRQYLIGVIEAAPSLQPLLSLSGMTGSGKTDFLKR
FT                   RKEAIDLEGIANHRGSSFGKNIDPQPTQINFENRLAIALLHHQLGNHACLLLEDESFLI
FT                   GRSALPQSFYSAMQTADIVVLEEDDDIRLTRLLDEYVHKMHRGFIERLGLEAGFEAFSH
FT                   YLLQSLGSIRKRLGGKQYQELQDIMQQALSQQLNQNQTSQHLAWISLLLHKYYDPMYEY
FT                   QLQKKAGNILFRGSHQATHEWLDNYQSER"
FT   gene            complement(191202..192260)
FT                   /locus_tag="Shewmr7_0170"
FT   CDS_pept        complement(191202..192260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0170"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="KEGG: son:SO0196 selenide, water dikinase; TIGRFAM:
FT                   selenide, water dikinase; PFAM: AIR synthase related
FT                   protein; AIR synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41176"
FT                   /db_xref="GOA:Q0I0C9"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0C9"
FT                   /protein_id="ABI41176.1"
FT                   /translation="MSNSAVSSADSIKLTEYSHGAGCGCKISPKVLTTILASQLPVFTD
FT                   PNLLVGNQSRDDAAVYKLNDEIGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGT
FT                   PMMAIAILGWPVNKLPAEIAQQVVDGGRQACMEAGIMLAGGHSIDAPEPIFGLAVTGQI
FT                   ALTDLKQNDTAKAGDRLYLTKPIGIGILTTAQKQKKLKDEDSQIAVNAMCQLNSIGAKI
FT                   AKITGVNALTDVTGFGLAGHLLEVCQGAKLTAKLDLDSVPLLPRALDYLAQGCIPGGTH
FT                   RNYDSYGEHLPALTDHQKAILCDPQTSGGLLVAVSSEAEAELVALLNAHQIEPICIGSL
FT                   ETPTSTANVVLC"
FT   gene            complement(192357..193484)
FT                   /locus_tag="Shewmr7_0171"
FT   CDS_pept        complement(192357..193484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0171"
FT                   /product="Delta-9 acyl-phospholipid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /note="PFAM: fatty acid desaturase; KEGG: son:SO0197 fatty
FT                   acid desaturase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41177"
FT                   /db_xref="GOA:Q0I0C8"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0C8"
FT                   /protein_id="ABI41177.1"
FT                   /translation="MRILETIMNKPPIIWLNVILFSLTFLSAIILVPWYGLTQGFGASE
FT                   WIAFVVLAFASGLSITAGYHRLWSHKAYKAHPAVRFLYALGGALALQNSALHWASDHRV
FT                   HHKHVDDNDKDPYSAKMGFWYSHIGWMLREYQAQRYHDYQNVRDLQNDRIVMWQHKHYL
FT                   ALVILMNIGLPALLGWFTGNIAGMLLMAGLLRLVVVHHCTFFINSLAHVWGNQPYTDKN
FT                   TARDNGFLAMLTYGEGYHNFHHIFENDYRNGIKWWHYDPTKWLIKALSWVGLATDLRTS
FT                   PQERIESARLQMQLLHAKNKVIHLPNADEIIEKIQQEYELMKEHLLEYYQAKKALLEAK
FT                   RKQLVDQQLLLQVEELKTRFLTQQKSWKSLTASYS"
FT   gene            193607..194221
FT                   /locus_tag="Shewmr7_0172"
FT   CDS_pept        193607..194221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0172"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO0198
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41178"
FT                   /db_xref="GOA:Q0I0C7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0C7"
FT                   /protein_id="ABI41178.1"
FT                   /translation="MGIRAQQKEKTRRALVDAAFNQLSAERSFSSLSLREVAREANIAP
FT                   TSFYRHFKDMNELGLTMVDEGGLTLRQMMRKGRQRAEAGGSVIRISVDTFMEVLDSNPN
FT                   VFRILLHERSGTSAAFRAAVAREIEHFISELAHYTEATAGRTPMLARAQAEALVTLVFN
FT                   AGASALDMKRADRKVLADQLVMQLRMVAKGAEALQHKVEHR"
FT   gene            complement(194291..195388)
FT                   /locus_tag="Shewmr7_0173"
FT   CDS_pept        complement(194291..195388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0173"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="KEGG: son:SO0206 tRNA (uracil-5-)-methyltransferase;
FT                   TIGRFAM: tRNA (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41179"
FT                   /db_xref="GOA:Q0I0C6"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0C6"
FT                   /protein_id="ABI41179.1"
FT                   /translation="MNLAAMDPTTYDAQLTAKRIKLEQAFAQFETPSVEVFASEPAHYR
FT                   MRAEFRVWHEGDDLYYYMFDKVLNDKVRCDQYLPASALINQMMAALIAELKPNHSLRHK
FT                   LFQVDFLSTLSGEILVSLLYHRQLDDQWRSEAAALKARLSSQFKVNIIGRARKQKIDLD
FT                   KDFVVESLQVNDKVFHYKQIENSFTQPNAKVAIKMLEWAIDVTQNSQGDLLELYCGNGN
FT                   FSIALAQNFNRVLATELAKPSVDAAQYNIEVNNIDNLQIIRMSAEEFSDAMAKKRSFRR
FT                   LEGIDLDSYVCNTIFVDPPRAGIDPATLELVQGYERILYISCNPDTLKDNLQQLNQTHK
FT                   VTRFALFDQFPYTDHMETGVLLERR"
FT   gene            195530..196348
FT                   /locus_tag="Shewmr7_0174"
FT   CDS_pept        195530..196348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0174"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: son:SO0207 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41180"
FT                   /db_xref="GOA:Q0I0C5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0C5"
FT                   /protein_id="ABI41180.1"
FT                   /translation="MSQPILVFDSGIGGLSVLAEIRKLLPHHNYCYLFDNARLPYGELE
FT                   EQELISGCVALIDQVVERTHAAIVVVACNTASTVVLPALRATLSIPVVGVVPAIKPAAQ
FT                   LSKSKRIGLLATPGTVKRHYTYELISQFADDCHVELFGSSELVLMAEQKIATGQLDMAR
FT                   LAQVLSPIVEADLDVLVLGCTHFPMLRDELQQVLGKGVTLLDSGEAIAKRVKTLLAETK
FT                   SEQQVQEDANRDSVMQAFYTKAEISEGLASMLVDCGFSTLERITTINSNR"
FT   gene            complement(196360..196824)
FT                   /locus_tag="Shewmr7_0175"
FT   CDS_pept        complement(196360..196824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0175"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   son:SO0208 RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41181"
FT                   /db_xref="GOA:Q0I0C4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0C4"
FT                   /protein_id="ABI41181.1"
FT                   /translation="MQKSFLIVLVIAILGAIALSQFATTLPAYIAFVAGVIITTLVFKF
FT                   VPETNQAQGSDEQYVGPTMTLYVGNLPYRVHEGEVKVLFGEFGPVNSVRLVRDRKTGRR
FT                   KGFGFVEMSEAGAQKAMVKLNDFNFQERTLKVREAKTQDSEAADRTGTDE"
FT   sig_peptide     complement(196753..196824)
FT                   /locus_tag="Shewmr7_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 24"
FT   gene            197497..199031
FT                   /locus_tag="Shewmr7_R0007"
FT   rRNA            197497..199031
FT                   /locus_tag="Shewmr7_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            199103..199179
FT                   /locus_tag="Shewmr7_R0008"
FT                   /note="tRNA-Ile1"
FT   tRNA            199103..199179
FT                   /locus_tag="Shewmr7_R0008"
FT                   /product="tRNA-Ile"
FT   gene            199317..199392
FT                   /locus_tag="Shewmr7_R0009"
FT                   /note="tRNA-Ala1"
FT   tRNA            199317..199392
FT                   /locus_tag="Shewmr7_R0009"
FT                   /product="tRNA-Ala"
FT   gene            199667..202559
FT                   /locus_tag="Shewmr7_R0010"
FT   rRNA            199667..202559
FT                   /locus_tag="Shewmr7_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            202781..202896
FT                   /locus_tag="Shewmr7_R0011"
FT   rRNA            202781..202896
FT                   /locus_tag="Shewmr7_R0011"
FT                   /product="5S ribosomal RNA"
FT   gene            203066..204121
FT                   /locus_tag="Shewmr7_0176"
FT   CDS_pept        203066..204121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0176"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: son:SO0213 UDP-N-acetylmuramate dehydrogenase;
FT                   TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine reductase;
FT                   PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41182"
FT                   /db_xref="GOA:Q0I0C3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0C3"
FT                   /protein_id="ABI41182.1"
FT                   /translation="MSLLSRQNITMSFPYSLKPFNTFGVEQSCLSMIEVHSKAELQSTC
FT                   LSLYQSKRPMLVLGGGSNIVFTDDFNGTVVRVLTKGISCSEDGTHFYLAVEAGENWHEL
FT                   VQFSLNQNMPGLENLALIPGTVGAAPIQNIGAYGVELCDICDWVEYLDLESGNLLRLTT
FT                   DECEFAYRESIFKGSLRDKAVITAVGLRLPKAWHPKLAYGPLQSFNAETVTSREIFDRV
FT                   CEVRSEKLPNPEELGNAGSFFKNPIVSAATYMQLAAHFPSIVGYAQPNGEVKLAAGWLI
FT                   EHAGLKGFALGNAGVHAKQALVLVNLGHATGQDICRLALHVIARVNEVFGVKLEAEPRI
FT                   MGLTGETSLDV"
FT   gene            204114..205073
FT                   /locus_tag="Shewmr7_0177"
FT   CDS_pept        204114..205073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0177"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: son:SO0214 birA bifunctional protein; TIGRFAM:
FT                   biotin--acetyl-CoA-carboxylase ligase; PFAM: biotin protein
FT                   ligase domain protein; biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41183"
FT                   /db_xref="GOA:Q0I0C2"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0C2"
FT                   /protein_id="ABI41183.1"
FT                   /translation="MSDNWVRKREILGLLSSEYFVSGEELATQLGISRAAVSKHVDALE
FT                   DYGVAIYSVKGRGYKLANPISLIDSARLIQSIDNRCFYFDEIPSTNGFMLSHTGELKSG
FT                   DLCVAEYQSAGRGRRGRTWGSPYGHHLYFSQFWSFPQGMAQAMGLSLVVACSLVEVLKS
FT                   FGVDNIGVKWPNDIYLNYKKLAGILIEMSGQADSECQLIIGIGVNMAMSEDQGKGIDQP
FT                   WSDLSALATMPNKTDLVIALQKQLKKDIQLFEREGLAAFKLRWQGADLFYGKEIRLLMG
FT                   ENHVEGICRGVDEQGAVLLETADGTQAYIGGEISLRPR"
FT   gene            complement(205075..206025)
FT                   /locus_tag="Shewmr7_0178"
FT   CDS_pept        complement(205075..206025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0178"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: son:SO0215
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41184"
FT                   /db_xref="GOA:Q0I0C1"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0C1"
FT                   /protein_id="ABI41184.1"
FT                   /translation="MTSKNPIQKALYLAFERTQWSVLRDAVPMTLSEQDLENLRGINEK
FT                   VSLTEVTDIYLPLSRLLNLIVKAKQQRGLVLDEFLGQKPSSSPYIISIAGSVAVGKSTT
FT                   ARILQALLRHWPEHPKVDLVTTDGFLYPLADLKRKGLLQRKGFPESYDMKMLVEFIAAV
FT                   KSGQAHVNAPIYSHVTYDRIRGQHQTVSQPDILILEGLNVLQTGLDSPVDIRRPFVSDF
FT                   VDFSIYVDAEEHLLKQWYQERFLQFRKGAFSDEKSYFHHYASLTDDEANVIAAKIWDTI
FT                   NGPNLQLNIQPTRERAHLILQKGQDHLMSHVLLRK"
FT   gene            206138..206269
FT                   /locus_tag="Shewmr7_0179"
FT   CDS_pept        206138..206269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0C0"
FT                   /protein_id="ABI41185.1"
FT                   /translation="MLDEGGLSVKKHHLIAFFKQFVDFSLHLGTHLPNIPFRNDLPA"
FT   gene            206260..206335
FT                   /locus_tag="Shewmr7_R0012"
FT                   /note="tRNA-Thr1"
FT   tRNA            206260..206335
FT                   /locus_tag="Shewmr7_R0012"
FT                   /product="tRNA-Thr"
FT   gene            206343..206427
FT                   /locus_tag="Shewmr7_R0013"
FT                   /note="tRNA-Tyr1"
FT   tRNA            206343..206427
FT                   /locus_tag="Shewmr7_R0013"
FT                   /product="tRNA-Tyr"
FT   gene            206463..206536
FT                   /locus_tag="Shewmr7_R0014"
FT                   /note="tRNA-Gly1"
FT   tRNA            206463..206536
FT                   /locus_tag="Shewmr7_R0014"
FT                   /product="tRNA-Gly"
FT   gene            206546..206621
FT                   /locus_tag="Shewmr7_R0015"
FT                   /note="tRNA-Thr2"
FT   tRNA            206546..206621
FT                   /locus_tag="Shewmr7_R0015"
FT                   /product="tRNA-Thr"
FT   gene            206737..207921
FT                   /locus_tag="Shewmr7_0180"
FT   CDS_pept        206737..207921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0180"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   son:SO0217 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41186"
FT                   /db_xref="GOA:Q0I0B9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0B9"
FT                   /protein_id="ABI41186.1"
FT                   /translation="MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAISHVLAKTYGGEAK
FT                   DFSQIDNAPEERERGITINTSHIEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVASTDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDAELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGEPEWEAKIIELAEALDSYIPEPERDIDKPFLMPIEDVFSIS
FT                   GRGTVVTGRVERGIVRVGDEVEIVGIRATTKTTCTGVEMFRKLLDEGRAGENCGILLRG
FT                   TKRDDVERGQVLSKPGSINPHTTFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMKVTLICPIAMDEGLRFAIREGGRTVGAGVVAKIFA"
FT   gene            208199..208570
FT                   /locus_tag="Shewmr7_0181"
FT   CDS_pept        208199..208570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0181"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: son:SO0218
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41187"
FT                   /db_xref="GOA:Q0I0B8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0B8"
FT                   /protein_id="ABI41187.1"
FT                   /translation="MTTNTENQTNSLDIVKWGLAILLLAAAVIGNQMYSETSAVIRALA
FT                   VIVAFAIAGFIALQTEKGKKALAFARESQIEVRKVVWPTRQEALNTTFIVLAATGILAL
FT                   VLWGLDAVLMHIVNFITGV"
FT   gene            208580..209131
FT                   /locus_tag="Shewmr7_0182"
FT   CDS_pept        208580..209131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0182"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: son:SO0219 transcription antitermination
FT                   protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM:
FT                   transcription antitermination protein NusG; KOW domain
FT                   protein; SMART: NGN domain protein; KOW (Kyrpides,
FT                   Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41188"
FT                   /db_xref="GOA:Q0I0B7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0B7"
FT                   /protein_id="ABI41188.1"
FT                   /translation="MTEAKEAKKRWYVVQAFSGYEGRVCKSLIEYIKMHGMEQYFGEVL
FT                   VPTEEVIEMRAGQRRKSERKFFPGYVLVQMEMNDDSWHLVKSIPRVLGFIGGTSDRPAP
FT                   ISDREADAILRRLQETTASPTHRVIFEPGEVVRVCDGPFADFNGTVEEVDYDKSRVKVS
FT                   VMIFGRSTPVELDFSQVEKG"
FT   gene            209260..209688
FT                   /locus_tag="Shewmr7_0183"
FT   CDS_pept        209260..209688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0183"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: ribosomal
FT                   protein L11; KEGG: son:SO0220 50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41189"
FT                   /db_xref="GOA:Q0I0B6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0B6"
FT                   /protein_id="ABI41189.1"
FT                   /translation="MAKKIDAYIKLQVKSGSANPSPPVGPALGQKGVNIMEFCKAFNAR
FT                   TEKMEKGMPIPVVITVYSDRSFTFETKTPPASYLLKTAAGLKSGSPRPNTQKVGTIARA
FT                   KIQEIAELKAADMTGADVEAMTRSIEGTARSMGLVVEG"
FT   gene            209693..210394
FT                   /locus_tag="Shewmr7_0184"
FT   CDS_pept        209693..210394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0184"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="TIGRFAM: ribosomal protein L1; PFAM: ribosomal
FT                   protein L1; KEGG: son:SO0221 50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41190"
FT                   /db_xref="GOA:Q0I0B5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0B5"
FT                   /protein_id="ABI41190.1"
FT                   /translation="MAKLTKRMRVIREKVDGTKLYEINDAVALLKELATAKFVESVDVA
FT                   VNLGIDPRKSDQNVRGATVLPHGTGRDVRVAVFTQGANAEAAKAAGAELVGMDDLAEQI
FT                   KAGEMNFDVVIASPDAMRVVGMLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFTPVQLKENLEALISALKKAKPAVAKGVYVKKVSISTTMGAGV
FT                   AIDQATLETAN"
FT   gene            210660..211160
FT                   /locus_tag="Shewmr7_0185"
FT   CDS_pept        210660..211160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0185"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: son:SO0222 50S
FT                   ribosomal subunit protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41191"
FT                   /db_xref="GOA:Q0I0B4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0B4"
FT                   /protein_id="ABI41191.1"
FT                   /translation="MALRLEDKKAIVAEVNEAAKGALSAVAADSRGVTVGAMTGLRKKA
FT                   REAGVYVRVVRNTLARRAVEGTAFECLAETFTGPTLIAFSNEHPGAAARLLKDFAKEQA
FT                   NFEVKGAAFEGNFIPAADIDRLAKLPTYEEALAQLMMTMKEASAGKFVRTLAALRDQKQ
FT                   EAA"
FT   gene            211215..211586
FT                   /locus_tag="Shewmr7_0186"
FT   CDS_pept        211215..211586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0186"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: ribosomal
FT                   protein L7/L12; KEGG: son:SO0223 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41192"
FT                   /db_xref="GOA:Q0I0B3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0B3"
FT                   /protein_id="ABI41192.1"
FT                   /translation="MSITKDQILEAFAAMSVMEVVELIEAMEEKFGVSAAAAVVAGGAA
FT                   DAGAAAEEQTEFTVMLTAHGDNKVAVIKAIRGATGLGLKEAKAMSEAAPVAVKEGVSKE
FT                   EAEALKKELVEAGATVEIK"
FT   gene            211829..215866
FT                   /locus_tag="Shewmr7_0187"
FT   CDS_pept        211829..215866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0187"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: son:SO0224 DNA-directed RNA polymerase subunit
FT                   beta; TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase Rpb2,
FT                   domain 7; RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41193"
FT                   /db_xref="GOA:Q0I0B2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0B2"
FT                   /protein_id="ABI41193.1"
FT                   /translation="MVYSYSEKKRIRKDFGKRPQVLDIPYLLSIQLDSFKKFTDQDPTG
FT                   ERGLEAAFRSVFPIKSFSGNSELQYVSYKLGEPVFDVKECQIRGVTYSAPLRVKLRMVL
FT                   YDREAAAGTVKDIKEQEVYMGDIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDHDRGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDALFVRIDRRRKLPATIILRALEYSTQEILD
FT                   LFFERVEFKIKKDTLVMTLVPERLRGETASYDIKDAEGSVLVEAGRRITARHIRQLEKT
FT                   NTTELEVPVEYIVGKYAAQDYIDPDTGEVLVSANSEISLEDLAKLSLAGIKELSTLYIN
FT                   ELDHGAYISDTLRIDPTTNRLEALVEIYRMMRPGEPPTKDAAEALFQNLFFSEERYDLS
FT                   KVGRMKFNRRLSIPDDEGSGVLSKEDIVAVMKNIIHIRNGFDEVDDIDHLGNRRIRSVG
FT                   EMAENQFRVGLVRVERAVRERLSLGDLNELMPQDLINAKPISAAVKEFFGSSQLSQFMD
FT                   QNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLINSL
FT                   ASFARTNSYGFLETPYRKVVDGVITDDVEYLSAIEEGRYVIAQANIEVDSQGRMVEEQI
FT                   ACRHKGESTFMRASDIQYMDVSPQQIISVAASLIPFLEHDDANRALMGANMQRQAVPTL
FT                   KSEKPLVGTGIERTLAVDSGVVVAAKRGGVIDYVDASRIVVKVNEDELRPGEAGIDIYN
FT                   LTKYTRSNQNTCINQRPCCSVGEPVVRGDVLADGPSTDLGDLALGQNMRIAFMPWNGYN
FT                   FEDSILISERVAQEDRFTTIHIQELSCIARDTKLGSEEITADIPNVGESALSKLDESGI
FT                   VYIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVKGTII
FT                   DVQVFTRDGVEKDKRAIEIEEMHIAQARKDLGEEFKILEEGVLSRARNLLLSAGFTEAQ
FT                   IAALPRKDVLVQVIDDETKQTELEQLAEQHEELKADFDKKFEIKRRKITQGDDLAPGVL
FT                   KIVKVYLAVKRTIQPGDKMAGRHGNKGVISKINPIEDMPYDEQGNPVDIVLNPLGVPSR
FT                   MNIGQVLEVHLGAAAKGIGNKIAAMLEDQREKGLAEVRSYIKQVYELGDEVQQRVDIDS
FT                   FTDDELLRLANNLKGGIPVATPAFDGAKEKEIKQMLELAGLPTSGQLKLFDGRTGNEFE
FT                   RPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAY
FT                   GAAYTLQEMLTVKSDDVNGRTQMYKNIVDGNHQMQPGMPESFNVLLKEIRSLGINIELD
FT                   QE"
FT   gene            215950..220167
FT                   /locus_tag="Shewmr7_0188"
FT   CDS_pept        215950..220167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0188"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: son:SO0225 DNA-directed RNA polymerase, beta'
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase, alpha subunit; RNA
FT                   polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41194"
FT                   /db_xref="GOA:Q0I0B1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0B1"
FT                   /protein_id="ABI41194.1"
FT                   /translation="MKDLLKFLKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETIN
FT                   YRTFKPEREGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVIEPGMTSLERGQMLTEE
FT                   NYLDALEEYGDEFEAKMGAEAVLELLRAIDLEKEIEQMREELPSINSETRRKKVTKRLK
FT                   LMEAFHTSGNKPEWMILKVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLEGRGLATTIKAAKK
FT                   MVEREVAEVWDVLDEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPVITPSQDVVLGLYYTSRER
FT                   INGRGEGMYFMSVAEVEKAYATGAAELHARVKVRITETVIGDNGERTEQRRIVDTTVGR
FT                   ALLSQILPAGLSFDLVNQNMGKKQISKLLNTCYRQLGLKDTVIFADQLMYTGFRYATIS
FT                   GASVGIDDMVIPAEKYTLVADAEAEVLEIQEQFQSGLVTAGERYNKVIDIWASANEKVS
FT                   KAMMENLSTETVINRDGVEEKQASFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPIVANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHEGLTMKPLIEGGDVVEPLRERVLGRVVAVDVMYPGTEDVLAPRNTLLDEAWCDK
FT                   LEEHSIDEVIVRSVITCDTDFGVCAACYGRDLARGHLINHGEAIGVVAAQSIGEPGTQL
FT                   TMRTFHIGGAASRASAENNVQVKNSGSLKLHNAKYVTNTDGKLVIVSRSSELAIIDELG
FT                   REKERYKVPYGTVLEKLEEASVEAGDIIANWDPHTHPIITEVAGSIKFVDMIDGVTMTR
FT                   QTDELTGLSSIVILDVGQRGSAGKEMRPMIRLVGADGSDLMIPGTEVPAQYFLPGSAIV
FT                   NLDDNAQIAVGDALARIPQESSKTRDITGGLPRVADLFEARKPKEPAILAEISGTISFG
FT                   KETKGKRRLVITPADGGEQYEEMIPKWRNLNVFEGEKVERGEVIADGPEAAHDILRLRG
FT                   IHNVANYIVNEVQDVYRLQGVKINDKHIEVIIRQMLRKCVITSAGDSEFLEGEQVEVSR
FT                   VKIANRELVEQGKVPATFERELLGITKASLATESFISAASFQETTRVLTEAAVGGKSDN
FT                   LRGLKENVIVGRLIPAGTGYAYHKTRNDARAKKDEPVVVNKITASEAEQNLADLLNLAG
FT                   SQD"
FT   gene            220347..220721
FT                   /locus_tag="Shewmr7_0189"
FT   CDS_pept        220347..220721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0189"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: son:SO0226 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41195"
FT                   /db_xref="GOA:Q0I0B0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0B0"
FT                   /protein_id="ABI41195.1"
FT                   /translation="MATVNQLVRKPRAPKVDKTNVPALNACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVTSRRQSRSKYGAKRPKS"
FT   gene            220802..221272
FT                   /locus_tag="Shewmr7_0190"
FT   CDS_pept        220802..221272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0190"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: son:SO0227 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41196"
FT                   /db_xref="GOA:Q0I0A9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A9"
FT                   /protein_id="ABI41196.1"
FT                   /translation="MPRRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYK
FT                   ALDVIAEKKGANHLDILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWL
FT                   VEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW"
FT   gene            221351..223447
FT                   /locus_tag="Shewmr7_0191"
FT   CDS_pept        221351..223447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0191"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: son:SO0228 elongation factor EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41197"
FT                   /db_xref="GOA:Q0I0A8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A8"
FT                   /protein_id="ABI41197.1"
FT                   /translation="MARTTPIERYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHD
FT                   GAATTDWMVQEQERGITITSAAVTTFWRGMDAQFTEHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQADKYRVPRLVFVNKMDRAGADFERVVKQIRTRLG
FT                   ATCVPIQLNIGAEENFTGVIDLIKMKAINWNEADQGMTFTYEEIPASLAAKAAEMHEYL
FT                   VEAAAEASDELMDKYLEEGTLSEDEIKKALRQRTINNEIVLATCGSAFKNKGVQAVLDA
FT                   VVEFLPAPVDVPPIKGIDDDEQEVERPSDDNAPFAALAFKIATDPFVGTLTFIRVYSGV
FT                   LESGSGVYNSVKQKRERIGRIVQMHANDRTELKEVRAGDIAAAIGLKEVTTGDTLCDPD
FT                   HKVILERMEFPEPVITIAVEPKSKADQDKMGIALQKLAAEDPSFRVETDEESSQTLISG
FT                   MGELHLDIIVDRMRREFGVECNVGKPQVAYRETIRASVEAEGKFVRQSGGRGQFGHVWL
FT                   KLEPNEEGAGYEFINAIVGGVVPREFIPAVDKGIQEQMKNGVLAGFPVLDVKVTLFDGS
FT                   YHDVDSNEMAFKIAGSMGFKKGALEANPVLLEPCMKVEVTTPENYMGDVVGDLNRRRGL
FT                   IEGMDDGFGGIKIVHAVVPLSEMFGYATDLRSATQGRASYSMEFLKYSDAPQNIAKAII
FT                   ESRS"
FT   gene            223519..224703
FT                   /locus_tag="Shewmr7_0192"
FT   CDS_pept        223519..224703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0192"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   son:SO0229 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41198"
FT                   /db_xref="GOA:Q0I0A7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A7"
FT                   /protein_id="ABI41198.1"
FT                   /translation="MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAISHVLAKTYGGEAK
FT                   DFSQIDNAPEERERGITINTSHIEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVASTDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDAELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGEPEWEAKIIELAEALDSYIPEPERDIDKPFLMPIEDVFSIS
FT                   GRGTVVTGRVERGIVRVGDEVEIVGIRTTTKTTCTGVEMFRKLLDEGRAGENCGILLRG
FT                   TKRDDVERGQVLSKPGSINPHTTFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            225042..225353
FT                   /locus_tag="Shewmr7_0193"
FT   CDS_pept        225042..225353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0193"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: son:SO0230 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41199"
FT                   /db_xref="GOA:Q0I0A6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A6"
FT                   /protein_id="ABI41199.1"
FT                   /translation="MQNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERYTVLISPHVNKDARDQYELRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            225381..226019
FT                   /locus_tag="Shewmr7_0194"
FT   CDS_pept        225381..226019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0194"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: son:SO0231 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41200"
FT                   /db_xref="GOA:Q0I0A5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A5"
FT                   /protein_id="ABI41200.1"
FT                   /translation="MAIGLIGRKVGMTRIFTEDGVSIPVTVIEVAGNRVTQVKTLETDG
FT                   YRALQVTTGTKKANRITKPEAGHFAKSGVEAGRGLWELRLADGEGEGIEVGAELNVGIF
FT                   ADVAKVDVTGQSKGKGFQGGVKRWNFRTQDMTHGNSLSHRSNGSIGQNQTPGRVFKGKK
FT                   MSGHMGAERVTTQNLDVVRVDVERNLLLVKGAVPGATNGDLIIKPAVKA"
FT   gene            226037..226642
FT                   /locus_tag="Shewmr7_0195"
FT   CDS_pept        226037..226642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0195"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: son:SO0232 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41201"
FT                   /db_xref="GOA:Q0I0A4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A4"
FT                   /protein_id="ABI41201.1"
FT                   /translation="MELVLKDAQSALEVSETTFGRDFNEALVHQVVVAYAANARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGGVKGPIWRGGGVTFAAKTQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLVVVESFSVEAPKTKELKAKLKAMNLEDVLIVTAEVDENLFLAARN
FT                   LYKVDVRDVAGLDPVSLIAFNTVLVTADAVKQIEEMLA"
FT   gene            226639..226944
FT                   /locus_tag="Shewmr7_0196"
FT   CDS_pept        226639..226944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0196"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: son:SO0233
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41202"
FT                   /db_xref="GOA:Q0I0A3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A3"
FT                   /protein_id="ABI41202.1"
FT                   /translation="MMIREERLLKVILAPHISEKSTVNAEKHNTVVFRVAIDATKAEIK
FT                   AAVAKLFEVEVESVRTLVSKGKTKRTGGRVGRRSDWKKAYVTLAAGADIDFVGGAE"
FT   gene            226961..227785
FT                   /locus_tag="Shewmr7_0197"
FT   CDS_pept        226961..227785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0197"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: son:SO0234 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41203"
FT                   /db_xref="GOA:Q0I0A2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A2"
FT                   /protein_id="ABI41203.1"
FT                   /translation="MAVIKCKPTSPGRRHVVKVVNSDLHKGKPFAGLLAKKSKSGGRNN
FT                   TGRITVRHVGGGHKQHYRLIDFKRDKDGIPAKIERLEYDPNRTAHIALVLYADGERRYI
FT                   LAAKGMQAGDKIQSGVEAEIKTGNAMPLRNIPVGSVVHAVEMKPGKGAQIARSAGAYVQ
FT                   VVARDGAYATLRLRSGEMRKVPVDCRATFGEVGNAEHMLRQLGKAGAKRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVTPWGVPTKGYKTRSNKRTDKYIVRRRNK"
FT   gene            227800..228078
FT                   /locus_tag="Shewmr7_0198"
FT   CDS_pept        227800..228078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0198"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: sdn:Sden_0174 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41204"
FT                   /db_xref="GOA:Q0I0A1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A1"
FT                   /protein_id="ABI41204.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAMEAGDKKPIKTWSRRSMIIPNMI
FT                   GLTIAVHNGRQHVPVFVTDEMIGHKLGEFSPTRTYRGHAADKKAKKR"
FT   gene            228094..228426
FT                   /locus_tag="Shewmr7_0199"
FT   CDS_pept        228094..228426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0199"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: son:SO0236 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41205"
FT                   /db_xref="GOA:Q0I0A0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0A0"
FT                   /protein_id="ABI41205.1"
FT                   /translation="MEVLAKHRFARTSAQKARLVADQIRGLPVAKALEILTFSPKKAAV
FT                   LVKKVLDSAIANAEHNEGADIDELKVGAVFVDEGPTMKRIMPRAKGRADRIMKRTSHIT
FT                   VVVSDR"
FT   gene            228436..229128
FT                   /locus_tag="Shewmr7_0200"
FT   CDS_pept        228436..229128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0200"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: son:SO0237 30S ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41206"
FT                   /db_xref="GOA:Q0I099"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I099"
FT                   /protein_id="ABI41206.1"
FT                   /translation="MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRKYLAD
FT                   KLQAASVSKIVIERPAKSIRVTIHTARPGVVIGKKGEDVEVLRAAVSKLAGTPAQINIA
FT                   EIRKPELDAKLVADSIAQQLERRVMFRRAMKRAVQNAMRIGAQGIKVEVSGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYSTSESHTQYGVIGIKVWIFKGEVLDGMLPQIEEPKQQQ
FT                   PKRKPRGK"
FT   gene            229140..229550
FT                   /locus_tag="Shewmr7_0201"
FT   CDS_pept        229140..229550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0201"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: son:SO0238 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41207"
FT                   /db_xref="GOA:Q0I098"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I098"
FT                   /protein_id="ABI41207.1"
FT                   /translation="MLQPKRMKFRKMFKGRNRGLANGTEVSFGTFGLKAVGRGRLTARQ
FT                   IESARRAMTRHIKRQGQIWIRVFPDKPITSKPLEVRMGKGKGNVEYWVCQIQPGKVLYE
FT                   MNGVSEVIAREAFALAAAKLPIKTTFVTKTVM"
FT   gene            229550..229741
FT                   /locus_tag="Shewmr7_0202"
FT   CDS_pept        229550..229741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0202"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: son:SO0239 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41208"
FT                   /db_xref="GOA:Q0I097"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I097"
FT                   /protein_id="ABI41208.1"
FT                   /translation="MKASELREKSVEELNAELLGLLREQFNLRMQHATGQLTQTHQLKL
FT                   VRRNIARVKTIITSKAGA"
FT   gene            229741..229989
FT                   /locus_tag="Shewmr7_0203"
FT   CDS_pept        229741..229989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0203"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: son:SO0240 30S
FT                   ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41209"
FT                   /db_xref="GOA:Q0I096"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I096"
FT                   /protein_id="ABI41209.1"
FT                   /translation="MSDKIRTLQGRVTSNKMDKTITVAIERQVKHPIYGKYIKRTTKIH
FT                   AHDEANQCNEGDVVAIRECRPLSKTKSWTLVEVVSKA"
FT   gene            230168..230536
FT                   /locus_tag="Shewmr7_0204"
FT   CDS_pept        230168..230536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0204"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: son:SO0241 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41210"
FT                   /db_xref="GOA:Q0I095"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I095"
FT                   /protein_id="ABI41210.1"
FT                   /translation="MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKE
FT                   AIPRAKAKKGDVYNAVVVRTKKGVRRPDGSVIRFDRNAAVLLNNNLQPIGTRIFGPVTR
FT                   ELRNEQFMKIVSLAPEVL"
FT   gene            230548..230862
FT                   /locus_tag="Shewmr7_0205"
FT   CDS_pept        230548..230862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0205"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: son:SO0242 50S ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41211"
FT                   /db_xref="GOA:Q0I094"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I094"
FT                   /protein_id="ABI41211.1"
FT                   /translation="MAAKIRRQDEVIVLAGKDKGKRAKVAQVLPTGKLIVEGINLVKKH
FT                   QKPNPQLGVAGGIVEKEAPIQASNVAIFNPVTGKADRVGFRFEDGKKVRFFKSNSELVK
FT                   "
FT   gene            230875..231414
FT                   /locus_tag="Shewmr7_0206"
FT   CDS_pept        230875..231414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0206"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: son:SO0243 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41212"
FT                   /db_xref="GOA:Q0I093"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I093"
FT                   /protein_id="ABI41212.1"
FT                   /translation="MAKLHDKYQETVVAELTKKFGYTSVMQVPRIEKITLNMGVGEAVA
FT                   DKKVMEHAVRDMTAIAGQKPVVTVARKSVAGFKIREGYPIGCKVTLRGERMWEFLERLV
FT                   DIAIPRIRDFRGLSAKAFDGRGNYAMGVREQIIFPEIDYDKIDKIRGMDIVITTSANTD
FT                   EEGRALLDAFNFPFKK"
FT   gene            231425..231730
FT                   /locus_tag="Shewmr7_0207"
FT   CDS_pept        231425..231730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0207"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: son:SO0244 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41213"
FT                   /db_xref="GOA:Q0I092"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I092"
FT                   /protein_id="ABI41213.1"
FT                   /translation="MAKTSMKAREAKRAQLVAKFAEKRAALKAIIANPASSDEDRWDAV
FT                   LKLQALPRDSSASRQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW"
FT   gene            231755..232147
FT                   /locus_tag="Shewmr7_0208"
FT   CDS_pept        231755..232147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0208"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: son:SO0245 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41214"
FT                   /db_xref="GOA:Q0I091"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I091"
FT                   /protein_id="ABI41214.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVSVKMPSAKLKVAIAKLLKEEGY
FT                   IADYAVADEAKPELEITLKYFQGQPVVETIQRVSRPGLRIYKGKNELPKVMGGLGVAIV
FT                   STSKGLMTDRAARLAGMGGEVICYVA"
FT   gene            232158..232691
FT                   /locus_tag="Shewmr7_0209"
FT   CDS_pept        232158..232691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0209"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: son:SO0246 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41215"
FT                   /db_xref="GOA:Q0I090"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I090"
FT                   /protein_id="ABI41215.1"
FT                   /translation="MSRVAKAPVSIPAGVEVTLNEQTLTVKGAKGSLTRVINNAVNVVI
FT                   EDGVIKFLPVEGAVGAWAQAGTTRALVNNMVVGVSQGFERKLKLVGVGYRAKLVGADID
FT                   LTLGFSHPLVHKLPAGVTAECPSQTDIVLRGVDKQLIGQVAAEIRGYRPPEPYKGKGVR
FT                   YDDEEVRRKEAKKK"
FT   gene            232702..233052
FT                   /locus_tag="Shewmr7_0210"
FT   CDS_pept        232702..233052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0210"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: son:SO0247 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41216"
FT                   /db_xref="GOA:Q0I089"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I089"
FT                   /protein_id="ABI41216.1"
FT                   /translation="MDKKTSRLRRAIRARKKIQELGVNRLVVHRTPRHIYAQVINPEAQ
FT                   VVAAASTVEKAVKEQLKSTGNVDAAKAVGKFVAERAIEKGVTSVAFDRSGFKYHGRVAA
FT                   LADAAREAGLQF"
FT   gene            233065..233568
FT                   /locus_tag="Shewmr7_0211"
FT   CDS_pept        233065..233568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0211"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5; ribosomal protein S5 domain protein; KEGG:
FT                   son:SO0248 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41217"
FT                   /db_xref="GOA:Q0I088"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I088"
FT                   /protein_id="ABI41217.1"
FT                   /translation="MAKLEAQQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNG
FT                   KVGYGYGKAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGT
FT                   GIIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVD
FT                   EIRG"
FT   gene            233575..233757
FT                   /locus_tag="Shewmr7_0212"
FT   CDS_pept        233575..233757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0212"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: son:SO0249 50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41218"
FT                   /db_xref="GOA:Q0I087"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I087"
FT                   /protein_id="ABI41218.1"
FT                   /translation="MATKTVKVTQTKSAIGRLPKHRATLTGLGLRRIGHTVELEDTPSI
FT                   RGMINKVYYMVKVED"
FT   gene            233761..234195
FT                   /locus_tag="Shewmr7_0213"
FT   CDS_pept        233761..234195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0213"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: son:SO0250 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41219"
FT                   /db_xref="GOA:Q0I086"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I086"
FT                   /protein_id="ABI41219.1"
FT                   /translation="MRLNTLSPAAGAKHAPKRVGRGMGSGLGKTAGRGHKGQKSRSGGG
FT                   VRPGFEGGQMPLKIRLPKFGFTSRRAMVTAEVRVLELAKVNGDVIDLNALKDANVITRN
FT                   IQFAKIVLSGTIERPVTVKGLKVTKGARAAIEAAGGKIEE"
FT   gene            234203..235543
FT                   /locus_tag="Shewmr7_0214"
FT   CDS_pept        234203..235543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0214"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: son:SO0251 preprotein translocase, SecY
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41220"
FT                   /db_xref="GOA:Q0I085"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I085"
FT                   /protein_id="ABI41220.1"
FT                   /translation="MAKPGLDLKSAKGGLSELKARLLFVIGAIIVFRAGSFVPIPGIDA
FT                   AVLAELFAQQKGTILGMFNMFSGGALSRASIFALGIMPYISASIIMQLLTVVHPALAEL
FT                   KKEGESGRKKISQYTRWGTLVLGTFQSIGIATGLPNLVPGLVVNIGFGFYFVAVVSLVT
FT                   GTMFLMWLGEQITERGIGNGISILIFAGIVAGLPSAIGQTAEQARQGDLNVLVLLLLAV
FT                   IIFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKINMAGVIPPIFASSII
FT                   LFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSLLYAAAIIFFCFFYTALVFNPRETA
FT                   DNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGALYITFICLIPEFMLIAWKVQFYFG
FT                   GTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLVNKANLDRFGR"
FT   gene            235565..235678
FT                   /locus_tag="Shewmr7_0215"
FT   CDS_pept        235565..235678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0215"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: sdn:Sden_0191 ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41221"
FT                   /db_xref="GOA:Q0I084"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I084"
FT                   /protein_id="ABI41221.1"
FT                   /translation="MKVRASVKKICRNCKIVKRSGVVRVICVEPKHKQRQG"
FT   gene            235794..236150
FT                   /locus_tag="Shewmr7_0216"
FT   CDS_pept        235794..236150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0216"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: son:SO0253 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41222"
FT                   /db_xref="GOA:Q0I083"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I083"
FT                   /protein_id="ABI41222.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGRTRARAICAATSIAETAKI
FT                   KELSEAQIDTLREEVAKYLVEGDLRREISMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            236165..236557
FT                   /locus_tag="Shewmr7_0217"
FT   CDS_pept        236165..236557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0217"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: son:SO0254 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41223"
FT                   /db_xref="GOA:Q0I082"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I082"
FT                   /protein_id="ABI41223.1"
FT                   /translation="MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSW
FT                   ATSGGSGFRGSRKSTPFAAQVAAERAGAAAQDYGLKNLEVFVKGPGPGRESAIRALNAV
FT                   GYKITNITDVTPIPHNGCRPPKKRRV"
FT   gene            236589..237209
FT                   /locus_tag="Shewmr7_0218"
FT   CDS_pept        236589..237209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0218"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: ribosomal
FT                   protein S4; RNA-binding S4 domain protein; KEGG: son:SO0255
FT                   30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41224"
FT                   /db_xref="GOA:Q0I081"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I081"
FT                   /protein_id="ABI41224.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKLESAPGQHGARK
FT                   PRLSEYGLQLREKQKVRRIYGVLEKQFRNYYKEAARLKGNTGENLLQLLETRLDNVVYR
FT                   MGFGATRAESRQLVSHKSVMVNGRVVNIPSFKVSANDVVSIREKSRTQARIKAALEVAA
FT                   QREKPTWVEVDSAKMEGAFKRIPERSDLSAEINEQLIVELYSK"
FT   gene            237234..238223
FT                   /locus_tag="Shewmr7_0219"
FT   CDS_pept        237234..238223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0219"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: son:SO0256 DNA-directed RNA polymerase subunit
FT                   alpha; TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase, alpha subunit domain protein; RNA
FT                   polymerase, dimerisation; RNA polymerase, insert; SMART:
FT                   RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41225"
FT                   /db_xref="GOA:Q0I080"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I080"
FT                   /protein_id="ABI41225.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVNSTRAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEILLNLKGLAVTIEGKDEAMLTLSK
FT                   SGAGPVIAADITHDGDVTIVNPDHVICHLTGNNDISMRIRVERGRGYVPASARAQTEDD
FT                   DRPIGRLLVDASFSPVARIAYNVEAARVEQRTDLDKLVIDMTTNGTIDPEEAIRRSATI
FT                   LAEQLDAFVELRDVTEPEMKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLV
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASLADDL"
FT   gene            238264..238659
FT                   /locus_tag="Shewmr7_0220"
FT   CDS_pept        238264..238659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0220"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: son:SO0257 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41226"
FT                   /db_xref="GOA:Q0I079"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I079"
FT                   /protein_id="ABI41226.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMASSLVRHEIIKTTVAKAKELR
FT                   RVVEPLITLAKSDSVANRRLAFARTRDAEVVGKLFTELGPRYQERPGGYTRILKCGLRA
FT                   GDKAPMAYIELVGRPEAAQAVEVEAAE"
FT   gene            complement(238724..239728)
FT                   /pseudo
FT                   /locus_tag="Shewmr7_0221"
FT   gene            complement(239841..240326)
FT                   /locus_tag="Shewmr7_0222"
FT   CDS_pept        complement(239841..240326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0222"
FT                   /product="CcmE/CycJ protein"
FT                   /note="PFAM: CcmE/CycJ protein; KEGG: son:SO0259 cytochrome
FT                   c biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41227"
FT                   /db_xref="GOA:Q0I078"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I078"
FT                   /protein_id="ABI41227.1"
FT                   /translation="MNPRRKKRLTLAIALIGGVAAIASLLLYALNSNLNLFYTPSEIVN
FT                   GKADTGVKPEAGQRIRVGGMVTVGSMVRDPNSLHVQFAVHDSLGGEIMVTYDDLLPDLF
FT                   REGQGIVAQGVLGEDGKLAATEVLAKHDENYMPPEVAEAMGQKHEKLDYSQQKSAAQ"
FT   sig_peptide     complement(240237..240326)
FT                   /locus_tag="Shewmr7_0222"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.851 at
FT                   residue 30"
FT   gene            complement(240323..240523)
FT                   /locus_tag="Shewmr7_0223"
FT   CDS_pept        complement(240323..240523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0223"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /note="PFAM: Heme exporter protein D (CcmD); KEGG:
FT                   son:SO0260 heme exporter protein CcmD"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41228"
FT                   /db_xref="GOA:Q0I077"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I077"
FT                   /protein_id="ABI41228.1"
FT                   /translation="MQFDSISDFFNMGGYAFYVWLAYGVTFFCLSTLIITSARQKRKVL
FT                   IEIAKKMNREERLKETRSTKS"
FT   gene            complement(240523..241269)
FT                   /locus_tag="Shewmr7_0224"
FT   CDS_pept        complement(240523..241269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0224"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: son:SO0261 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41229"
FT                   /db_xref="GOA:Q0I076"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I076"
FT                   /protein_id="ABI41229.1"
FT                   /translation="MWKWLHPYADPERAYKLSGTLFPWFATLACLFITVGTVWGLMFAP
FT                   TDYQQGDSYRIIFIHVPAASMSMAAYMGMATAAFIGLVWQVKLADWAAASIAPIGAVIT
FT                   FIALFTGAAWGKPMWGTWWVWDARLTSELVLLFLYLGVISLYASFEDKVLAARAAGILA
FT                   IVGVINIPIIKYSVEWWSSLHQPSTIKITSKSTMSSEMLYPLLINILGFGLMIGAITIV
FT                   RFRAEILARNGMRPWVRELAKAEEVK"
FT   gene            complement(241271..241957)
FT                   /locus_tag="Shewmr7_0225"
FT   CDS_pept        complement(241271..241957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0225"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG: son:SO0262
FT                   heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41230"
FT                   /db_xref="GOA:Q0I075"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I075"
FT                   /protein_id="ABI41230.1"
FT                   /translation="MKRGISFTTAFFTLLQRDLKIAIRHRGDIFNPLLFFIMVVTLFPL
FT                   GIGPEPQMLARIAPGIIWVAALLASMLSLERLFKADFSDGSLEQMLLSPQPLSVLVLAK
FT                   VLAHWLLTGVPLIIIAPLLAVLLNLEANSYGALIATLALGTPVLSLLGAIGVALTVGLR
FT                   KGGVLLSLLILPLYIPVLIFATSAIDAAGMNLPYDGQLAIIGAMLIGSLTLAPFAIGAS
FT                   LRVSTN"
FT   gene            complement(241969..242619)
FT                   /locus_tag="Shewmr7_0226"
FT   CDS_pept        complement(241969..242619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0226"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: son:SO0263 heme exporter protein CcmA;
FT                   TIGRFAM: heme exporter protein CcmA; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41231"
FT                   /db_xref="GOA:Q0I074"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I074"
FT                   /protein_id="ABI41231.1"
FT                   /translation="MTNITSVNTLVSASKLTCIREERILFDELSFDINAGDIVQIEGPN
FT                   GAGKTSLLRILAGLSRPYAGQTFYLNEDINRCRDEYNEDLLYLGHLAGVKSELTAEENL
FT                   NFNLRISGYDDFDTAAILAKVNLAGFEEALAGHLSAGQHRRTALARLWHNDCKVWILDE
FT                   PFTAIDKKGVEELEQLFIQHADNGGCVILTTHQDMGIIKDDRLRKIRLDYRFV"
FT   gene            242945..243244
FT                   /locus_tag="Shewmr7_0227"
FT   CDS_pept        242945..243244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0227"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: son:SO0264
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41232"
FT                   /db_xref="GOA:Q0I073"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I073"
FT                   /protein_id="ABI41232.1"
FT                   /translation="MKKLLAMTAVAALTMSVNVSAQDAEAIFNKACTVCHSMGVAGAPK
FT                   AHNAAEWEPRLAKGMDTLLHSVKTGLNAMPPGGMCTDCTDEDYKAAIEFMSKAQ"
FT   sig_peptide     242945..243010
FT                   /locus_tag="Shewmr7_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(243334..244581)
FT                   /locus_tag="Shewmr7_0228"
FT   CDS_pept        complement(243334..244581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0228"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: son:SO0265
FT                   cytochrome c-type biogenesis protein CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41233"
FT                   /db_xref="GOA:Q0I072"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I072"
FT                   /protein_id="ABI41233.1"
FT                   /translation="MTTFWIFIALVVLVSLLLIWIPHFRQQKLLRTEEAGVRKQTNLEL
FT                   FNERLATLEKELNEELLDQAEFDALKKELEISLLQDIKQASDDSLVNQIKPKSILWPSI
FT                   MSVCLIAISGYLYQHLGAFENIGNTQPANPHAGMDAAQIMAQRVQMMEAQVQAEPENSQ
FT                   AWFSLGHAYISANQFDKAVAAFDKVMDLVGKHAELLGPKATALYYKNGQQMTPQIQALI
FT                   DESLALDPLDPSTLLLVGMDAFFTANYQKAIDSWQAILSSDRTDVDRAALMNAIETANL
FT                   RMQGETAGMPNDDVHKQAKVATKSVSIEISISPELAAQASPEDSIFVFARATEGPKVPL
FT                   AATKVSAKSLPITVTLDDSTGMGGDVKLSQTASVEVIAVLSKHGNIKPQAGDIQGKVSK
FT                   VNVGETANLVLDTQVQ"
FT   gene            244981..246960
FT                   /locus_tag="Shewmr7_0229"
FT   CDS_pept        244981..246960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0229"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: son:SO0266
FT                   cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41234"
FT                   /db_xref="GOA:Q0I071"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I071"
FT                   /protein_id="ABI41234.1"
FT                   /translation="MIPELGHFSLIIGVAFAFLLISVPLIGVARKDQYLVRYAWPLTYG
FT                   MFFFIALSVVSLGYSFAVDDFSVAYVAHHSNSQLPIFFKIAAVWGGHEGSLLFWVFALS
FT                   TWAASVALFSKGLEEVFTARVLAVLALIVIGFSLFMLLTSSPFERLFPMPAEGRDLNPM
FT                   LQDVGLIFHPPMLYLGYVGFSVSFAFAIAALMSGHLDSAWARWSRPWTLAAWIFLTGGI
FT                   ALGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALVHSLIVTEKRGAFRNWTVLLSIF
FT                   AFSLSLLGTFIVRSGVLTSVHSFAADPSRGMFILLLLGLAIGGSLTLFAFRASEMSSPA
FT                   RFELKSKETMLLVCNVLLTVAAGTVLLGTLYPLLIDALGMGKISVGPPYFNAVFVPIVL
FT                   VLFGFMGVGPIIRWKKSKAGELKRQLLVPALVSAAIGIVTPFIVDGAFNAWVAFGIAAA
FT                   AWIVLATARAAYNIVKPKDGELSMARMGRSQLGMILAHLGIAVSVIGATMVSNYSIEKS
FT                   VRMGPGVSQELAGYTFKYLETKNVVGPNYTAQQGQIEIYKGDKLLTLLKPDRRQYNVRT
FT                   MDMTEAGIDWGLFRDLYVTMGDPISSTEFAVRLNYKPFVRWLWFGAIFMMVGGFFAASD
FT                   KRYRSKVAATVKPQAEKAKLATAQ"
FT   gene            246972..247526
FT                   /locus_tag="Shewmr7_0230"
FT   CDS_pept        246972..247526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0230"
FT                   /product="periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: Redoxin domain protein; KEGG:
FT                   son:SO0267 thiol:disulfide interchange protein DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41235"
FT                   /db_xref="GOA:Q0I070"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I070"
FT                   /protein_id="ABI41235.1"
FT                   /translation="MKKLVLFIPLVIFLGMGVFLYKGLFLNPQKLDSALEGKPIPAFQL
FT                   ERLETPNEMITNEQLKGKVSLLNVWATWCPSCKYEHPFLVMLKRQNILPIYGINYRDER
FT                   IPALEELKRQGDPYHINIFDKDGRLGLDLGVYGAPESFIVDHKGIIRFRYAGPIDQRVW
FT                   SETLYPMIQQLQAEAAKDGAA"
FT   gene            247523..248002
FT                   /locus_tag="Shewmr7_0231"
FT   CDS_pept        247523..248002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0231"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   son:SO0268 cytochrome c-type biogenesis protein CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41236"
FT                   /db_xref="GOA:Q0I069"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR017565"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I069"
FT                   /protein_id="ABI41236.1"
FT                   /translation="MKTLTKIIGGLVLLLSMATAAMATPVDTYEFKSPENQKRGLSLAH
FT                   ELRCPQCQNQNLIDSNSPVARDLRLEVYKMVDEGKGDDEIIEFMTSRYGEFVLYKPKME
FT                   TKTYILWLGPVGLLLLGLIIGFIFIRKQRIGGTTEPEISAEDQKALDALLKRDNK"
FT   sig_peptide     247523..247594
FT                   /locus_tag="Shewmr7_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            247999..248580
FT                   /locus_tag="Shewmr7_0232"
FT   CDS_pept        247999..248580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0232"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: son:SO0269
FT                   thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41237"
FT                   /db_xref="GOA:Q0I068"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I068"
FT                   /protein_id="ABI41237.1"
FT                   /translation="MKSFALAAILASLSVAFAGGAQAYPGMQQANKPIESTVDLINVLP
FT                   KTYPIEPVAFSDVDGKPLDFSQYKGKIVMVNMWATWCPPCVRELPAIERLATKFKAEEF
FT                   ALLPISIDADGKQQVQPFLTSLGMANFNSYYDPEQNLGQVFPLDTIPATFILDQNGQLI
FT                   AFVRSFVDWDDAKAVSLIQGFIDKGAKKLN"
FT   sig_peptide     247999..248070
FT                   /locus_tag="Shewmr7_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            249066..250600
FT                   /locus_tag="Shewmr7_R0016"
FT   rRNA            249066..250600
FT                   /locus_tag="Shewmr7_R0016"
FT                   /product="16S ribosomal RNA"
FT   gene            250913..253805
FT                   /locus_tag="Shewmr7_R0017"
FT   rRNA            250913..253805
FT                   /locus_tag="Shewmr7_R0017"
FT                   /product="23S ribosomal RNA"
FT   gene            254027..254142
FT                   /locus_tag="Shewmr7_R0018"
FT   rRNA            254027..254142
FT                   /locus_tag="Shewmr7_R0018"
FT                   /product="5S ribosomal RNA"
FT   gene            254400..255677
FT                   /locus_tag="Shewmr7_0233"
FT   CDS_pept        254400..255677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0233"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="TIGRFAM: competence/damage-inducible protein CinA;
FT                   PFAM: molybdopterin binding domain; CinA domain protein;
FT                   KEGG: son:SO0272 competence/damage-inducible protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41238"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I067"
FT                   /protein_id="ABI41238.1"
FT                   /translation="MMKLEMICTGEEVLSGQIVDTNAAWFASTMMEHGIEIQRRVTVGD
FT                   RLEDLIAVFQERSLHADVILVNGGLGPTSDDMSAEAMAKAKGESLVENREWRQHLEDWF
FT                   TRNNREMPVSNLKQAMLPESAVMVDNPVGTACGFRVKLNRAWLFFTPGVPFELKHMVKE
FT                   QFIPFIREEFDLDAKVALKKLLTIGHGESSLADKIEPLELPEGITIGYRSSMPHIEIKI
FT                   FARGEKAIALLPRVTGHIKMVLGTAVVAEDKATLAEEIHAKLLNSGLTLSVAESCTGGM
FT                   ITSQLVDFPGSSSYLQHGLVTYSNESKVRVLGVNPATLDDHGAVSIPTVEEMAKGARAI
FT                   LDSDFALATSGIAGPDGGTEEKPVGTVAIALATRSGVYSQMIKLPRRSRDLVRSLSAAV
FT                   AYDMLRRELLTEAVIVDYQSIGRFSK"
FT   gene            complement(255776..256321)
FT                   /locus_tag="Shewmr7_0234"
FT   CDS_pept        complement(255776..256321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0234"
FT                   /product="protein of unknown function DUF1439"
FT                   /note="PFAM: protein of unknown function DUF1439; KEGG:
FT                   son:SO0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41239"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I066"
FT                   /protein_id="ABI41239.1"
FT                   /translation="MKKLTLSLCLGLSVLLGGCVTQYSISEHEMEQYLSKEIHFEVKQG
FT                   NQLVGAQVRINDISVRLGEKPDTMSVSAATQVSITNPIFPLKAQLSTTFEAKPWYDSAT
FT                   HSVYLRQLELVKVESTPKDIEKAISSAMPQVMGYLRHFLENQPVYVLDTKDSNQALMAK
FT                   MTESIQVVPGKLVLKFTK"
FT   sig_peptide     complement(256247..256321)
FT                   /locus_tag="Shewmr7_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.360 at
FT                   residue 25"
FT   gene            complement(256321..258990)
FT                   /locus_tag="Shewmr7_0235"
FT   CDS_pept        complement(256321..258990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0235"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   son:SO0274 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41240"
FT                   /db_xref="GOA:Q0I065"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I065"
FT                   /protein_id="ABI41240.1"
FT                   /translation="MAGNVADNVTDMYASLRSNVSMLGQILGDTMRTHLGDSFLEKVEQ
FT                   IRKLAKDSRRGDEAAREQMLELLTALPDEELVPFAKAFNQFLNLANLSEQFHTISRNCD
FT                   ELVCVPDPVEQLLGRMLNGRIDQTKMLDCLKTLDIDLVLTAHPTEISRRTLIQKYAAIV
FT                   DCLAEQENNQLSDRERRQINLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLW
FT                   HAVPDFLRQLNDQVQDRTGQQLPIDIAPVRFSSWMGGDRDGNPFVTAKVTQEVLDRNRH
FT                   AAARLFLKDIVLLVGELSMEEANSELMAFTNNSCEPYRFVLRSLRQKLRDTIDYLNARI
FT                   EGHNPEVDKSTLIWQESDLKAPLEMLYKSLCDCGMRLIANGLLLDILRRLACFGIHMLR
FT                   LDIRQDAGRHCDVLAELTRYLGMGDFNHWDETEKQAFLLRELSNRRPLIPSNWQPSADV
FT                   AEVLNTCRLIAKHPAKALGSYVISMASKPSDVLTVLLLLKETGCTHPMRVVPLFETLSD
FT                   LNNAAECITALLDIDWYRGYTKGMQEVMIGYSDSAKDAGVMAAAWAQYRAQEQLVAVCQ
FT                   QAGVKLTLFHGRGGSIGRGGGPAHKAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAV
FT                   QSLALYTSAVLEATLLPPPEPKQEWRNCVERIAEESVSAYRGIVREEPDFVPYFRAATP
FT                   EVELGKLPLGSRPAKRRVDGGIESLRAIPWIFAWSQNRLMLPAWLGAGEALQAACQRGE
FT                   IGLLQDMEREWPFFSTRISMLEMVYAKAEPNLARYYETCLVPPNLHHLGETLRQRLDLG
FT                   IKVVLELTKSDTLMAHTPWNRESVKLRNPYIDPLNFLQTELLARTRKETTEAPASEHVQ
FT                   LALMLTIAGVAAGMRNTG"
FT   gene            259656..260636
FT                   /locus_tag="Shewmr7_0236"
FT   CDS_pept        259656..260636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0236"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: son:SO0275 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   Semialdehyde dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41241"
FT                   /db_xref="GOA:Q0I064"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I064"
FT                   /protein_id="ABI41241.1"
FT                   /translation="MKNIAIIGASGYTGAQLTALVHAESELSIQGLYVSENSLDKGRAL
FT                   ADLYPVYSHIDLALSPLTEEAKAKIVAEADAVVLATEHSVSLHLAAWFYNQGLAVFDLS
FT                   GAYRFSDVAQYPKWYGFEHEYPEVLAKAVYGLAEWNAKEVAATKMIAVPGCYPTASLTA
FT                   LKPLKNLLTSAYPVINAVSGVTGAGRKAQLHTSFCEVSLTPYGVLGHRHQPEIATQLGQ
FT                   EVIFTPHLGNFKRGILATITVQLKPGTTTADVAAAYSVYDQAPLVTVKQNQFPKVDDVV
FT                   LTPNCHLGWKFDENSGYLVVASAIDNLMKGAASQALQCIKIHFNL"
FT   sig_peptide     259656..259727
FT                   /locus_tag="Shewmr7_0236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.719 at
FT                   residue 24"
FT   gene            260668..261450
FT                   /locus_tag="Shewmr7_0237"
FT   CDS_pept        260668..261450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0237"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: son:SO0276
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41242"
FT                   /db_xref="GOA:Q0I063"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I063"
FT                   /protein_id="ABI41242.1"
FT                   /translation="MSTNNSVLVLKVGGALLQCEMGMARLMDTAAAMIANGQQVLMVHG
FT                   GGCLVDEQLAANGMETVKLEGLRVTPPEQMPIIAGALAGTSNKILQGAATKAGIVSVGM
FT                   SLADGNTVSAKIKDERLGLVGEVSPKDATYLKFILSQGWMPICSSIAMMDDGQMLNVNA
FT                   DQAATVLAKLVGGKLVLLSDVSGVLDGKGQLIPSLTGQQIAELVKQGVIEKGMKVKVEA
FT                   ALEVAQWMGQAVQVASWRDASQLVALAKGEAVGTQIQP"
FT   gene            261463..262368
FT                   /locus_tag="Shewmr7_0238"
FT   CDS_pept        261463..262368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0238"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: son:SO0277 ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41243"
FT                   /db_xref="GOA:Q0I062"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I062"
FT                   /protein_id="ABI41243.1"
FT                   /translation="MKHLLSIKELTQQQLLDLITLAKTIKANPAEYRHALDGKSVVMLF
FT                   EKPSLRTRVSFDIGINKLGGHCLYLDQQNGALGKRESVADFASNLSCWADAIVARTFSH
FT                   KTIEQLAEFGTVPVINALSDLYHPCQALADFLTLAEHFENISDVKLAYVGDGNNVTNSL
FT                   MYCAAILGATMTVICPAGHFPDGYVVAEVQELASRYGGKVVLTSDIGAIEGHDAIYTDT
FT                   WISMGDPTPLAEIKDKFAPYQVNKGLMTKAGAHFFMHCLPAHRGVEVTDEVMDGEGSLI
FT                   LQQAENRMHAQNAVLVTLFS"
FT   gene            262429..263652
FT                   /locus_tag="Shewmr7_0239"
FT   CDS_pept        262429..263652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0239"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: son:SO0278 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41244"
FT                   /db_xref="GOA:Q0I061"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I061"
FT                   /protein_id="ABI41244.1"
FT                   /translation="MSIENKNTGVKKVVLAYSGGLDTSAIIPWLKETYDNCEIIAFCAD
FT                   VGQGEEELVGLTEKALASGASECHIVDLKEEFVKDYIYPTMATGAIYEGTYLLGTSMAR
FT                   PIIAKAQVEVARKVGADALCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWTMQSRE
FT                   DLLAYLAERNIKTSASATKIYSRDANAFHISHEGGELEDPWNEPSKGVWTLTADPEDAP
FT                   NQAEYVSLEVEHGRVTKVNGEALTPYAALMKLNAIAAPHGVGRIDITENRLVGMKSRGC
FT                   YETPGGTVMFAALRAIEELVLDKTSRTWREQVGAQMAHLVYDGRWFTPLCKSLLAASES
FT                   LAESVNGEVVVKLYKGHAIAVKKRSPNSLYSEAFATFGEDQVYDQKHAEGFIRLYSLAS
FT                   RIRALNAK"
FT   gene            263736..265103
FT                   /locus_tag="Shewmr7_0240"
FT   CDS_pept        263736..265103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0240"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: son:SO0279 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41245"
FT                   /db_xref="GOA:Q0I060"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I060"
FT                   /protein_id="ABI41245.1"
FT                   /translation="MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIA
FT                   SVGIITATECSDLKKALNELLVEVKGDPAIILASGAEDIHSFVESALIAKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCQSEGAALVARLQTLRSELIALAEREFDAVMPGYTHLQRAQPV
FT                   TFGHWCLAYVEMIERDLSRLTDALKRANTCPLGSGALAGTAYQMDRHSLAVALNFASPT
FT                   LNSLDSVSDRDHVVELCGAASISMMHLSRMAEDLIFFNSGEAGFISLSDEVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVYGSLVGILTTMKALPLAYNKDMQEDKEGLFDVVDSWAICLD
FT                   MAALVLSGLVVNRPNALLAAQQGYANATELADYLVSKGMPFREAHHVVGVAVVAAIAKK
FT                   IPLEAFSLAEFRTFADIIEADVYPNLTIEACLAKRDVLGGTALTQVKQAIAAKKVI"
FT   gene            complement(265165..267684)
FT                   /locus_tag="Shewmr7_0241"
FT   CDS_pept        complement(265165..267684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0241"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase; KEGG: son:SO0280
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41246"
FT                   /db_xref="GOA:Q0I059"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I059"
FT                   /protein_id="ABI41246.1"
FT                   /translation="MKWLKRIVIALFSLALLGVGAIVAAYFYVLPDLPDVSTLKNVQLQ
FT                   TPLRIYSSDGKLISQFGEKRRIPLKLEEVPKPLLQAFLATEDARFYEHGGIDPVGVIRA
FT                   AIVMLTTGEKKQGASTITMQVARNFFLTRDKTIIRKVKEIFISYHIEQLLTKDEILELY
FT                   VNRIYLGQRAYGVGAAAQVYFGKNVQDLTLSEMSMIAGLPKAPSTLNPITSPSRALARR
FT                   NVVLMRMNEVGYISKAEYQAAMQEPLVAKYHGAEIDLYAPYISEMARDYMVQKYGEEEA
FT                   YTNGYNVYTTISSEQQLLAQQALRNNVYAYDERHGYRGPAAVLWTDTKPDDAQIKAELA
FT                   KITPVQELQPAAVLSIDGQQASVLTAKGETKVIKWDGLKWARKFITDKRQGSVPKSASD
FT                   MLKVGERIWIRDNGQYLQLSQVPEVASATVALDPTNGAIRTLVGGYSFSQSQYNRVTQA
FT                   KRQLGSNIKPFIYAAALEKGFTLATLINNAPINKPDISQGTAWRPKNSPDIYGGPTRLR
FT                   VGLAQSINVMSVRAMRHIGLDAAIAELTKFGFDPNDLPRNESLALGSPSVTPLQVATAF
FT                   NVFANGGFLVEPYYIERVEDSFGNVIEKANPTLACKPNNSSVQPSSDPMSFGEPTTPTD
FT                   EPVAHCFEQTGRYAPQIISEQTAFLITEALKSVIWGGGDWSKGTGWQGTAWRAAQLIKR
FT                   HDIAGKTGTTNESRDTWFSGFGPTLTSTFWVGFDDHGRQLGRTAWNSNGEKDQITGTEA
FT                   GAKTAGPGWNEFMNNVLKGVPETTAIPPEGIVSVRIDLATGKLTRKTDYTSAFEYFISG
FT                   TEPKEYISESQDENNLFIDAPTDDLFQ"
FT   sig_peptide     complement(267610..267684)
FT                   /locus_tag="Shewmr7_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.782 at
FT                   residue 25"
FT   gene            267876..268955
FT                   /locus_tag="Shewmr7_0242"
FT   CDS_pept        267876..268955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0242"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   son:SO0281 type IV pilus biogenesis protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41247"
FT                   /db_xref="GOA:Q0I058"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I058"
FT                   /protein_id="ABI41247.1"
FT                   /translation="MLSNLWKRQAPQMVGIDIGSHEVKAILLSKTADGYKILSHAAVPV
FT                   KKGAINDHDIRDADAVVECLKQVKRILPKSVKYAAVAVSGSAVMTKVIYMDASLSEEEM
FT                   EAQIEIEADNLIPYSLDEVSIDFETLNVNSTDPSKVDVLLSACRTDNIDARVDALDEVE
FT                   LETKVVDVEGYALGRAVELVLGQLPEGARQKAVAMVDIGANMTTFSVVESGETTFIREQ
FT                   AFGGELFTQSILSFYGMSYEQAEKAKIEGDLPRNYMFEVLSPFQTQLLQQIKRTLQIYC
FT                   TSSGKDKVDYLVLCGGTSKLEGMANLLTNELGVHTIIADPFQGCLHADESVKNILQPSI
FT                   SKYMVACGLALRSYGQWRT"
FT   gene            268943..269527
FT                   /locus_tag="Shewmr7_0243"
FT   CDS_pept        268943..269527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0243"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   son:SO0282 type IV pilus biogenesis protein PilN"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41248"
FT                   /db_xref="GOA:Q0I057"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I057"
FT                   /protein_id="ABI41248.1"
FT                   /translation="MANINLLPWREEAREKQKRDYIGILAAVFLGSAILVYVALSLLDM
FT                   MTDEQRGRNAYLQSEIQLLDAQIAEIKKITERKKDIERRTEIILNLQQSRNLPTHVLDE
FT                   LVRIVPPGIYLSSLEKKGSLLLIEGRSESNNNVANMMRKVKASEWLTDPNMQSIVTQDD
FT                   ELRQLQRFSLRVSIKGAMADEPIKTAKGASK"
FT   gene            269524..270150
FT                   /locus_tag="Shewmr7_0244"
FT   CDS_pept        269524..270150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0244"
FT                   /product="Pilus assembly protein, PilO"
FT                   /note="PFAM: Pilus assembly protein, PilO; KEGG: son:SO0283
FT                   type IV pilus biogenesis protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41249"
FT                   /db_xref="GOA:Q0I056"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I056"
FT                   /protein_id="ABI41249.1"
FT                   /translation="MKLDLSQFNDIDFENIGGWPNQVKVFFAVLLALCVFAAGYFLVVS
FT                   DAIDVYNAEQRKEEQLREDFKTKYQLAANLKLYREQLAVMEEQFAELLKMLPSENEMPG
FT                   LLDDLTFVATDAGLRIKSLNWEPEIQRDFYIEFPIKMSVTGDYHQIGNMVSGVAKLPRI
FT                   VSLHDFTIKRDESGNLAMDILAKTYRFKEGAELPPEKPANNKGKK"
FT   gene            270150..270665
FT                   /locus_tag="Shewmr7_0245"
FT   CDS_pept        270150..270665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0245"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /note="PFAM: Pilus assembly protein, PilQ; KEGG: son:SO0284
FT                   type IV pilus biogenesis protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41250"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I055"
FT                   /protein_id="ABI41250.1"
FT                   /translation="MKLLPLLALSLFLMGCVGDRSDLELFVTTTKAQHVAHIPPLKEPP
FT                   KFEHFAYQAELMRSPFVPPSRELTEEVVDTSKNCLQPDLKRRKGRLETYALDNLKMRGT
FT                   LSEGNVIWALIETNDGSVYRMGVGEYLGLFNGHIAKVTSQNVEVVELIPDGSGCWAERT
FT                   NNIELSGK"
FT   sig_peptide     270150..270215
FT                   /locus_tag="Shewmr7_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.676) with cleavage site probability 0.377 at
FT                   residue 22"
FT   gene            270687..272741
FT                   /locus_tag="Shewmr7_0246"
FT   CDS_pept        270687..272741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0246"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB, short N-terminal domain protein; KEGG:
FT                   son:SO0285 type IV pilus biogenesis protein PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41251"
FT                   /db_xref="GOA:Q0I054"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I054"
FT                   /protein_id="ABI41251.1"
FT                   /translation="MKSSAAIKIPLSFLSSGLAKSVIGIALVFGFLPSSFAANRLMDVK
FT                   YHALVDHQLEVELVFEDAINAPQIDSNAAPAQLVLTFDDSISGLSKDRLPINQVGVKDI
FT                   VTTQQDANLMVTLGLSKVKPYQGSVVGNSYRLTINDEVAGSQAGNNPFVNSVKNIDFRR
FT                   NANGGGDLLVYLNNRSVAANVEQIGAKLEVQLYNTDINSDLLYVMDVQDFSTPVKHFET
FT                   FKDDLTTRILVDVSGNYEFNYKQEDNLFRLSINKVERAAATKEVKKYNGKTLSLNFQNI
FT                   SVRTVLQIIADYNNFNLVTSDTVEGDITLRLDDVPWDQALDLILQTKGLDKRIEGNILM
FT                   VAPSEELAIRESQNLKNKQEVKELAPLYSEYLQINYAKATDIAELLKGADSSLLSPRGS
FT                   VAVDERTNTVLVKDTAEIIENIHRLVEVLDIPIRQVLIESRMVTVKDDVSEDLGIRWGV
FT                   TDQQGSKGTSGTLEGAGSIATGTVPSLDNRLNVNLPAAVTNPTSIAFHVAKLADGTILD
FT                   LELSALEQENKGEIIASPRITTSNQKAAYIEQGVEIPYVQSTSSGATSVTFKKAVLSLR
FT                   VTPQITPDNRVILDLEITQDSQGKTVDTPTGPAVAIDTQRIGTQVLVDNGETIVLGGIY
FT                   QQNLISRVSKVPILGDIPLVGFLFRNTTDKNERQELLIFVTPKIVNEKL"
FT   sig_peptide     270687..270800
FT                   /locus_tag="Shewmr7_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.988 at
FT                   residue 38"
FT   gene            272961..273476
FT                   /locus_tag="Shewmr7_0247"
FT   CDS_pept        272961..273476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0247"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: son:SO0286 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41252"
FT                   /db_xref="GOA:Q0I053"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I053"
FT                   /protein_id="ABI41252.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLEFHDSDQEIEQRTGA
FT                   DIAWVFDVEGEEGFRRREAQVIADLSEKQGIVLATGGGSVQSKDIRNHLSARGIVVYLE
FT                   TTIDKQVARTQRDKRRPLLQVDDPREVLENLAEIRNPLYEEIADVIVKTDDQSAKVVAN
FT                   QIIEKLGF"
FT   gene            273482..274561
FT                   /locus_tag="Shewmr7_0248"
FT   CDS_pept        273482..274561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0248"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase; KEGG: son:SO0287
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41253"
FT                   /db_xref="GOA:Q0I052"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I052"
FT                   /protein_id="ABI41253.1"
FT                   /translation="MTQQIQVDLGERSYPIYIGQSLMSDSETLSRYLLKKRILIVTNET
FT                   VAPLYLKQIQDTMASFGEVSSVILPDGEQFKDLTHLDSIFTALLQRNYGRDSVLVALGG
FT                   GVIGDMTGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPQIV
FT                   IIDTECLQTLPAREFAAGMAEVIKYGIMWDADFFQWLENNVQALKSLDTQALVYAISRC
FT                   CEIKADVVSQDETEQGVRALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGTVLAAQTAKS
FT                   MGLIDESIVRRIVQLFHAFDLPVTAPESMDFDSFIKHMRRDKKVLGGQIRLVLPTAIGR
FT                   ADVFSQVSESTLEQVICCA"
FT   gene            274601..275995
FT                   /locus_tag="Shewmr7_0249"
FT   CDS_pept        274601..275995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0249"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: son:SO0288
FT                   DamX domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41254"
FT                   /db_xref="GOA:Q0I051"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I051"
FT                   /protein_id="ABI41254.1"
FT                   /translation="MLPSQEALVERLHHVASYSDQLLVLVGAHGSGKTTLLTALATDFD
FT                   ESNAALVICPMHADNAEIRRKILVQLVSSPIFDDEISLAETILRVAPKQSKPLHIIIDD
FT                   AHLLSKELWAECIILNQVQCAGQRIAVTLAVPPAFLAELLPQLPEPLRRQILPVSVEPL
FT                   SLPEREALYQTLLRYSDQNPFTPRDIVRAQLEKQTGTPQEVVALLELALHGQSEKKSFW
FT                   VQYRIALIGFASVLITLVIWLGLANPFSDEPIPEVVTYPAVDSAEFLAHGKQILAPYFK
FT                   LRAESLTQALLAEAVEQADPLAKFHGEEPQAEGETGIEPPVDEATSKGDSSAIEVDEAE
FT                   PAPVPTEQAKDNNTTQVVHATPEPASPVSVRPKTGYAIQIATVSQRETVHSLLKKLHNV
FT                   PEVRVAKYKQFWVVLVGQFKDSQSAQQAAAELVKEYHLSQPLIKKWAELGGYELQETRS
FT                   SDEISE"
FT   gene            276044..276883
FT                   /locus_tag="Shewmr7_0250"
FT   CDS_pept        276044..276883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0250"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: son:SO0289 DNA adenine methylase; TIGRFAM: DNA
FT                   adenine methylase; PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41255"
FT                   /db_xref="GOA:Q0I050"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I050"
FT                   /protein_id="ABI41255.1"
FT                   /translation="MIKKHRAFLKWAGGKFKLVDELSNYLPTGERLVEPFVGAGSVFLN
FT                   TDYPSYLLCDINQDLINLYNIVKERPVEYITAAKKLFVDEMNQKDAYYRVRTDFNKSRD
FT                   PFLRSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEKEILAFSKKAQRAEFKC
FT                   IGYEKAFEQIRTGDVIYCDPPYAPLSTTASFTTYVGAGFSLDDQALLARYSRHMALEQR
FT                   IPVVISNHDIPLTRELYRGAHLAKIQVQRNISQNGSGRNKVDELIALYDENYDPQDD"
FT   gene            complement(276908..277093)
FT                   /locus_tag="Shewmr7_0251"
FT   CDS_pept        complement(276908..277093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41256"
FT                   /db_xref="GOA:Q0I049"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I049"
FT                   /protein_id="ABI41256.1"
FT                   /translation="MLSRIWQVFHSTIAAFFGVQSDRNRQKDFQTNSPLPYILMGIVLA
FT                   IALVASLILLVSQVVG"
FT   gene            complement(277093..277458)
FT                   /locus_tag="Shewmr7_0252"
FT   CDS_pept        complement(277093..277458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41257"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I048"
FT                   /protein_id="ABI41257.1"
FT                   /translation="MKGRLTQFSHILGSVTFKSSMMLAFTAVVVASLAFGVEKLTASND
FT                   TSACACSSDTRYNNSLPSSHPNNRCAEQAQTLSWKTWLTGKNRSSQFHFVDLLELLHGH
FT                   QDKPIDDLKPANSQQSY"
FT   sig_peptide     complement(277348..277458)
FT                   /locus_tag="Shewmr7_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.907 at
FT                   residue 37"
FT   gene            277721..278398
FT                   /locus_tag="Shewmr7_0253"
FT   CDS_pept        277721..278398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0253"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="KEGG: son:SO0292 ribulose-phosphate 3-epimerase;
FT                   TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase; Orotidine 5'-phosphate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41258"
FT                   /db_xref="GOA:Q0I047"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I047"
FT                   /protein_id="ABI41258.1"
FT                   /translation="MRPFLIAPSILSADFARLGDDVKAVLDAGADVVHFDVMDNHYVPN
FT                   LTIGPMVCKALRDYGITADIDVHLMVKPVDRIVPDFAKAGASIITFHPEASEHIDRTLQ
FT                   LIKESGCKAGLVFNPATPLHYLDHVMDKLDVILLMSVNPGFGGQSFIPSTLDKLRQVRE
FT                   RIDASGFDIRLEVDGGVKVDNIAEIAAAGADMFVAGSAIFGKPDYKAVVDEMRAELAKV
FT                   EVK"
FT   gene            278398..279081
FT                   /locus_tag="Shewmr7_0254"
FT   CDS_pept        278398..279081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0254"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: son:SO0293 phosphoglycolate phosphatase;
FT                   TIGRFAM: phosphoglycolate phosphatase ; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41259"
FT                   /db_xref="GOA:Q0I046"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I046"
FT                   /protein_id="ABI41259.1"
FT                   /translation="MREQIKAIAFDLDGTLIDSVPDLAVATQAALAELGLATCTEAQVR
FT                   TWVGNGAEMLMRRAMSHALGTDVEQTALDAAMPIFMHHYQENLEKHSALYADVHQVLQI
FT                   LFDAGFKLAVVTNKPYRFTLPLLEAFKINDFFSLVLGGDSLAKMKPDPLPLEHLLAEWQ
FT                   LDKTELLMVGDSKNDILAAKAAGVASIGLTYGYNYGEDIGLTGPDAVCEQFAEILRWLN
FT                   LAQPV"
FT   gene            279118..280116
FT                   /locus_tag="Shewmr7_0255"
FT   CDS_pept        279118..280116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0255"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: son:SO0294 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41260"
FT                   /db_xref="GOA:Q0I045"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I045"
FT                   /protein_id="ABI41260.1"
FT                   /translation="MTKPIVLSGAQPSGELTIGNYMGALRQWVAMQDSHDCLYCVVDLH
FT                   AITVRQDPQALREACLDTLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGEL
FT                   SRMTQFKDKSQKHANNINVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATR
FT                   FNNAYGETFTIPEPFIPEHGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAVMKKLKK
FT                   AMTDSDEPPVVRFDMENKPGVSNLLSLMSGITGQSIASLEAEFEGKMYGHLKGAAGEAV
FT                   VGMLEPLQERYRALRADRAYLDQVMKAGAENAQARAEVTLKKVYEKIGLLV"
FT   gene            complement(280219..281091)
FT                   /locus_tag="Shewmr7_0256"
FT   CDS_pept        complement(280219..281091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0256"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0295 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41261"
FT                   /db_xref="GOA:Q0I044"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I044"
FT                   /protein_id="ABI41261.1"
FT                   /translation="MRKLPPLRALQVFETAARQQHFSKAAAELCITQSAVSHQVRVLEE
FT                   YFGEQLFDRQGRKLQLTPKGQSLFIELERIFNELSDLNLKIRDTPNQQLCLAVYSSFAV
FT                   KWLIPRLADFRRQYPSVKIRLEMITQDPDLSTSTADIFIAGKLNQRGYWQQLLHKERLI
FT                   PVCSPSFYPKWRDINLSNFQQQALLIVDEGPLGLDWHKWSSAHQIPLNNEQQHIFSHIV
FT                   MAIEAAIAGQGLALAPDFMVAGDISTGRLVAVNLPDVHTGFEFSFICKQRRLTEPAIAA
FT                   FSSWLKSQA"
FT   gene            281212..282132
FT                   /locus_tag="Shewmr7_0257"
FT   CDS_pept        281212..282132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0257"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: son:SO0296 integral membrane domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41262"
FT                   /db_xref="GOA:Q0I043"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I043"
FT                   /protein_id="ABI41262.1"
FT                   /translation="MQRPVVIGLILLIVGNLFSAFYDVSIKWLPEDANAATFLLVRQIT
FT                   SVLMLIPIWLYSQRPKTEHISVHLWRANIGSVGALFLIIGLMALPLATVSSLFYSAPLM
FT                   IILMGYWFLKERITTGQVVCTLLGFVGILIILRPSEMNWFGLAVLFSAFTFAVNQLTLK
FT                   KVPNTEHPVLTLMLYNLLGIPATLIIAAFQGLEGLSWGLLAVALLSNAFLLIYHWFCVL
FT                   AYRRAQASDIAIAEYTGLLFIVFLGWLLFDEWLDSLSWLGAALIVLPSLFLPWIGMWMA
FT                   KSPKVMDNIQVKALGLEAVEGEPKP"
FT   gene            complement(282151..282717)
FT                   /locus_tag="Shewmr7_0258"
FT   CDS_pept        complement(282151..282717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0258"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; KEGG: son:SO0297
FT                   lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41263"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I042"
FT                   /protein_id="ABI41263.1"
FT                   /translation="MRYAAPLLMVCMLLQGCAGAVMVGAVSGAMMANDERSVKTQLDDT
FT                   NTDFKITSALLEHEDLKKQTNITGVSVNGNVLMIGQAPNSMLRDKAIKVVQDLKLGGKI
FT                   HNQIRIGNPTSFTTRSNDTWVTTKVKGRMLNEKELDVTRIKVITENGEVFLLGLIHRSQ
FT                   ADMAVDIARNTAGVRKVVKVFEYIE"
FT   sig_peptide     complement(282640..282717)
FT                   /locus_tag="Shewmr7_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.309 at
FT                   residue 26"
FT   gene            complement(282714..283307)
FT                   /locus_tag="Shewmr7_0259"
FT   CDS_pept        complement(282714..283307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0259"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG: son:SO0298
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41264"
FT                   /db_xref="GOA:Q0I041"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I041"
FT                   /protein_id="ABI41264.1"
FT                   /translation="MLERIKDSFTESIQTKIDAAEALPESIAKAAEMMVQCLLGGNKIL
FT                   ACGNGGSAGDAQHFSAELLNRYEIERPPLPAIALSTDTSTITAIANDYSYDEIFSKQIL
FT                   ALGQPGDILLAISTSGNSGNVIKAMEAALSRDMTIVALTGKDGGAMAGLLSVGDVEIRV
FT                   PSNVTARIQEVHLLVIHCLCDNIDRTLFPQDEQQ"
FT   gene            complement(283414..283740)
FT                   /locus_tag="Shewmr7_0260"
FT   CDS_pept        complement(283414..283740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0260"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   son:SO0299 predicted endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41265"
FT                   /db_xref="GOA:Q0I040"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I040"
FT                   /protein_id="ABI41265.1"
FT                   /translation="MTLGQQAESLAQGYLEQQGLTFVERNVRYPFGEIDLVMRHKKHWV
FT                   FVEVKYRSANQFGGAIQALSKAQIGRIRMAASHYLQTHKLDVPCRFDVVAIEDAQIHWL
FT                   VDAF"
FT   gene            complement(283737..285623)
FT                   /locus_tag="Shewmr7_0261"
FT   CDS_pept        complement(283737..285623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0261"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG: son:SO0300
FT                   lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41266"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I039"
FT                   /protein_id="ABI41266.1"
FT                   /translation="MLKSLNTTKFVSVAILSAVLAGCGSQAPSSTGTAPTVATSLASAP
FT                   LAPNVYLAQAANSKDPQQRDTNLLLAAHAYINANDYAAAQKLLKSMQPSLTQTPTLVAE
FT                   HKYLTARVLEHTSTYVEALKTLSYPSTWVLPGWQMAAYHQFRAHLFQLNKQPIEQVREL
FT                   SLLTTYLPPAEASEVNNQIWQVLQPMHEQTLQTFIRDANNPVFAGWLQLAYIAKHYAVD
FT                   PNQLVRYLGDWQKQNPYHPAAAKLPTDLDRALNAKPFMPKNIAVLLPLTGQRAGAANAI
FT                   RQGILASYLAKPNEQVAVNFYDTANDAVAAYQQAVNAGAEFIIGPLLPNEIDQLLALNN
FT                   STSPATSTPSGSAPTAPAAPTAPIPQLFLNQTDKFVPDINKFYFALSPAQEAADAATRM
FT                   YQDGVTMPLLLASNDATGKRMAESFIQAWKKKSDTPIEVYYYDGGDKMKTTVQDALGVR
FT                   DSQARIARIKELLGSSVQADFRSRQDIDAIYMISTPQDLTLLKAFIDVNFSVFTQPVPL
FT                   YTSSRSRIDNESSQTAQDLNNLTMSDAPWLMQNSEENLMVNTLWSGWNNGQKRLFVMGY
FT                   DAMDLISKLAQMRSFTGYQFNGRSGVLSVNPDGVINRQLSWGRYQRGSFRQL"
FT   sig_peptide     complement(285528..285623)
FT                   /locus_tag="Shewmr7_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.350 at
FT                   residue 32"
FT   gene            285712..286557
FT                   /locus_tag="Shewmr7_0262"
FT   CDS_pept        285712..286557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0262"
FT                   /product="Protein of unknown function UPF0011"
FT                   /note="TIGRFAM: Protein of unknown function UPF0011; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: son:SO0301 hypothetical
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41267"
FT                   /db_xref="GOA:Q0I038"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I038"
FT                   /protein_id="ABI41267.1"
FT                   /translation="MDQSVALYIVPTPIGNLGDMSPRAIEVLTQVALIACEDTRHSGKL
FT                   LSHFGISTKTIALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQ
FT                   SGFRVVPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLELKEDPRTLIFYE
FT                   SPHRIEHSLTTMAQVLGGERQVVMAREVTKTFETFLSGPVAEVLATVSSDPNQQKGEIV
FT                   LMVHGHRAADDDEAIPTVAINTLKLLCEELPLKKAAAIAAQIHGLKKNALYKFGLESDL
FT                   "
FT   gene            286671..286970
FT                   /gene="rnpB"
FT                   /locus_tag="Shewmr7_R0019"
FT   misc_RNA        286671..286970
FT                   /gene="rnpB"
FT                   /locus_tag="Shewmr7_R0019"
FT                   /product="RNA component of RNaseP"
FT   gene            complement(287058..287507)
FT                   /locus_tag="Shewmr7_0263"
FT   CDS_pept        complement(287058..287507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO1432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41268"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I037"
FT                   /protein_id="ABI41268.1"
FT                   /translation="MSVIHSIAHQWDKAEFAHQLQQYIASNRDAMRLFIGATGSQTVCH
FT                   LIAAMGELPQKSEEGNFNISLPLLLDVLLQRFLLLYVKELQHQSLTQAEQLIVSLTELI
FT                   AQQAKQDDEQDAEVLSKSHIILSAMEKLAKQRTQLRRQRSTMGRS"
FT   gene            complement(287538..288203)
FT                   /locus_tag="Shewmr7_0264"
FT   CDS_pept        complement(287538..288203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0264"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: son:SO1431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41269"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR026269"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I036"
FT                   /protein_id="ABI41269.1"
FT                   /translation="MSKIKADDYLTWGAIAKVLHNILYTYPEAPLIDNFKQEELHMSWP
FT                   QLVDSEYEKQGRTYLKRYLTNWESTEAQLIELKVDYGQLFFGPSDPKAAPWGSVYTGEE
FT                   QSLNGDSTQKLMAFYKAHNIEFTLERNEPIDHIGLILLTLEYLFNQLAATPEDKNTLGT
FT                   CTLLLQQHLLPWADRCLELAEQHADSEFYKGIAILSRVYLAHVSQQLGIITQQTKLFR"
FT   gene            complement(288266..288925)
FT                   /locus_tag="Shewmr7_0265"
FT   CDS_pept        complement(288266..288925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0265"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: son:SO1430 anaerobic dimethyl sulfoxide
FT                   reductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41270"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I035"
FT                   /protein_id="ABI41270.1"
FT                   /translation="MTQETQYGFYFDSSKCTGCKACHIACKDRMTGLIRANDGNGSVAN
FT                   LPGVLWRRVTEYGGGNWSQNADGSFEQNVFAYYTSIGCNHCSEPVCVKACPTGAMHKRK
FT                   DNGLVLVESSICIGCGSCARACPYDAPQLDTQRKVMTKCDGCYDRLADGKKPICVNACP
FT                   LRALDFDTMENLKAKYGEGDGHIAPLPSSSITSPNLIVKKNPNAQSGGQVLNWSEI"
FT   gene            complement(288939..291455)
FT                   /locus_tag="Shewmr7_0266"
FT   CDS_pept        complement(288939..291455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0266"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   anaerobic dimethyl sulfoxide reductase, A subunit,
FT                   DmsA/YnfE family; PFAM: molybdopterin oxidoreductase;
FT                   molydopterin dinucleotide-binding region; molybdopterin
FT                   oxidoreductase Fe4S4 region; KEGG: son:SO1429 anaerobic
FT                   dimethyl sulfoxide reductase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41271"
FT                   /db_xref="GOA:Q0I034"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I034"
FT                   /protein_id="ABI41271.1"
FT                   /translation="MERRSFLKMSAALSAAAAVTGCDSSSSDVDVVPPTPPVTDGEIQT
FT                   WSSCLVNCGSNCPIKVFSKDGVITRVEADNETTDEYGYNHQIRACARGRSLRQRTYAAD
FT                   RLKTPMKRVGKRGEGKFVPITWDEAASTIASELQRITAEYTNRSILKLYGSGAYYGFSS
FT                   SNCFNRLLNLNGGFLNIYGNYSWAQQIEAAAATWGGSSTNGSSMVCVADSDLFLGIGYN
FT                   PSEMRQSGSGEGYDYLQAIQNNPSIEVIMVDPRYTDSMAGKEDHWYPIRPGTDAAFAEA
FT                   IAYEMISSGWVDANSKAFLDKYCVGYDKASLEKTKAEFEASGDATKLEYAKFIDVEENY
FT                   RDYILGVGKFTEAKTPAWAATVCGISEANIKAIAQKVMNAKAPYIIIGAGVNRHANGEQ
FT                   AMRACYMLPFLTGKVGQPGVNNGALPVQGSMSKSSLSGLSNPIKEAISFFTFSEAIERG
FT                   AEMTARKDGVRGMPDLDTPLGQNIKAIFAINSNSLVNQHADSNGTSKILEDDTKCELIV
FT                   VADCWMTPSARYADILLPDTSWLESNDLVDGSYATGLMGYLVAMKAAVKPMWECKSMYD
FT                   MCGLIAQKMGVYQQYSEGKDETAWLNQLYAGTLTAPSSANAIPALPSSYEEAQKIGVFR
FT                   SFNGTKRIALDSYINGGKALGTPTGKVEFYSLDFAQKAAEWEFDASVKGNYITALPKYQ
FT                   PTWEGYEDADTIDTYPLQLMGYHTKGRTHSSYHNVAWLREAVEDAVWMNPIDANARGLS
FT                   QGDTVHVWSQRGTIEIPVRITPRVAPGVAALGQGAWYTPDPSGRIGPSGHVIDIGGCIN
FT                   TLTRYQPSPAAKGNPQHTNRVQIAKA"
FT   sig_peptide     complement(291366..291455)
FT                   /locus_tag="Shewmr7_0266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.269 at
FT                   residue 30"
FT   gene            complement(291475..293478)
FT                   /locus_tag="Shewmr7_0267"
FT   CDS_pept        complement(291475..293478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0267"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: son:SO1428 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41272"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I033"
FT                   /protein_id="ABI41272.1"
FT                   /translation="MKFKLNLITIGLLAASASVNAADFSVKQANTSQVNTSAYQCKACT
FT                   VKQGYQGEVNANAGWANSDDIHSGNNFGDSDAGWRGSVGGDVSYRQGEYHAAMQADELG
FT                   SDNGYLHLEAAKNNLGGVQLDYSLLTRYDATTQTQLWHNNGLLRPDSHTRSLDLELQRE
FT                   KVGIGLEGELDALLNGLKGYINYDHEDKTGNRRSSLLANSGPINFALPVDATTQNINAG
FT                   ISIDQHQWQSELAYNGSYYRNHINHLSLPYADNVYAATPDNDAHQVSLTGQYLLGSSVI
FT                   NGRLATGRMIQDDNLIQISGNPLQSWDGEVETLDARIGFSSMLSPRWRLNGQLDYSDRD
FT                   NKSSTWDFAQFEVDNVSGAFKQNVAMDIQRTNFKLQSSYRFNSDYRLLGGFDYKAVERN
FT                   YTEREETEDSALWAKLNIRAIPKTVVDLKASYETRDGSTYDSLEATSIEENPLLRKFYL
FT                   ADRNRNGLELRVNHTPLQWLTLDFDAHYNNDDYDNTTIGLTEVKDYGYNVQLSAQLSGK
FT                   LNVFASAGQQWIESDMAGSQAYAAPDWYTNVDDEFIDLNIGFTYDGLMDDRLSIGGNYQ
FT                   FANSASDTLITTTTDQPYGDYYSYSHNLELYGRYALNERMGLKLSYQYERYYDTDYAEV
FT                   STYAIPGLVTLGELNHNYNAHLLMLTFSYMLP"
FT   sig_peptide     complement(293413..293478)
FT                   /locus_tag="Shewmr7_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(293493..294437)
FT                   /locus_tag="Shewmr7_0268"
FT   CDS_pept        complement(293493..294437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0268"
FT                   /product="cytochrome C family protein"
FT                   /note="TIGRFAM: cytochrome C family protein; KEGG:
FT                   son:SO1427 decaheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41273"
FT                   /db_xref="GOA:Q0I032"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I032"
FT                   /protein_id="ABI41273.1"
FT                   /translation="MRWHKIKRWIIGASALLLLSPSVIAEKAQNSEQLEKLLEQKFTAG
FT                   QYSAKGADTCLMCHKKNNKVMAIFDGKHGDMSHSNSPMAGLQCESCHGPLGNHNKGGKE
FT                   PMITFGRDSKLSAPTQNTVCLGCHQNTAKAGWHNSLHNLEEIACASCHQVHAAKDPILD
FT                   KQQVNQTCTSCHTREKADMSKRSAHPLKWDQMTCIDCHAPHGSSNESALKKATVNDTCY
FT                   SCHAEKRGPFLWEHAPVTENCSTCHNPHGSVNEALVKQRVPQLCQQCHADDGHASRVVS
FT                   QPSTNAFGAGMGCLNCHSQIHGSNHPAGSNFAR"
FT   sig_peptide     complement(294360..294437)
FT                   /locus_tag="Shewmr7_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 26"
FT   gene            complement(294957..295451)
FT                   /locus_tag="Shewmr7_0269"
FT   CDS_pept        complement(294957..295451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41274"
FT                   /db_xref="GOA:Q0I031"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I031"
FT                   /protein_id="ABI41274.1"
FT                   /translation="MKSFAAGLNNFWVGLFTGIMLPLIIVAGLLYATVDKFTGLIEDAA
FT                   IAPLINRSEQTFDRVDNLLLTLDNKVDDANLKDVALLAPLKNAQLFPELQALASGVTNL
FT                   KQTVTDIDKQAVLANLQEKLQASLATKFPEEQAKELAQNLINIAQVLASQPSISTQSAA
FT                   Q"
FT   gene            complement(295596..297896)
FT                   /locus_tag="Shewmr7_0270"
FT   CDS_pept        complement(295596..297896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0270"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: pmu:PM1282 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41275"
FT                   /db_xref="GOA:Q0I030"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I030"
FT                   /protein_id="ABI41275.1"
FT                   /translation="MIQLHPSTLTFKRKDPHKMKYPQYLLLLGASTLSVAAEPIERINV
FT                   TGNPLEKPLSQKIQASKIELSGTELNKRKADTLGETLSQLPGIDSGFFGSAAGRPQIRG
FT                   FGGHRVQTLLNGIPVEDMSSISEEQFIPIEPFLADSINVIKGPTAVIAYGGQAMAGIVD
FT                   LQEGRIPLSPINGFNSRAEVKTGYNATSTALAKLSGGNESFNFNLNMINKDRGDYDIPG
FT                   HSKDSNCKQWSEVVGAAQFADQCQIQYGQPVWKRNELLNRYEDATPIEQQIITDRSIDN
FT                   DGTVLNSSHHTTSFSAGGSYTSQNRLLGLAYGYTDTDRGIPGFMRRGTSAPVDFNLRGN
FT                   IRILSQGNRVDMKYIEHWDNNWLESLTLDTAYSHQVDDEQMAGVSVNQFELTSWVISPK
FT                   LYHNWSPNFDGVVGLQYDARAYEGEGYDNYMPKVDSQSYAAYTLQTLHLGPVTFELGGR
FT                   YDAIKHQANTEGYHVGRGLGANVKDRNFYLQSYSGSMQWDILQNWSTRVNYVHAERAPE
FT                   MNELYASNPHYALLIEEQGNSNLNKEVNRSLELNTTAQIADLQLMASWYQNQFDDFIYL
FT                   GGTGINRGGTYVREWRQADTNNQGLEVQAVYTFPWQTWGIFELSAFTDRVKNTPRYQYD
FT                   GSYHIFNSRPPLPGEREEYFRRALEGSSMPRTPQSKTGAELNWQYNALMVSIDYVRYHS
FT                   QNDLAKFERPSESYSLLGANIMVDQVIASIPTQFYLSLDNLTDEDARPHNSFIRHLSPM
FT                   PGRSAAIGVRIQF"
FT   sig_peptide     complement(297786..297896)
FT                   /locus_tag="Shewmr7_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.792 at
FT                   residue 37"
FT   gene            298099..298569
FT                   /locus_tag="Shewmr7_0271"
FT   CDS_pept        298099..298569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0271"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: hch:HCH_01703
FT                   Fe2+/Zn2+ uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41276"
FT                   /db_xref="GOA:Q0I029"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I029"
FT                   /protein_id="ABI41276.1"
FT                   /translation="MTEKKTELLREVVQKCEEKGINLTSKRKMVLTVLQEHDSPLSAYE
FT                   IADVLKQSVGESLPIMSIYRMLDFLVQEQLAHKLLTVNKYIACHHICDHHIHSQFLICN
FT                   VCQKVTEIALPDALVAQLQQNVSEAQFTLSSPQLELAGWCHDCRQQLNIQHA"
FT   gene            complement(298618..300258)
FT                   /locus_tag="Shewmr7_0272"
FT   CDS_pept        complement(298618..300258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41277"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I028"
FT                   /protein_id="ABI41277.1"
FT                   /translation="MQKFTLYASILPCCLCGLVNLARADEALPKTPPKEAPKKVSKIVV
FT                   VSNPIFDESAPDAFFIHRWANYLHINTKEYVVRDKLTFGENDTVTQKDLDESQRLLRAE
FT                   PYIRDAKVYVSEKDPEADVHPDDESIVIETWDNWSLLPTTSFSSSGGDTRYSFGVKEDN
FT                   LFGTGIRTRLKYQSDESRTGYKFAFEAPISIIDHGIVAAEFYDNSDGQAKHVYVSKPFY
FT                   SLNTETMYSAEFLDDSRTDILRQNGHEVNEFEHTVDYLNLQYGWLINKNNEHLSRFITG
FT                   FTQDKHEFANSEVYPTSELPQDRDFMYPWVAYEFIQDDFQVLNNVHLIRNNEDFNLGWH
FT                   HYIQLGIETNDIGDNNPVGYHFKWQTTRGYKFDEHLWLLEMGATSTLGTTQKDTYQANV
FT                   QAEYFYQINPKWIAYGKAWASVSNNTYLDLTEGLGDETGVRGYPNEYQQGDNQWLLTAE
FT                   IRNYPNINLYQLAELGWAIFADVGQASGGPLAANNEVSGPLASIGIGARIYSSRSSYGN
FT                   VAHIDLSVPYTGGDSVNSWEWRFLVKRSF"
FT   sig_peptide     complement(300184..300258)
FT                   /locus_tag="Shewmr7_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            complement(300432..301652)
FT                   /locus_tag="Shewmr7_0273"
FT   CDS_pept        complement(300432..301652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0273"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   son:SO0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41278"
FT                   /db_xref="GOA:Q0I027"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I027"
FT                   /protein_id="ABI41278.1"
FT                   /translation="MDNEQFLEKRKFIIKLGKALHKFGTPAYRLETHLQTVSRTLGIEG
FT                   YFLISPTSMTFVLQHDTDQEYNHVARVKPGELDLGSLARTDELVDELTSGKRTLTEALD
FT                   RLEEIANKPNPYGPALTCFSFGTSAAAFAMLMGTGWNDVFWSGLLGLLVYGFVYRAERS
FT                   TRMAEVLEPFATIVCAIAACAIARIDPNINIPVVILSSIIIFIPGLALTLGLAELAARD
FT                   LISGTARIMDASMLLFKLYFGAVLGMAIGKAFFGEAIHIEPEGLPRWAIWSAVPILSMA
FT                   LVFIFKARMQDSPWGVLAGIVAFFSAMLGGHFFGDSVGIFFGALAVGVYSNLYARWMKA
FT                   PASIALLQGIVILVPGSKTYIGLNALISGETMLNQSHIGSQIFLIFMSLIAGLIFANVV
FT                   VPPRRTL"
FT   gene            301808..302206
FT                   /locus_tag="Shewmr7_0274"
FT   CDS_pept        301808..302206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41279"
FT                   /db_xref="GOA:Q0I026"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I026"
FT                   /protein_id="ABI41279.1"
FT                   /translation="MPLMVTGFYASLTGLLIIALAYRVVKLRRSQKIGIGDGGNNALAL
FT                   AGRVHANLIENAPIVLILMLVAEAGGLAHFYLHCFGTLWIVARLLHAIGLTQGKGGYHF
FT                   GRFWGVLLTWLVTISLALVNLVHFAQSL"
FT   gene            302419..304764
FT                   /locus_tag="Shewmr7_0275"
FT   CDS_pept        302419..304764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0275"
FT                   /product="Radical SAM N-terminal domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM
FT                   N-terminal domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: son:SO0311 hypothetical Fe-S
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41280"
FT                   /db_xref="GOA:Q0I025"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I025"
FT                   /protein_id="ABI41280.1"
FT                   /translation="MQVESTLFSHPKYWAESFGTAPFLPMSRKEMEKLGWDSCDIIIVT
FT                   GDAYVDHPSFGMAVIGRMLEAQGYRVGIISQPDWSSKDAFMQLGRPNLFFGVTAGNMDS
FT                   MINRYTADRRIRSDDAYTPGDVGGKRPDRAVTVYTQRCKEAFKDVPVIIGGIEASLRRI
FT                   AHYDYWSDKVRRSVIFDAKADILMYGNAERPLAEVARRLAAGEAIGDIQDVRGTAVIRK
FT                   EPMPEWRGMDSRKIDQLHKIDPIPNPYGADDVGCANLSGPSDVKIFDNDAPKPISVQPP
FT                   RPKPWDKTYVLLPAFEKVSEDKYLYAHASRILHQEQNPGCARALFQPHGDRGVWVNPPA
FT                   WPLNTDEMDAVFDLPYQRVPHPAYGKDKIPAYDMIKTSINIMRGCFGGCSFCSITEHEG
FT                   RIIQSRSQESIIKEIKDIQDKVPGFTGVISDLGGPTANMYRLGCTSEKAEKTCRRLSCV
FT                   YPSICGHLGTDHKHTIDLYRAARAVPGIKKILIASGVRYDLAIEDPAYVKELVQHHVGG
FT                   YLKIAPEHTEEGPLSKMMKPGMGAYDKFKELFDKYSKEAGKEQFLIPYFISAHPGTTDE
FT                   DMLNLALWLKERKFKLDQVQNFYPSPMANATTIYHTELNSLKNVKHTSEVVPVPKKGRQ
FT                   RRLHKALLRYHDPAGWPIIREGLIAMGREDLIGNSPNHLVPPEGRNERGQKWMKDANQG
FT                   QKALTRFSGNQFDERKGKGDAKGKPSASKPKGPKSGANATQGQQPKSNRPGAKAPFGQS
FT                   GFKGKSDQGKAGHQGRGNKASSGRQHAK"
FT   gene            complement(304968..306122)
FT                   /locus_tag="Shewmr7_0276"
FT   CDS_pept        complement(304968..306122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0276"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: son:SO0312
FT                   outer membrane porin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41281"
FT                   /db_xref="GOA:Q0I024"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I024"
FT                   /protein_id="ABI41281.1"
FT                   /translation="MKKTCIALMLPMLLAATSSQAVELYNDQKNSLDLSGWLGFAALND
FT                   SHDTSVIDDSSRVRFSFERSERNGWTAFATTEWGINMVSSDDSLVMQGGKLAAEKTEDF
FT                   LYNRLGYVGMSHDEWGSLSFGKQWGAYYDVAGTTDLPNVFAGYSVGAYAFSDGGLTGTG
FT                   RADSAFIYRNSFGPVQIALQYAAKTNGDVTLKNDDGSEMTNSELNFDSSYGASLTYSLT
FT                   DKFKLLAGFNRGDFEGHLGNTQVDETNEIVGIGAMYGDYYHYADNREASGLYVGFNAHQ
FT                   SKNNELVGGELYDATGAELMTAYQFDNGFVPMIVLSYLDLDTDASTPIQGKWTRQFAML
FT                   GLHYRYSNDTVMFAEMKLDFSDMDDPALEAQEDNGFAVGINYFF"
FT   sig_peptide     complement(306057..306122)
FT                   /locus_tag="Shewmr7_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(306247..307566)
FT                   /locus_tag="Shewmr7_0277"
FT   CDS_pept        complement(306247..307566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0277"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   son:SO0313 putrescine-ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41282"
FT                   /db_xref="GOA:Q0I023"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I023"
FT                   /protein_id="ABI41282.1"
FT                   /translation="MSKSANKIGVVQLTIITIVNMMGSGIIMLPTQLAQVGTISILSWL
FT                   VTAAGSTALAYAFAKCGMFSKKSGGMGGYAEYAFGRSGNFMANYTYAVSLLIANVAIAI
FT                   SAVGYAAVLLEVNLSPMAICLATIGVLWLATVANFGGARITGRVSSVTVWGIILPVIGV
FT                   SLIGWFWFDIDLYKGAWNPHELPFFKALGGSIAMTLWAFLGLESACANSETVDNPEKNV
FT                   PIAVMGGTLGAALIYIVSTNVIAGIVPNADLANSNAPFGLAFAQMFNPVVGKIVMACAI
FT                   ISCTGSLLGWQFTIAQVFKASADEGFFPKIFSKVSKADAPIWGMTIIVSIQTLLSLMTI
FT                   SPSLSKQFEALVNLAVVTNIVPYILSMAALGVMQKQLKVPANKARVANVIAVIGALYSF
FT                   YALYSSGETAVMLGAIATFFGWTIYGVISNKTPTAEIKAA"
FT   gene            complement(307652..309814)
FT                   /locus_tag="Shewmr7_0278"
FT   CDS_pept        complement(307652..309814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0278"
FT                   /product="ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG: son:SO0314
FT                   ornithine decarboxylase, inducible"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41283"
FT                   /db_xref="GOA:Q0I022"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="InterPro:IPR027568"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I022"
FT                   /protein_id="ABI41283.1"
FT                   /translation="MKSLKVAASLSVRSCFEIDREVVNVLTTDFCDVGAAVVSVDDVRN
FT                   GIVEKIKNTGLKLPIFVSVCCEETFPDDICSSITGVFELCGSNTDFYGKQVETAIQKYE
FT                   QALLPPFFGTLKKYVEMGNSTFACPGHQGGQFFRKHPVGRQFFDFFGETIFRSDMCNAD
FT                   VKLGDLLIHEGAPLDAQKYAAKVFNADKTYFVLNGTSSSNKVATNALLAKGDLVLFDRN
FT                   NHKSNHHGALIQAGATPIYLETARNPFGFIGGIDAHCFQESYLREQIRAVAPERADEQR
FT                   PFRLAIIQLGTYDGTIYNARQVVDRIGHLCDYILFDSAWVGYEQFIPMMNDCSPLLLEL
FT                   TPEDPGIIVTQSVHKQQAGFSQTSQIHKKDSHIKGQARYCNHKRFNNAFMMHASTSPFY
FT                   PLFAALDVNAKMHEGASGRYLWREAVKAGIEARKLLLKKCKYIKPFIPSMIEGRPWQDY
FT                   PTEQMADDLRFFEFEPGQKWHSFDGYEKGQYFVDPCKFLLTTPGIDAETGKYTEFGIPA
FT                   TILANFLRENNIIPEKCDLNSILFLMTPAEDMAKMQHLVSQISRFEKLVDEDAPLSEVL
FT                   PNVYNANKARYKDYTIRQLCQEMHNLYVSHDVKQLQKEMFRQAHFPTKVMDPQEANLEF
FT                   IRGKVELVPLSQIEGRIAAEGALPYPPGVLCVVPGEIWGGAVQRYFLALEEGINLLPGF
FT                   SPELQGVYLENTPDGKIQALGYVLNK"
FT   gene            complement(310126..310230)
FT                   /locus_tag="Shewmr7_0279"
FT   CDS_pept        complement(310126..310230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vch:VCA1065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41284"
FT                   /db_xref="InterPro:IPR021237"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I021"
FT                   /protein_id="ABI41284.1"
FT                   /translation="MKRKSKIMAHIRRTRHIMMPSQRDYFDHSYIFLR"
FT   gene            310715..311263
FT                   /locus_tag="Shewmr7_0280"
FT   CDS_pept        310715..311263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0280"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /note="TIGRFAM: YbhB and YbcL; PFAM: PEBP family protein;
FT                   KEGG: son:SO0316 hypothetical
FT                   phosphatidylethanolamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41285"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I020"
FT                   /protein_id="ABI41285.1"
FT                   /translation="MMHLHKWIVGIGLFTAVFSSAQAMTLSSKDIGEGQQLSNQFVFNG
FT                   FGCNGENLSPELTWRDAPNGTKAYAVTAYDPDAPTGSGWWHWAVYNIGGDQQQLTQGAG
FT                   SKANALPQGAIALKNDYGTTNFGGACPPQGHGMHRYVFTVWALPTPLELPKDASPALLG
FT                   FMLRSQALGSAKLTAVYQR"
FT   sig_peptide     310715..310786
FT                   /locus_tag="Shewmr7_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.972 at
FT                   residue 24"
FT   gene            311282..312040
FT                   /locus_tag="Shewmr7_0281"
FT   CDS_pept        311282..312040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0281"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: son:SO0317 transcriptional regulator,
FT                   AraC/XylS family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41286"
FT                   /db_xref="GOA:Q0I019"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I019"
FT                   /protein_id="ABI41286.1"
FT                   /translation="MIRMFEYDSKLAQSLSRVPVHQPSIIRVIQGEKSLLWQDEALAVN
FT                   AEQLLLLPAGSHISFVNRPMSGRYRAVQLLLPYDLPPGIMLAATDRVMPKPTQTISRSV
FT                   DFAWNALLHSLTLALPTSVQMHYLAALLLSLPQQISVNWLYSHKPANVSQAVLGLLGQH
FT                   PSAPWQQEDIADKLHMSTASLRRKLAQEDTSFRQLLAEVRLCQGLTLLQNSTDSVLQIA
FT                   LACGYLSAEKFSARFKQAFGLTPAAYRRTL"
FT   gene            complement(312087..313133)
FT                   /locus_tag="Shewmr7_0282"
FT   CDS_pept        complement(312087..313133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0282"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: cps:CPS_3847
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41287"
FT                   /db_xref="GOA:Q0I018"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I018"
FT                   /protein_id="ABI41287.1"
FT                   /translation="MNKTSLLLLGLTLPFGTMAAENSDWEQLDRRLQHLEQQQTTQLQN
FT                   TELSLYGSVRPTLVYSDSSLTDDWDVGDALSRIGIKGKTEFAPGWALLAQGEWKINLNG
FT                   DGSFGDARLAFAGVSSPWGQFTLGRQRPVQYSLVAEYTDIFNNANSPFAYNQESPFFTD
FT                   NLALYQAKIGYFTLMGAAQFKSEEANSGADMLNAGIGFDWQQLHLGLSYLEQDTFESNL
FT                   NTGKENTTGFAMAYSFTNGVYLAVAYQYKDYQLNQGEDREGYSLDSALALPLGPDYKLK
FT                   LGYFQFDDGVSDPSSLNYQGVNTTIEWSPTPNVRLHAEYLYQDNDNRDTDNSIAIGVRY
FT                   DFDLNWKA"
FT   sig_peptide     complement(313074..313133)
FT                   /locus_tag="Shewmr7_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(313290..314255)
FT                   /locus_tag="Shewmr7_0283"
FT   CDS_pept        complement(313290..314255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0283"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   son:SO4515 formate dehydrogenase, C subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41288"
FT                   /db_xref="GOA:Q0I017"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I017"
FT                   /protein_id="ABI41288.1"
FT                   /translation="MKRLITAITSLTTGICSLPLLASETLMPQPQQWQPIQEIAVQGDI
FT                   PELRGMPLQPEFPAPLAQVNQGYLETLAPATWWADLLTYSFFGMFFILALFVLINGKAK
FT                   LTQGFSGQMVNRWSGMDVLFHWIGAIACLLLIGTGLAMIAGRFWLEPNMGAERWIGFIG
FT                   SSVAIHNLMAFPFILGWLVMVVKWANKQLPEACDLGWFKALGGYLNFGSFKGKHPDAGF
FT                   ANAGEKLWFWCFALFGALMIGSGLVLMFPSLVATKDGANLALLLHLVSAFVLGAFTVVH
FT                   IYMATVISEGGMECMLTGQCDENWAKQHHNLWFQKLPKSK"
FT   sig_peptide     complement(314187..314255)
FT                   /locus_tag="Shewmr7_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(314265..314897)
FT                   /locus_tag="Shewmr7_0284"
FT   CDS_pept        complement(314265..314897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0284"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: dsy:DSY4601 uncharacterized component of anaerobic
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41289"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I016"
FT                   /protein_id="ABI41289.1"
FT                   /translation="MTSADFGPVATGYQAFKGMLFTPSNPDTLQLLITWLEHNQQYPML
FT                   LQEARKWLAEPMELECDFNRMCIGPTRLLVPPYESVYRDGGRQLNTDNTTAVASFYQKL
FT                   GLVIDNKLNEPADYIGNEMEFLFCAEALRHHHSNTNPTVANELNQMAQRFLQQHLGTWF
FT                   EDFTNGMSHHAQLKFWDCYAKALADFLANRLNIARAYASSEKPRLDA"
FT   gene            complement(314894..315442)
FT                   /locus_tag="Shewmr7_0285"
FT   CDS_pept        complement(314894..315442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0285"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: dsy:DSY4602 putative oxidoreductase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41290"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I015"
FT                   /protein_id="ABI41290.1"
FT                   /translation="MENKHQLGFVFRQENCVGCQACTIACQIHNELPEDVRFRKVDRYE
FT                   VQRDDGAVDVWLSHSCMHCGNPACLIACPAQAYTVRSDGLVVLNRDKCTGCGLCVSACP
FT                   YDAVVMLKTDGKAAKCNMCIELIDQGLKPACVDGCPVKCLDTDRINQLLAQKPSVSKQG
FT                   IGYGNCVTKPNMVIVKERL"
FT   gene            complement(315454..317655)
FT                   /locus_tag="Shewmr7_0286"
FT   CDS_pept        complement(315454..317655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0286"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: dsy:DSY4603 putative
FT                   anaerobic dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41291"
FT                   /db_xref="GOA:Q0I014"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I014"
FT                   /protein_id="ABI41291.1"
FT                   /translation="MKIDRRTFLQGAAASAVLSSLSGLTPGIAHAKQPGANTGLLAKRN
FT                   GDVVYHSCLRNCAARCLLKFRVQDGRMTYVSGAEEQAKTGLAPCLKGQSYVQYTYAADR
FT                   ILHPMERVGNKGEGKWRRISWDEAYRKISSRFKQIIAEHGSEAILPYSYSGNYGAIGMS
FT                   ASGERFWNRIGSSILERKVCTYAAYDGLESLYGTFLGPDPEDILLSDVYLTWGHDEVVS
FT                   NTIAIKLINQARDRGTKLLAVNPQRTPLCSQADIYLQPRPSTDVQLCAGIMKYLVEKDL
FT                   VDHEFIAEQTIGYDALLQRLNEISYDEIETITGVPRAKMFEFAKVLGENEKTMLRMGYG
FT                   FQRNFNGARMSRAVAMLLAVTGNFGKRGNGLIYDNVHAGGGLNQYQASGKYMRSNPDAQ
FT                   RINMTELAKALHPTHPTSHDKPSKPIHGMIIYNGNPVVVAPDTNAVIEGMKREDLFVVG
FT                   HDMVMTDSLQYCDIILPAASQFETDDIVGDYHGYYVQVCQKVIEPLGESKCNWTFFREL
FT                   GQAMGFEDPAFKASNDDIIRELLTTDSPYYKGVSYERLMKEKYIKLDIPQPVLADGKYD
FT                   TPSGKIEFSSQLMADAGFHPVLDWGLPEDEMEAREKALPFRLLSSGVPQRVNSSFYNVK
FT                   YIRAIPAYYVKINPEDAKTYGIKNNDRVQLSNHRGDAKFVAMITTGVPQGTLMSPKCNW
FT                   LRLNPNGTEGCTNSLTTDRLTDMGGCSAYHSTRVSLAKA"
FT   sig_peptide     complement(317560..317655)
FT                   /locus_tag="Shewmr7_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(317767..319203)
FT                   /locus_tag="Shewmr7_0287"
FT   CDS_pept        complement(317767..319203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0287"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; KEGG:
FT                   hpj:jhp0542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41292"
FT                   /db_xref="GOA:Q0I013"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I013"
FT                   /protein_id="ABI41292.1"
FT                   /translation="MKEHLFNKLASFASIIIMALPVGIACFIFGFIYLDNPCAFCWQER
FT                   TAMILVALTALYIVRFGLKPKYIAALVWLGIYGAFMASVHTSINLGSDIGQGFSLKIMG
FT                   AHTYTWALFVFVVVLIVVALLMLTLGNKFPSNGYGKQPLDTLPKIACGVFLVVISGNIV
FT                   QAFTQTGPLPFVGQDSPGRVSFNPQFMSWELDHWPTYAPNARGAYAIDNPDIETWQLTE
FT                   PLFAEVPRAKLVAEQVLPSEISGRVTAIDYQAEAEIYALTTTDNWVYILDKQMQILSKA
FT                   QIDGMYMLHIETLQGVAFTSSNSLLVMGFNKAWAELTLDPAQNWEMNYRRFNQSSDGIG
FT                   ETARGQFSTVRAKTSYSLALGYSSTLAQFVTVTTRDALNEHLVLSRFDHTDMTLSAESN
FT                   LQGLPALPQITGISVQGEQAWILNNDGSEILKLNLLTGEVAPMAKLAGTNNPQGLLVQD
FT                   GKLVTISQINGQNQLQTYVM"
FT   gene            complement(319414..320376)
FT                   /locus_tag="Shewmr7_0288"
FT   CDS_pept        complement(319414..320376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0288"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: vpa:VPA0299
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41293"
FT                   /db_xref="GOA:Q0I012"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I012"
FT                   /protein_id="ABI41293.1"
FT                   /translation="MKIDNLNYLQLRVLLSVYKHGQGNIAATELGLSNCNVTRILNALR
FT                   DIFMDSLFIRKSHGLIPTKKLEELIPHAKYLVEQYQLLERQHSVFTPSESGGHFVIRAY
FT                   DEFVYAVHKVIANYIQPEAPNLRFDVRSLSHDCNNELIAGDIDFVVVYEGFDDSRLNNE
FT                   IFSETGDIYILANHNHPILEGEMSLEQLSHYPLLEIDNYNDLSCPLLVNLCRDNGLQMD
FT                   MAGYTDSLATAMQLLANSNSITLSCNQFTRQFVEMIPAISYRRLTDEMIKDIKEIRSEQ
FT                   RAVGNYILYGNINNSPAFNWVKSKLVYGLEREWRLASAS"
FT   gene            320826..321176
FT                   /locus_tag="Shewmr7_0289"
FT   CDS_pept        320826..321176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0289"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   son:SO0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41294"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I011"
FT                   /protein_id="ABI41294.1"
FT                   /translation="MAEEQFTETSFWNKIKIFGRQAGREVVERALWLYYAAQKPNTPKW
FT                   AKSVIFGALAYFISPLDAIPDLTPLVGFTDDLGALAAALTMVMLYIDDEVKSQAADKLA
FT                   LWFGDEPAEPKS"
FT   gene            321337..322752
FT                   /locus_tag="Shewmr7_0290"
FT   CDS_pept        321337..322752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41295"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I010"
FT                   /protein_id="ABI41295.1"
FT                   /translation="MCLGKEMKNIMAVILWFLGVSAATPVFADKASPEQLARLYLDFMA
FT                   QTSRQSEALWPGFRLDDKVHLFSYAGNVWLRQPGGEIIQDNSVLESVNLHSGLSINFGF
FT                   PQYQGQAGVLIQLESPTIQFESTTKTADLPFVIWAGNSVHEAFHFYAQSEWRVLEDARR
FT                   YEGEVYPLNLDARFYRLQLFNALMSALKQPEQQAQYLGYAAYWLQVWRQTAPNEDKVSY
FT                   VNDLVEGSARYVELVAGARFLSQNQSYLGYQQILLQYVQDYYQQQQMLGGWTAEAENIG
FT                   ALAGILLDSTQDAYVWKESVMSGMLPVDLLLSRIKPIAPPVAQNMVQKQRLQDMLAYYP
FT                   ATEQKLTQLLKDVQDPKVPLLVMPSVSDSSSFIDVGEVRSGFYVVPYQEEMTQAYLGMS
FT                   SQFSNLNVSGSPLLDVPLQNYCEGIEAATLLPLGFNFQREGQYLVFNEPEIHGTIRVSA
FT                   SVVEGRTLYCAMN"
FT   sig_peptide     321337..321423
FT                   /locus_tag="Shewmr7_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.986 at
FT                   residue 29"
FT   gene            322754..323791
FT                   /locus_tag="Shewmr7_0291"
FT   CDS_pept        322754..323791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0291"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: son:SO0320
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41296"
FT                   /db_xref="GOA:Q0I009"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I009"
FT                   /protein_id="ABI41296.1"
FT                   /translation="MRKNQLEFTYMRGIAIIFIVLGHSIYNSGEGFPLLLENLLRGGTA
FT                   LFVFISGYFFHRIFYKDFDYGKFMKNKVQNVLYPFLVVSAVGLFFLSLRWIFLEHQSLD
FT                   KLLLSIFYTVRNGYILYPHWYIPFIMAVFLFSPVFLWFIRCSQQMRWILFVLSCVVAIL
FT                   LHRPIGNVNFIHSVVYFMPFYLIGILYSQDEHIVTRYGSIFSALAVIFLIVSLVEQSYI
FT                   VQHIGNYHKAPFEYNGIDWQFIQKLSLCVLVLNFCDWLSQRSRIPWLVETAEMSFAIFF
FT                   IHPLFDMLFNTVATVLRYRLPPGSWVTSILFSAGIFIFLMVGSIITARFIKKRLGNRSR
FT                   LYIGW"
FT   gene            323868..324482
FT                   /locus_tag="Shewmr7_0292"
FT   CDS_pept        323868..324482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41297"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I008"
FT                   /protein_id="ABI41297.1"
FT                   /translation="MENIMKTITLPRLGIVGLMMATPVFANAATEPALAMEQETFFNQL
FT                   ASHCGKAFAGKVVSTDSADAAFRDKSLVMHVRECSDTELKIPFHVGDDHSRTWVITKTA
FT                   QGLRLKHDHRHQDGTEDKVTMYGGDTASVGSSQKQSFPIDQASIDNFMQNGLTQSVTNV
FT                   WHMEVTPSTFSYLLTRENRHFQVDFDLSQPQPLPPTPWGHE"
FT   sig_peptide     323868..323954
FT                   /locus_tag="Shewmr7_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 29"
FT   gene            complement(324561..325142)
FT                   /locus_tag="Shewmr7_0293"
FT   CDS_pept        complement(324561..325142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41298"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I007"
FT                   /protein_id="ABI41298.1"
FT                   /translation="MKSFLSLIVASTCLIASFMAPAAQADDSYTEALNNFHQAKETRKF
FT                   FDTAYGYALFPTVGKGGIGIGAAYGKGRVFQAGQYMGDSSLTQLSIGFQLGGQAYSEII
FT                   FFKDAKSYNEFTSGSFEFDAQASAVAINMGANAKAGTTGNSAGAGQAGGNQSATAAYIN
FT                   GMAVFTVAKGGLMFEAALAGQSFSFEPRGN"
FT   sig_peptide     complement(325065..325142)
FT                   /locus_tag="Shewmr7_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            complement(325281..326213)
FT                   /locus_tag="Shewmr7_0294"
FT   CDS_pept        complement(325281..326213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41299"
FT                   /db_xref="GOA:Q0I006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I006"
FT                   /protein_id="ABI41299.1"
FT                   /translation="MNEFNTFFAQAYWWLSLFGGLHCLALAIYIRYIYHSNNNQKLLAG
FT                   FLSLVGLYFLTGMLNRDNTPIPIHVLFNLITPIYFLLMPLLYLYCKRSLEQTTSPVGLS
FT                   RHYWPALLTLFLAMLDIATRLNLHKNAFWFQAEFFKYRQDIDFSHWSLALPLLLFIQTA
FT                   TYFFALWRLFQRHKLRQQQINDAPQETLKLIRFRWLFGLTLAMLFNWLLRVFVVVLPFY
FT                   LGDSLSTLSHALPRLSLLLSFYLLAAYGLKQITRTAYLKGHMSAPQPKVEPQSSEVLTP
FT                   EEFEFIQQLQQESNECSEKITHTPPDPKN"
FT   gene            complement(326269..326670)
FT                   /locus_tag="Shewmr7_0295"
FT   CDS_pept        complement(326269..326670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41300"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I005"
FT                   /protein_id="ABI41300.1"
FT                   /translation="MDSAALLTGKLRYEHETISAMAKIYCKAKHQGQTESGLCEECLAL
FT                   LEYAAVRLDRCPYGQDKPTCNKCPVHCYKPAQKAQVKEIMIFAGPRMLLPHPIRAIKHL
FT                   LAERQPVPASVPEAASNRHQRIAITQKNL"
FT   gene            complement(326775..327134)
FT                   /locus_tag="Shewmr7_0296"
FT   CDS_pept        complement(326775..327134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0296"
FT                   /product="DsrE family protein"
FT                   /note="PFAM: DsrE family protein; KEGG: son:SO0325
FT                   DsrE-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41301"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I004"
FT                   /protein_id="ABI41301.1"
FT                   /translation="MQNILIVAHASPYGTEKLFNSLRIALALKDQTEQQVDLKIFLMSD
FT                   AVFGALKHQTTPDLSYNLQQMFEILSAQQVPILLCKTCAQARGVNPEMLLEGAQIGTLQ
FT                   DLTRWTLAADKVMHI"
FT   gene            327387..328304
FT                   /locus_tag="Shewmr7_0297"
FT   CDS_pept        327387..328304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41302"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I003"
FT                   /protein_id="ABI41302.1"
FT                   /translation="MKVVVVFILIAIGVFLFRRAQRLAKEEQEAMMAKKSTEKTRDTSA
FT                   SPDEAEPTPDLAPSATNESTAAAAAKAPEVELMPRDVEPASRVELSEDIIDVEIPATTH
FT                   DENVIILADTHSADADKDSAIPEDDTLAAKASEAKEDPVVVDVPVKAKESAESSPEVAS
FT                   TRLAKDEPLAALGSWANVTLERAVEEYQSAETALARYNALQNVIAECYKQRKSTEYLAY
FT                   GAALHGLYLALFHSANAEKPKELELKTPGFMQLATLLNDTQDFDKAIALCQEALKLGLT
FT                   DGTVTGFEGRISRIEKAQAKATTV"
FT   gene            328482..328832
FT                   /locus_tag="Shewmr7_0298"
FT   CDS_pept        328482..328832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO0329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41303"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I002"
FT                   /protein_id="ABI41303.1"
FT                   /translation="MKYVASCFNRSGKMKLSLAILFASLSLGLSGCTKTPEWTLFYYPA
FT                   ATSLPTTPLQTDDINGYYDTLEQCQRKAQGLQRLTGSGVSGFEASGAGVYQCGQQCELN
FT                   DKSVLVCKQLVQ"
FT   sig_peptide     328482..328577
FT                   /locus_tag="Shewmr7_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.864 at
FT                   residue 32"
FT   gene            328844..330298
FT                   /locus_tag="Shewmr7_0299"
FT   CDS_pept        328844..330298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0299"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   son:SO0330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41304"
FT                   /db_xref="GOA:Q0I001"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I001"
FT                   /protein_id="ABI41304.1"
FT                   /translation="MKFKQDFFTQLPEFYAQVYPQGISNPHWLAWSEDVAKLIDLQQPT
FT                   DALLQGLSGNAAVEGASYYAQVYSGHQFGGYTPRLGDGRSIILGEALGPQGAWDVALKG
FT                   GGPTPYSRHGDGRAVMRSAVREFLVSEALHHLGVPTTRALAVIGSDMPVWRESQETAAI
FT                   TVRLARSHIRFGHFEFFCHSERGQADKLTQLLNFTLKQHYPHLSCDLAGYKAWFLQVVQ
FT                   DTAKLIAHWQAIGFAHGVMNTDNMSILGDSFDFGPFAFLDTFQEDFICNHSDPEGRYAF
FT                   GQQPGIGLWNLQRLAQALTPVIPSDDLIAALNQYQHALVQHYLMLMRAKLGLAERADST
FT                   AEQDQQDLELIGRFTVLMEKNQLDYSNTWRRFGQLDPSSAHSSLRDDFIDLNEFDAWYQ
FT                   AYQTRLGKVTDIEAWQQARNSVNPKYILRNYLAQEAIIAVEEGNLAPLERLHQVLRQPF
FT                   AEQVEHEDLAKRPPDWGQGLIMSCSS"
FT   gene            330298..330603
FT                   /locus_tag="Shewmr7_0300"
FT   CDS_pept        330298..330603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41305"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I000"
FT                   /protein_id="ABI41305.1"
FT                   /translation="MEVKMKLEAIQLDRAALSLSVSGDIDFDHFEAFAEPLAHALDCRV
FT                   RERQWGADRHQWLLEFEGTSLWLNYEFYGNICWLSVEREVDFEVLEYLATLLKSYV"
FT   gene            330614..331651
FT                   /locus_tag="Shewmr7_0301"
FT   CDS_pept        330614..331651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0301"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   son:SO0332 hypothetical kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41306"
FT                   /db_xref="GOA:Q0HZZ9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ9"
FT                   /protein_id="ABI41306.1"
FT                   /translation="MSQDKLVPPQGAVDETHSGAAFDFQALTPDLILDAIESLGIYPET
FT                   GLLALNSYENRVYQFRSDEGQRYVVKFYRPDRWTDVQIQEEHDYAIALAEQEIPMAVPT
FT                   AVQGQTLHHFHGFRFALFPSIGGRPFEVDNLEQLEFVGRFIGRIHQYGAQSTFKAREPL
FT                   NPQILGDEPLAWLKQSELVPNTLRPAFFTVVEQVLAKVNQRWAQQAFTPIRLHGDLHPG
FT                   NILWTPDGPGFVDLDDARMGPAIQDLWMMLTGDRAQQQLQLEVLLEAYEEFCEFDTRQL
FT                   ALIEPLRALRMVHYNAWIGRRWQDPAFPMHFPWFGDEKYWEQQILAFKEQLAALDEPPL
FT                   SLIPY"
FT   gene            331779..332390
FT                   /locus_tag="Shewmr7_0302"
FT   CDS_pept        331779..332390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0302"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: son:SO0333
FT                   thiol:disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41307"
FT                   /db_xref="GOA:Q0HZZ8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ8"
FT                   /protein_id="ABI41307.1"
FT                   /translation="MKKALLMAAALLLAPLTVSAVEYKEGVHYTVINDGPATAKPEITE
FT                   FFSFYCPHCFNFSKTVVPKILAEKPEGVAFNQAHVDFIGKEMGVEMSRAFAVAHQLNVD
FT                   EKMDAAIFSAIHEKKQHFTNRDDVRALFVANGVDGKAFDAAADSFMVKAQMAKMKRDTE
FT                   NAKISGVPALVVNGKYRVETGAIKSYDELLDIAYYLAKKQ"
FT   sig_peptide     331779..331841
FT                   /locus_tag="Shewmr7_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 21"
FT   gene            332852..333064
FT                   /locus_tag="Shewmr7_0303"
FT   CDS_pept        332852..333064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0303"
FT                   /product="protein of unknown function DUF1107"
FT                   /note="PFAM: protein of unknown function DUF1107; KEGG:
FT                   son:SO0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41308"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ7"
FT                   /protein_id="ABI41308.1"
FT                   /translation="MRVFPVYAPKLIAKHARIFLTGVIWVKDLGRLEFEKGRFLLPRKS
FT                   LPKVKQAILELNELIESQNHQTKTA"
FT   gene            complement(333061..333282)
FT                   /locus_tag="Shewmr7_0304"
FT   CDS_pept        complement(333061..333282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0304"
FT                   /product="protein of unknown function DUF904"
FT                   /note="PFAM: protein of unknown function DUF904; KEGG:
FT                   son:SO0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41309"
FT                   /db_xref="GOA:Q0HZZ6"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZZ6"
FT                   /protein_id="ABI41309.1"
FT                   /translation="MSLELLSKLETKIQATLETIELLKMELEEEKQKASTLSEQNQQLT
FT                   EQNQQLQQELASWNDKVTGLVGLLNSEI"
FT   gene            333462..334967
FT                   /locus_tag="Shewmr7_0305"
FT   CDS_pept        333462..334967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0305"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; KEGG: son:SO0336
FT                   hypothetical Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41310"
FT                   /db_xref="GOA:Q0HZZ5"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ5"
FT                   /protein_id="ABI41310.1"
FT                   /translation="MSPNLLAILPLLLTLVLALWLRRTLVALGVGILSGALIIAQFDIL
FT                   QSLGYLLEIGAKQFYSQGAWQWWHLNVLMAMLLLGSMTQLLARSGAVEQFGDWLYRRIR
FT                   TGRQARIGVVLLGWLVFIDGIFSCLAVGHVCQPLSQRYGIRQTQLAYLVDSNASPLCSL
FT                   LPFSSWGPYVMALLAGLSFLPVSALEAFIDIALSNFYAITTLGLSLIVAWFGMGFRPIE
FT                   NAVLAADPVEPSLTPSQGNPWLLAIPMLTLLCASVGLTLWSGAQQVPSWDVSAWLAKAD
FT                   IGAAMRDACLLSTLVTLVLLMLSGRSLGKLLGDLAHGVRMIAFAIAILLCTWMIGAVIQ
FT                   DLGVASLLAAWAKLYLSPSLLVAGMFLLCAIMAFATGSSWGTFAIMIPIGGGIAHNMDA
FT                   SLLLPVLSAVMAGSVFGDHCSPISDTSVLSATSSGCLPHDHVVTQLPFALIGAGAALVG
FT                   FQLVNLSVTTLFVWFGVIGTALGLLALMTRFYPPWLSARSQTN"
FT   sig_peptide     333462..333545
FT                   /locus_tag="Shewmr7_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.402 at
FT                   residue 28"
FT   gene            335024..335380
FT                   /locus_tag="Shewmr7_0306"
FT   CDS_pept        335024..335380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0306"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: son:SO0337
FT                   hypothetical translation initiation inhibitor, YjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41311"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ4"
FT                   /protein_id="ABI41311.1"
FT                   /translation="MSITRLDVGTRMSSIVIHQGTVYLCGQVAKDKYQNISEQTTTMLE
FT                   EVDTLLAQAGSSREHLLSATIYLKDMNDYDAMNAVWDAWVPQGHAPARACVQAAIAEPE
FT                   YLVEVSVIAAVVKA"
FT   gene            complement(335505..335833)
FT                   /pseudo
FT                   /locus_tag="Shewmr7_0307"
FT   gene            complement(335851..336117)
FT                   /locus_tag="Shewmr7_0308"
FT   CDS_pept        complement(335851..336117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0308"
FT                   /product="transcriptional antiterminator, Rof"
FT                   /note="PFAM: Modulator of Rho-dependent transcription
FT                   termination; KEGG: son:SO0339 hypothetical transcriptional
FT                   antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41312"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ3"
FT                   /protein_id="ABI41312.1"
FT                   /translation="MSDYKMIPCAHYDYLELACMHGYRLDIELQDGSLCQARAITTQTH
FT                   ADKTEWLVVEHQAGQQTLRLDSIIAITPTDPHASFGRVMIASQ"
FT   gene            336146..337003
FT                   /locus_tag="Shewmr7_0309"
FT   CDS_pept        336146..337003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0309"
FT                   /product="protein of unknown function DUF1223"
FT                   /note="PFAM: protein of unknown function DUF1223; KEGG:
FT                   hch:HCH_00871 uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41313"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ2"
FT                   /protein_id="ABI41313.1"
FT                   /translation="MRFKVFFSIKGGEIMKRILLVSILFWQLLQPVLAQSLVPFQAQSA
FT                   LTRPYIIELYTSQGCSSCPPAEAWLSEQFNKTDLWQKYFPLAFHVTYWDYLGWKDIFGQ
FT                   RAFSERQYQHLNQKHTRQVYTPQFVINVKEWRGWFSGELNGILAMPQPEVGVLKVSIAN
FT                   QQLEASFEPQSTWVQDKDLHRARLHLALVGSGFTTEIKRGENRHKQLPHDFVVLSMQSL
FT                   PASSVHEHAKDPTLQFTQSLDAIAASAFNAPRLAWVAWLTLNEEPIQAVGGWLEAQQGD
FT                   IQSQ"
FT   sig_peptide     336146..336250
FT                   /locus_tag="Shewmr7_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.805) with cleavage site probability 0.794 at
FT                   residue 35"
FT   gene            337160..338251
FT                   /locus_tag="Shewmr7_0310"
FT   CDS_pept        337160..338251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0310"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="KEGG: son:SO0340 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41314"
FT                   /db_xref="GOA:Q0HZZ1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ1"
FT                   /protein_id="ABI41314.1"
FT                   /translation="MEIKYDLKPASERRTEQFKPEGNVGFGSLRTDHMFLMDYRDGEWR
FT                   DPRIVPYGPFEMAPGAMALHYGQSIFEGAKAFMHEDGEIYTFRINKNAERMNRSADIVC
FT                   IPNIDEQMQIDAINALIDVDRLWFPMQEGACLYIRPFIFATEDRLSVSPSTRYTFCVVL
FT                   SPSGAYYAAGVNKGIRLLISKTYHRAVSGGTGASKAAGNYAASLRAGKAAAQFGASQVL
FT                   YLDANNQQIEEAGAMNHFHILKDGTVIIPTFTDTILKSITSQSIMELGELLGCEVRQET
FT                   VMLDKFIADIESGEIIEAGGFGTAAVVSAVGSYIFEDGRVVTVGNGEVGEHIQRIYKLY
FT                   TDIQKGHIQGPDGWVKRVERVAP"
FT   gene            complement(338311..342825)
FT                   /locus_tag="Shewmr7_0311"
FT   CDS_pept        complement(338311..342825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0311"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: son:SO0341 sensory box protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; Two component
FT                   regulator propeller; Two component regulator three Y domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41315"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZZ0"
FT                   /protein_id="ABI41315.1"
FT                   /translation="MIGVTLSHPILKFVLVVLCLISLGAPRTGLALPLNTANTQLKFEH
FT                   IRSEEGLNQNTITSLFMDSAGMLWIGTQDGLHSYNGYNFNLFIHSPNDPKSISESYVSD
FT                   IIQDAQGYIWVGTFSQGINRLDLKTGTFERFGVEQGLTDPRVTKLNIVGNTLWIGTQGG
FT                   LFSLSTRTNRVTQVSLGTSIEPQITSLANVDNTYLLAGTKASGTFAVTANSITRLNVPQ
FT                   ELVAYQIKANSTRAITLALGNQLWHYDLVSQQGQVLWQTEKNVPYIKDFIQTPQGQFWV
FT                   VGPDAGLIQLQRAGEQFVATYHRYDTKRSNSISENNILCLLEDPFGNLWIGASYSGLNK
FT                   INTRRQYFQHLFEYSAKLPLQSNNIRTIYRSQDNALWIGTEGAGLKRLGFNSTQYEHYN
FT                   SLFAKALGLEAHNLNLILRSIIQDQQGTLWFASNYGLGRLSTGGDFSLLKVSDNQDTST
FT                   EANYIRSLELDDQNRLWVATSHALYRKAPEGNEFTPVSIAHIENFYPMQNQLLTLRADK
FT                   HDLWIGSLNGLVKLDMQTGKGEVFYHDPHDKNTIINNRIRDILVASNGDIWFATHGGIS
FT                   RLSAQATTPIFSDYTREQGLPSDTIYALLEDAEHHIWFSSNAGIGKLNPVSGKVINFNE
FT                   QEGLQALEFNGGVKLKDSDGDLWFGGINGINRFNPKTLPDKRSEAKVALTAYKIAGKKH
FT                   TILDLSHPPKIVMNYTDQLVSFEVTSLDFSYTGKNRFSYFLEGFDNQWHDLPTGNEITF
FT                   TNIEPGNYVLHVRHSIEHNNEGNYALLVDLSIKAPLYRTQFAYVLYGLLTLALLVVVYR
FT                   WRKQKRQQQQEFDTSIRASEERLKLALWASGDGMWDWNIQEQQVYRTHTDIPVPQWNSH
FT                   SLLHDNAHPEDRERFKQVLTEHLLGRSPFFEVEYRIEHSPGNWLWILERGKVVETNAQA
FT                   QPVRMTGTTRNITSRKLIENELVLSSQVLNSMNEAVVVAGLDYRIRSVNPAFSAITGYS
FT                   ERQISDKYLIHLAYSRQQRDLFNGIEQQLLRHKHWAGEIWIRNKARKAILVWLEINQVI
FT                   DVKGETSHFVAVFTDITERKKAEEDLRFLASFDTLTGLPNRTLFQDRLNHAISQAHRSN
FT                   NIVALLFLDLDRFKHINDSMGHHIGDLLLKAVAHRLQNAVREGDTVARLGGDEFTIILE
FT                   GVAKTKAATLISEKVLKAFQAPFLLDDKSLTISTSIGISLYPNDAEDVDSLIKFADTAM
FT                   YHAKALGRNNFQFYTNKLNEMATRHVQLEAGLKQAISRNELSLVYQPKFCLRNGSLTGL
FT                   EALLRWHHSELGPISPAEFIPLAEETGIINQIGHWVINHACQQLAEWNELGLGNISMAV
FT                   NLSARQLKADIISTIEVALAVSGLPAKVLELELTESMIMANPQESVNILSKLKALGLTI
FT                   AVDDFGTGYSSLSYLKRFPIDTLKIDREFVRDITNDPDDAAITSAIIALAHSLELNVVA
FT                   EGVETQEQLNFLALQGCDQVQGFLLSKPLSAQDCLALLQQRIK"
FT   sig_peptide     complement(342730..342825)
FT                   /locus_tag="Shewmr7_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.829 at
FT                   residue 32"
FT   gene            complement(343105..344298)
FT                   /locus_tag="Shewmr7_0312"
FT   CDS_pept        complement(343105..344298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0312"
FT                   /product="methylitaconate delta2-delta3-isomerase"
FT                   /EC_number="5.3.3.6"
FT                   /note="TIGRFAM: putative AcnD-accessory protein PrpF; PFAM:
FT                   protein of unknown function DUF453; KEGG: son:SO0342
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41316"
FT                   /db_xref="GOA:Q0HZY9"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY9"
FT                   /protein_id="ABI41316.1"
FT                   /translation="MSKNPFPPQIKVAATYMRGGTSKGVFFRLQDLPEAAQVPGPARDA
FT                   LLLRVIGSPDPYGKQIDGMGGATSSTSKTVILSKSSQADHDVDYLFGQVSIDKPFVDWS
FT                   GNCGNLTAAVGAFAISNGLIDAARIPQNGVCTVRIWQANIGKTIIAHVPITNGEVQETG
FT                   DFELDGVTFPAAEVQIEFMNPAADEDGDGGSMFPTGNLVDVLEVPGIGSFNATMINAGI
FT                   PTIFINAEDLGYTGTELQDDINSDNAALAKFETIRAHGAVRMGLIKHIDEAASRQHTPK
FT                   VAFVAKPKNYVSSSGKAVAAEEIDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVN
FT                   LAAGGGKKEAVRFGHPSGTLRVGAQAMQTNGEWTVVKAIMSRSARVLMEGFVRVPTA"
FT   gene            complement(344412..347015)
FT                   /locus_tag="Shewmr7_0313"
FT   CDS_pept        complement(344412..347015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0313"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: 2-methylisocitrate dehydratase,
FT                   Fe/S-dependent; PFAM: aconitate hydratase domain protein;
FT                   KEGG: son:SO0343 aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41317"
FT                   /db_xref="GOA:Q0HZY8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY8"
FT                   /protein_id="ABI41317.1"
FT                   /translation="MTTAMNRLYRKPLPGTALDYFDTREAVEAISPGAYAKLPYTSRVL
FT                   AENLVRRCEPEALTDSLKQIIESKQELDFPWFPARVVCHDILGQTALVDLAGLRDAIAA
FT                   KGGDPAQVNPVVPTQLIVDHSLAVEYGGFDKDAFAKNRAIEDRRNEDRFHFINWTQKAF
FT                   KNIDVIPQGNGIMHQINLERMSPVVHARDGVAFPDTLVGTDSHTPHVDALGVIAIGVGG
FT                   LEAESVMLGRASYMRLPDIIGVELTGKPQPGITATDIVLALTEFLRKEKVVSSYLEFFG
FT                   EGAEALTLGDRATISNMTPEFGATAAMFYIDQQTLDYLTLTGRSDEQVKLVETYAKTTG
FT                   LWSDDLKQAEYPRTLHFDLSSVVRTIAGPSNPHARVPTSELAVRGISGVVENEPGLMPD
FT                   GAVIIAAITSCTNTSNPRNVIAAGLLARNANAKGLSRKPWVKTSLAPGSKAVQLYLEEA
FT                   NLLPELESLGFGIVGFACTTCNGMSGALDPVIQQEVIDRDLYATAVLSGNRNFDGRIHP
FT                   YAKQAFLASPPLVVAYAIAGTIRFDIEKDVLGQDKDGNPVRLIDIWPTDAEIDAVIAAS
FT                   VKPEQFRKVYEPMFDLSVDYGDKVSPLYDWRPQSTYIRRPPYWEGALAGERTLKGMRPL
FT                   AVLGDNITTDHLSPSNAIMMDSAAGEYLHKMGLPEEDFNSYATHRGDHLTAQRATFANP
FT                   KLKNEMAIVDGKVKQGSLARIEPEGQVTRMWEAIETYMDRKQPLIIIAGADYGQGSSRD
FT                   WAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFKAGENRATYGIDGTEVFDVYGE
FT                   IAPRADLTVVISRKNGERVEVPVTCRLDTAEEVSIYSAGGVLQRFAQDFLESNLK"
FT   gene            complement(347154..348281)
FT                   /locus_tag="Shewmr7_0314"
FT   CDS_pept        complement(347154..348281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0314"
FT                   /product="2-methylcitrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /note="KEGG: son:SO0344 methylcitrate synthase; TIGRFAM:
FT                   2-methylcitrate synthase/citrate synthase II; PFAM: Citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41318"
FT                   /db_xref="GOA:Q0HZY7"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY7"
FT                   /protein_id="ABI41318.1"
FT                   /translation="MSDAKKLSGAGLRGQSAGETALSTVGVSGSGLTYRGYDVKDLAEN
FT                   ATFEEVAHLILYGELPTTAQLEAYKTKLKGMRGLPQALKEVLERIPADAHPMDVMRTGC
FT                   SMLGNLEAEHSFSEQSQIADRLLAAFPSIICYWYRFSHDGVRIETETNDEQIGAHFLHL
FT                   LHGKAPSALHAKVMDVSLILYAEHEFNASTFTARVCASTLSDMHSCVTGAIGSLRGPLH
FT                   GGANEAAMELIQDMKDEADARDVLMGKLERKEKIMGFGHAIYRDSDPRNAIIKEWSEKL
FT                   AADYGDDRLYRVSVACEALMWEQKKLFCNADFFHASAYHFMGIPTKLFTPIFVCSRVTG
FT                   WTAHVMEQRSNNRIIRPSADYVGVALRKVVPIAER"
FT   gene            complement(348515..349393)
FT                   /locus_tag="Shewmr7_0315"
FT   CDS_pept        complement(348515..349393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0315"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /EC_number="4.1.3.32"
FT                   /note="TIGRFAM: methylisocitrate lyase; KEGG: son:SO0345
FT                   methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41319"
FT                   /db_xref="GOA:Q0HZY6"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY6"
FT                   /protein_id="ABI41319.1"
FT                   /translation="MTQSAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSG
FT                   AGVANASYGLPDLGMTSMNDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEK
FT                   AGVAAVHMEDQVSQKRCGHRPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVE
FT                   GLEAGIERAKAYIAAGADMIFAEALTELDQYRHFKAQVNAPILANMTEFGQTQLFNKEE
FT                   LAEAGADMVLYPLGTFRAANQAALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFE
FT                   DKLDQLFSQDK"
FT   gene            complement(349460..350248)
FT                   /locus_tag="Shewmr7_0316"
FT   CDS_pept        complement(349460..350248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0316"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: son:SO0346 transcriptional regulator GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41320"
FT                   /db_xref="GOA:Q0HZY5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY5"
FT                   /protein_id="ABI41320.1"
FT                   /translation="MLKQETIFPTDDTPSSVAHAATSPTNKVKSLASEKSSTTLADQIL
FT                   VQIQTSIIKGELPAGSKINEQALAEKYGISRGPTREALQTLERQRLVVRAPHVGARVAQ
FT                   LTVSELNDLYQLRSVLEGMACELAANRITPEQLAKLQDLLAVQETALANGDTYFQEEGD
FT                   VDFHYQIIQASGNKHLQETLIGGLYHLLRMYRYQCTNKNRPVKAIAEHRRIVEAIAQRD
FT                   GELASLLMRRHIEQGRKNTELRLIELQANAAAKETLANIN"
FT   gene            350580..351053
FT                   /locus_tag="Shewmr7_0317"
FT   CDS_pept        350580..351053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0317"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   ppu:PP5158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41321"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY4"
FT                   /protein_id="ABI41321.1"
FT                   /translation="MEKILISSCLLGQAVRYDGGHNLLQDEWMQRWQREGRIVAFCPEC
FT                   AGGLATPRPAAERVGEAVLTAQGKDVTAAFQLGAQKALALAQDQGIKMAILKARSPSCG
FT                   NQHIYDGTFSKRLIAGQGMTAELLQAAGVSVFNETELAQAATRLAQLEAESAG"
FT   gene            complement(351085..352026)
FT                   /locus_tag="Shewmr7_0318"
FT   CDS_pept        complement(351085..352026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0318"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   son:SO0347 acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41322"
FT                   /db_xref="GOA:Q0HZY3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY3"
FT                   /protein_id="ABI41322.1"
FT                   /translation="MLNFLPGPVLFILSLSLLIINTALWGTLVCLGGLVKMLMPAQSAR
FT                   NAVTALMNRFMWAWATCNGGILYLIAKIEWDVQGLESLNKNSWYLLISNHLSGFDIAAQ
FT                   TYLLRNHIPMLKFFLKKELIYVPIMGLGCWALDMPFMDRTSPAKLKKNPKLKGKDLATT
FT                   RRACEKFKNMPTSIINYVEGSRFTEDKRQRQDSPYRHLLRPKAGGIAFTLSAMGEQFTN
FT                   LLDVTLVYPDAPDDVLFGVMNGKVRKIVVRVRALPVPQVDATRYFAESEYRVEFQRWLN
FT                   QIWVEKDEQIDALLLQHRQLTDSATSTHTQLH"
FT   gene            complement(352034..352936)
FT                   /locus_tag="Shewmr7_0319"
FT   CDS_pept        complement(352034..352936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0319"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   son:SO0348 acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41323"
FT                   /db_xref="GOA:Q0HZY2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY2"
FT                   /protein_id="ABI41323.1"
FT                   /translation="MGTLFSQLKGCIAFLGYVVNTLFWVIPIVLGSLIKLIPLPPLRTA
FT                   ISYFLDFCASAWISVNGVIERVLHPVEIELSGETQFSTKEWYMVIANHQSWVDILILQR
FT                   VFNRRIPFLKFFLKQELLYVPVLGLAWWALDFPFMRRYSTSQLKKNPKLKGKDIEITRK
FT                   ACAKFKTKPVSVMNFVEGTRFTKAKHKKQNSQFQHLLKPKAGGMAFALSAMGEQIHKLV
FT                   DVAIYYPGPVPSFWDYLTGKLPKVKVHIKVTDIAPGMRGDYMNDRDFKIGFQEQLNELW
FT                   LAKDQVISQLAGQADQEVR"
FT   gene            complement(353302..354828)
FT                   /locus_tag="Shewmr7_0320"
FT   CDS_pept        complement(353302..354828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0320"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: son:SO0349 magnesium chelatase family protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41324"
FT                   /db_xref="GOA:Q0HZY1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY1"
FT                   /protein_id="ABI41324.1"
FT                   /translation="MAIACVHTRASCGVEAPEVIVEVHLSNGLPAFNLVGLPEASVKEA
FT                   RERVRSALINAGFEFPMRRITVNLAPADLPKQGGRYDLPIAIGILAASEQIPASSLKNT
FT                   EFVGELALSGQIRHCQGLLPAIIAAKRHNNQLILPLENRHDAELVGYHGVYFASHLQSL
FT                   AAFLHGQAPLPMLEQQLEWINDEAPTTQPCLSDVIGQYQAKQALEIAAAGNHNLLMLGP
FT                   PGTGKTMLASRIMALLPILNYEEALEVAAIHSVAGINIKPQDFLKRPFRAPHHTSSSIS
FT                   LVGGGSIPKPGEISLAHRGVLFLDEVAEFPRKVLDCLREPMETGEVVISRAAAKLTFLS
FT                   RFQLIAAMNPSPSGDIEGTNRATPDQVQRYLARLSGPFLDRFDLTIEVPKLPAGTLTQP
FT                   TSTSETSDEIAKRVKRARDSQLARAGVLNSELSGKQLKQFGGLSDADLGFLEQSVVKLG
FT                   LSVRSFHRIQRVARTIADLEQAPNTERRHLAQALGYRAMDKLLARLSQQY"
FT   gene            355041..356189
FT                   /locus_tag="Shewmr7_0321"
FT   CDS_pept        355041..356189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41325"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZY0"
FT                   /protein_id="ABI41325.1"
FT                   /translation="MDMLLAENSPIRQQLLEQKLAQFKDPKLANVLSAFIRCSVDLYPC
FT                   ANEDYAQLGNSRLGGLPDLPVGMDYPMTLVGREEMLDGYVESFGHTREFINEHWREDWQ
FT                   DDWETDEAHLWDWDEAAQAFRVPMQFIAQLNCSDLKAFQSYLPREGRLLFFLERWRFSE
FT                   MLRGHVYYVAEDQQLKSGKAIAELKFDDAVCANYEYEEAYQLQGIASIKMIAPDMINSD
FT                   NPHLVRLAKARLQALPEPQQAMVLEALAVVDDELVPEWQNQLYFFDLMKMNKHGLIPGQ
FT                   ILTQAQWAALPDWQSSNLQALLVAEQPLPYYDGIASINGHGDSRYKAPELHAAAELGGN
FT                   AEDYLVLFKAVYSEHSMQLNFIIHRDDLALGKFDRIYCIYDN"
FT   gene            complement(356195..356791)
FT                   /locus_tag="Shewmr7_0322"
FT   CDS_pept        complement(356195..356791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0322"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: son:SO0351
FT                   DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41326"
FT                   /db_xref="GOA:Q0HZX9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZX9"
FT                   /protein_id="ABI41326.1"
FT                   /translation="MHILLAEDQAMVRGALAALLTLAGGFTITQASNGDEALNLLKQQD
FT                   FDLLLTDIEMPGRTGLELATWLKEQHSHTKVVVITTFGRAGYIKRAIEAGVGGFLLKDA
FT                   PSETLVHAIQQVIAGKRIIDPELAMMAIGDVDPLNDKERRALRFASEGKSTAEIAEMLF
FT                   IAEGTVRNYLSEAIAKLNASNRIDAARIAKQKGWL"
FT   sig_peptide     complement(356687..356791)
FT                   /locus_tag="Shewmr7_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.366 at
FT                   residue 35"
FT   gene            complement(356791..357870)
FT                   /locus_tag="Shewmr7_0323"
FT   CDS_pept        complement(356791..357870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0323"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region; KEGG: son:SO0352 sensor histidine
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41327"
FT                   /db_xref="GOA:Q0HZX8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZX8"
FT                   /protein_id="ABI41327.1"
FT                   /translation="MTQHSVQIEQKIAWVYLINLAFYLIPLFVTPYPSWQIGLILAVLI
FT                   PFIYSYFWAYRCHTRVAYRPISVMLLLAIAITPINPGSISLFTFASFFIGFFYPLRVSM
FT                   LSWFGILALLFLLNHFSQFNNLYFPLYGSALVFGVGMLGIAEQKRYQHRLKERQSAQEI
FT                   STLATMVERERIARDLHDIMGHSLSSIALKAELAEKLLAKQEYQLATTQLQELGQIARE
FT                   SLSQIRHTVSDYKHKGLASCVTQLCNSLRDKGIAVELLGELPKLSARAESQLGLVLTEL
FT                   VNNILRHSSASQCRIQFREQADSLIVDVQDNAPASPIIEGNGLTGIRERLASLGGHLSY
FT                   DLEQGYAFSVSLPLQGATD"
FT   gene            complement(357954..358658)
FT                   /locus_tag="Shewmr7_0324"
FT   CDS_pept        complement(357954..358658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0324"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG: son:SO0353
FT                   TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41328"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZX7"
FT                   /protein_id="ABI41328.1"
FT                   /translation="MKTFLLLSSLALTCSPVFAASNSSPNIAEVDKAASTLNIEKLQQL
FT                   STATQDYEAAYANYRLAISANVMGQKTIAENALASAQASLETLTNSQADAESLALLSSV
FT                   YGMQIALDNSKGAELGSKSANAIAQAEQLAPLNPRVALVKAIAAYNTPAMFGGSMQHAK
FT                   TLASSAIERFNQPCEDICWGEAEAYTWRGLAKQELGDTQGAIEDWQQALQVEKDYGWAK
FT                   FLLQQNQQISAK"
FT   sig_peptide     complement(358599..358658)
FT                   /locus_tag="Shewmr7_0324"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            complement(358835..359785)
FT                   /locus_tag="Shewmr7_0325"
FT   CDS_pept        complement(358835..359785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0325"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: son:SO0354
FT                   sodium/calcium exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41329"
FT                   /db_xref="GOA:Q0HZX6"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZX6"
FT                   /protein_id="ABI41329.1"
FT                   /translation="MLIALSIIGGFIILTLGAEALVRGASSIALRLGITPLIIGLTIVA
FT                   FGTSAPELAVSVKSALAGNSGIALGNVIGSNIANIGLILAITALIRPIQVQSQMVRRDI
FT                   PLMILASMLFWGLLLDGELSLIDGVILLSLLVGYLVFSYFSSKNTTDADGEIIEEGPKN
FT                   PLLSVAFIVVGIGMLVGGGILFVNGAVDLAKVFGVSEIIIGLTIVAIGTSMPELVTSVL
FT                   AALKGESDIAIGNVVGSNLFNILGILGVTAIVHPVSALGFQSFDFIVMLALAVVILPFA
FT                   WSGLRIGRREGATLLVAYLGYMVYLVNQASTQAVV"
FT   gene            complement(359945..361609)
FT                   /locus_tag="Shewmr7_0326"
FT   CDS_pept        complement(359945..361609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0326"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   son:SO0355 AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41330"
FT                   /db_xref="GOA:Q0HZX5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZX5"
FT                   /protein_id="ABI41330.1"
FT                   /translation="MDNAIKTPVEMLAHWANTRGDEIYLRQPIKGQYLDFTWNEVQEKV
FT                   QQLAGALRHLGLEPGDKIAVLSKNCAEWFITDLALMHGGYISVPIYPTANTDTIRYVLQ
FT                   HSGAKAIFLGKLDHWADQEAGVGGELLRLAMPYETMPAQYQWEQLLKMGNPLIEAPLPE
FT                   LDQTMTLIYTSGSTGQPKGAIQTFASYGWTCQAVVRDLRTNGNDRLLSYLPLAHITERV
FT                   AIEGSSFYSGSTVAFVESLDSFVADVQRAKPTVFFSVPRLWSLFQKNIIDKIGVGKLNL
FT                   LLKIPLISSLVKHKIHKGLGLNHCRLLGSGSAPIPPSLIHWYHSIGLDICEAWGMTENC
FT                   AYSIINYPFDVRKIGTVGKPVQDCQIRQGEDGELLLKSPGLMTAYYQQPEATAAAFDPD
FT                   GFFHTGDLCAIDADGCVTITGRVKDNFKTAKGKYVAPVPIERKLAQDPHVELICVIGSG
FT                   LPHPVALVQLSEGATLQAREEVRASLKATLDSVNPHLESHEHVDAIVVVNEPWTIENDV
FT                   LTPTLKIKRHVLEKAFSERVDGIRGAQVRWEDELAVK"
FT   gene            complement(361842..362225)
FT                   /locus_tag="Shewmr7_0327"
FT   CDS_pept        complement(361842..362225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0327"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: son:SO0358 endoribonuclease
FT                   L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41331"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZX4"
FT                   /protein_id="ABI41331.1"
FT                   /translation="MAEKIIIATENAPAAIGTYSQAVKVGNTVYLSGQIPLVPSTMQIV
FT                   SDDFEAQVVQVFENLTAVCTAAGGTINDIVKLNIFLTDLSHFAKVNEIMSRYFSQPYPA
FT                   RAAIGVKQLPKDAQVEMDGVMEL"
FT   gene            complement(362248..364350)
FT                   /locus_tag="Shewmr7_0328"
FT   CDS_pept        complement(362248..364350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0328"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /note="KEGG: son:SO0359 guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase; TIGRFAM: RelA/SpoT family protein;
FT                   PFAM: amino acid-binding ACT domain protein; TGS domain
FT                   protein; metal-dependent phosphohydrolase, HD sub domain;
FT                   RelA/SpoT domain protein; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41332"
FT                   /db_xref="GOA:Q0HZX3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZX3"
FT                   /protein_id="ABI41332.1"
FT                   /translation="MYLFEGLKESASGYLEPEQVELLKQAYQVARDAHEGQMRTSGEPY
FT                   ITHPVAVARILAEMRLDHETLMAALLHDTIEDTYVTKEDLAEQFGEAVAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMMMAMTQDIRVILIKLADRTHNMRTLGALRPDKRRRIARETL
FT                   EIYAPIANRLGIHNIKTELEDLGFQAYYPMRYRVLKEVVKAARGNRKELIQGIEAAVLT
FT                   RLNDAGIKGKVKGREKNLYSIYNKMQSKELQFQEVMDIYAFRVIVDSIDTCYRVLGAMH
FT                   GLYKPRPGRFKDYIAIPKANGYQSLHTSLFGPHGVPVEIQIRTEDMDQMADKGVAAHWA
FT                   YKGGADGQGTTTQVRARKWMQSLLELQQSASTSFEFVENVKTELFPEEIYVFTPEGRIL
FT                   ELPVNATAVDFAYEVHTDVGNTCVGARVNRQAYPLSQPLISGQTVEIITAKGARPNAAW
FT                   LNFVVTGKARAKIRQVLKSLKADDAIALGRRLLNHALGKTKLDSIPAEQIDKVVRDTKH
FT                   ANLNSLLADIGLGNAMSIVIAQRLIGDNLENQESRDSHLMPIRGAEGMLVTFANCCRPI
FT                   PGDAVIAHVSQGKGLVVHMENCANIRGYQGEPDKYIPVQWDNVEGVEYQANLRVEIVNH
FT                   QGALAKITSIIAAEGSNIHNLSTEERDGRVYLINLRISVKDRIHLANVMRRIRVLPEVL
FT                   RTSRNR"
FT   gene            complement(364394..364672)
FT                   /locus_tag="Shewmr7_0329"
FT   CDS_pept        complement(364394..364672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0329"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: son:SO0360 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41333"
FT                   /db_xref="GOA:Q0HZX2"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZX2"
FT                   /protein_id="ABI41333.1"
FT                   /translation="MARVTVEDAVEQIGNRFDMILVAARRARQIAVQGKDPMVEEMNDK
FT                   PTVIALREIELGLVNAHTLDADERQSVREREAAEIAAVAAIAEGRSL"
FT   gene            complement(364731..365405)
FT                   /locus_tag="Shewmr7_0330"
FT   CDS_pept        complement(364731..365405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0330"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: son:SO0361 guanylate kinase; PFAM: guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41334"
FT                   /db_xref="GOA:Q0HZX1"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZX1"
FT                   /protein_id="ABI41334.1"
FT                   /translation="MLGFLGPSCVNQLDILLMTARGNLFIVSAPSGAGKSSLISALLKD
FT                   KPADMQVSVSHTTRAPRPGEVNGQHYHFVNVEEFKALIEQNAFFEWAEVFGNYYGTSRH
FT                   VIEHTLTQGIDVFLDIDWQGAQQVKAVMPEAIGVFILPPSRDELERRLTGRGQDSQEVI
FT                   ASRMAQAVSEMSHYKEYDFIIVNDDFDTALADLRAIIRSQRLTGASQIHAQNDMLNDLL
FT                   AG"
FT   gene            365727..367223
FT                   /locus_tag="Shewmr7_0331"
FT   CDS_pept        365727..367223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41335"
FT                   /db_xref="GOA:Q0HZX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZX0"
FT                   /protein_id="ABI41335.1"
FT                   /translation="MLLKSLFCLHGRDSRPRFVAISVGVYLSISLAVAAFGANFLMYLL
FT                   ALVGLPLLALTALRRLNDAAKPKALVAVFILPLLILLALYIVAAPPVVAILGLVLGAGA
FT                   TFWGTRLTSPTLVEYRLGYYGPALDTPTSQAIPRRRVEPVLTPKAAAAQSADVSHAAPD
FT                   IPVSTEAEAYSHTEPTSASTVVDADLDALRQDELRFDALTKMTQNPADFVVQDALLEGH
FT                   ADFRPANQSRVEQTRIDIADVDLAQVDLQGAEFKRAPLDPAEHSDEPVWRFDPDEDTAA
FT                   FNDTEHAEEVRRRRAEAKESGSMTELFRGVAEFFAPYRRFIKLPSLPKLERRYWLPVGG
FT                   GVGAVLLVLLVWGLWPNSDESQAEEAAPVVPSAPIAASDRVTLDMPDGFSVALEQDVLI
FT                   IRWLGERGKPQQLWSIATAKGDKSCSALVFNNGTEYRTISVDLLADSATEARFTPLDTA
FT                   SIITDLARRGSIGLCGYKFSLKGSQAVLEPNRNFGNYLAR"
FT   sig_peptide     365727..365840
FT                   /locus_tag="Shewmr7_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.621 at
FT                   residue 38"
FT   gene            367369..368250
FT                   /locus_tag="Shewmr7_0332"
FT   CDS_pept        367369..368250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41336"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW9"
FT                   /protein_id="ABI41336.1"
FT                   /translation="MNTDLTLVIMAAGLGSRFGGDKQLASLGPAGEPMLVLSIQSAIRS
FT                   GFKRAVLVIRPELEAELHELLICFLPADFEYHFCYQSLTDLPAEAQLADLSHRLKPWGT
FT                   AHALWCARDCVSGPMAVINADDFYGDSAFISLAKGLTARPHDWMMVAYPIELTLSEHGG
FT                   VNRGLCQVEQGLLRSVAEWLNIQAQDHGFIGEGPEGLAPLPSQSLVSMTCWGFSPSIFD
FT                   VIKHQLTEFIEQQGQLPKSECYLPAVVQAGIEQGVPVFVDVASEPWLGVTYPQDTVWVK
FT                   QKLMELLSDKTH"
FT   gene            368234..369298
FT                   /locus_tag="Shewmr7_0333"
FT   CDS_pept        368234..369298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0333"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   son:SO0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41337"
FT                   /db_xref="GOA:Q0HZW8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW8"
FT                   /protein_id="ABI41337.1"
FT                   /translation="MIKLIRQSVLPHFGIEADEAKISALGNGHINDTLLVRWPSGELVL
FT                   QRINTQVFKTPQALVSNADKISHHLCAKALQQQYGLQVVSPCLTQEGELAIDLGEQGFW
FT                   RAISYLPHSLSIEVVKSEAEAEMAAKAFGHFACALSDFDATQLEDVIPQFHHLPGRMEI
FT                   LRQAVQQDKAKRLDLCRNWVDYALSQQSLLDELAEISPQLPLRICHNDTKINNMLFDKR
FT                   DMSSMAIIDLDTCMKGHLMYDFGDMVRTFCSPEAEDSTALDNVKVRQSIFAAICRGYLS
FT                   ELGEVLTEVEKRSLWLGARVICLMIGVRFLTDYLNGDVYFHVHREGHNLDRAANQFTLY
FT                   QSLLDQEAELKACF"
FT   gene            369416..370840
FT                   /locus_tag="Shewmr7_0334"
FT   CDS_pept        369416..370840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0334"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: major facilitator superfamily MFS_1; KEGG: son:SO0365
FT                   hypothetical permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41338"
FT                   /db_xref="GOA:Q0HZW7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW7"
FT                   /protein_id="ABI41338.1"
FT                   /translation="MGTLEAPTALTCSRRSARNLWLRCTLRRSQQEAVASSMMTATSDN
FT                   FFNAYAIFLGASLAQMGFVTGLPQLFGAMSQLVSVWLASHFSRRSFIVYCAALQALVVL
FT                   GMGALAAFRPEHAVWIFIALAVGYHGFINLIQPHWRAWMGSIVPERRRGAFFAARTRLT
FT                   MGASLSVFFVGGGILTLTDSLQMAWLGFTLLFSIAAMGRFVSAWLLLQMHDPDPREARQ
FT                   RGVFIQTIRNFRGAWKDKTFRQYSLFVASMQAMVAISAPFFAVYMLEDLKFSYIEFVLA
FT                   SVASIATQFVTLKFWGRFSDQFGNRLVMIITSCMIPSLPLLWLFSDNYLYILLIQAFSG
FT                   LAWSGFTLSTANYLYDIRPFRSDFATYAALQASLSAGLVFVGAMVGGTIASHAADFLVW
FT                   SGWNTWLSSPIFVVFLVSTILRAFVTLWFIPRSVEPKVRPRPQLLQLIFRIRGFNAISG
FT                   VSLDWLTVVKRRNTPD"
FT   gene            complement(370860..371723)
FT                   /locus_tag="Shewmr7_0335"
FT   CDS_pept        complement(370860..371723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41339"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW6"
FT                   /protein_id="ABI41339.1"
FT                   /translation="MPDNATIATLPDSQGHNYRADVQLNQLQCDSTKPNDIRPSLLAPN
FT                   ATKPNATKPSAIKPNAIKPNAIKHESVIAKQKQKVIFIGLPRTGTTSVSVALLEQGLKV
FT                   AHMAFTKEAFMQADAISDAPCFSDFKQLDELFPKAKFVYLDRELESWVPSMQMLLSRML
FT                   PHLDVQTGRFHPIMKRSFRHSFGVGLVENPQDEQHLIDCYLRHKQSVFDYFAGRDDFLS
FT                   LDVSQQGALGQLLAFIGLASAEDQQNFPKLNVGRNVASWDEYKHPNKISANTSGPEKRK
FT                   FLDYKL"
FT   gene            372028..373143
FT                   /locus_tag="Shewmr7_0336"
FT   CDS_pept        372028..373143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0336"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: son:SO0367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41340"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW5"
FT                   /protein_id="ABI41340.1"
FT                   /translation="MWIWQQADWPKFHWNASSIDALLRQVYFNQGQLLGKQMLSHDDSQ
FT                   LTSAAALDTLLANIIHSSAIEGEKLNAASVRSSLAKKLGVSEDKPYPTTAQTDGLADIM
FT                   LDALKNLDTELTLERILGWHKQLFPRGYTLFNPVIGGALRGDTPMQVVSGRIDKPTVHF
FT                   EALSRATLDAELSQFIEWFNASRQDLGLDPLIRAAITHLWFVTLHPLDDGNGRITRLLT
FT                   DLALAQAEKRSIRFYAMSVSILARRQAYYDILESTQRGNVDITPWLVWFFETLNDCLLN
FT                   AMADVNKTLLKTQYWQNVDQSLLSQEQAKVLNRMLDGDFELGMNSSQYQKVAKVSRATA
FT                   TRHLAQMVEQGFLVKADAGGRSTRYLLPNGQ"
FT   gene            373304..373534
FT                   /locus_tag="Shewmr7_0337"
FT   CDS_pept        373304..373534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0337"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   reu:Reut_A0999 helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41341"
FT                   /db_xref="GOA:Q0HZW4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW4"
FT                   /protein_id="ABI41341.1"
FT                   /translation="MEDHLLTSFGTHLKSLRLERSFSQEQLALKADMDRTYVSGIERGQ
FT                   RNVSLINIFKLAKALDIPAKQLLDFTVEGSL"
FT   gene            373531..375486
FT                   /locus_tag="Shewmr7_0338"
FT   CDS_pept        373531..375486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_3690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41342"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW3"
FT                   /protein_id="ABI41342.1"
FT                   /translation="MTQRAFYSASFKDFLSAEPDVITGQISRFHTQHLLHSQTRAWVTE
FT                   IEVLKRSLAESIEREGHIFIEFMIPRMGRRADVVIIFKGIVFVVEFKVGAKVFTAADMR
FT                   QTHGYALDLKNFHRGSHDKYLVPLLVATKAMSQSRNPEFADDNVASTLCISPSELFSRM
FT                   RQIAERLNQAPFDPNLWADSGYLPTPTIIEAAQALYAQHKVEDIARSEADTQNLGQTSQ
FT                   QLLQLIHDARINKRKIICFVTGVPGAGKTLVGLNIASIHANREENEYSVFLSGNGPLVA
FT                   VLQEALARDRSSRTGDSIRATRKETESFIQNIHRFRDEYLHGGVPPEKVAIFDEAQRAW
FT                   DKEQASDFMRRKRGIVDFDKSEPEFLIEVMDRRQDWAFIIALVGGGQEINKGEAGLAGW
FT                   LDALKAKFLDWDVYFSTALLSGEYVSLGVDLNAVSRANVLPNLHLATSMRSFRAEKLSS
FT                   FIHYLVAGQCGLAVSIYKDLEHVYPIKVTRDIAKAKAWVNLHKRANESMGLLASSNGIR
FT                   LKAEGIFVKNEIDPAKWFLSGAEDIRSAEFLEDVATEFDVQGLELDWCVVAWDADYRFN
FT                   AQAFEHWQFVGTKWQKRSQLVRQKYLENAYRVLLTRARQGMVIFVPKGDKSDETRDPNF
FT                   YDHTYKYLIDCGIGVV"
FT   gene            complement(375522..375998)
FT                   /locus_tag="Shewmr7_0339"
FT   CDS_pept        complement(375522..375998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41343"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW2"
FT                   /protein_id="ABI41343.1"
FT                   /translation="MNQESLFEDLPEVDSGKYEASMLSNQKFCDQVEQSLVALGFREAQ
FT                   GVPSQNEFLKSAPYTDMYGGIRKAAFLVQHQTLGAVRIEAHKQEQSGSVDQKFPFFLES
FT                   LRLAPEHNLVILLGGKGYKQKAFDWIKTAARNIQDKQIKVFSDLDEFISFFVSK"
FT   gene            complement(376102..376998)
FT                   /locus_tag="Shewmr7_0340"
FT   CDS_pept        complement(376102..376998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0340"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0369 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41344"
FT                   /db_xref="GOA:Q0HZW1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW1"
FT                   /protein_id="ABI41344.1"
FT                   /translation="MDHFSALPIFVTVVECGSFSAAGQKLGLSKSAISKRITQLEQHLG
FT                   IQLLQRTTRSLSLTDAGARYFEYIRPAVQLTQEGLDAISELQQTPKGNLRISVPMVFGR
FT                   LYIAPLIAEFLKRYPDIQLQMQMDDKTTDLIAGGFDLAIRIGELPDSSLIARKIAPCFS
FT                   VICASPAYLAQHGSPMVPSKLTQHNCLFYSYFQDGVEWSFQSPDGMQRIQPKGNYQVNN
FT                   SDAIHRACLDGLGIANLPRFIVESDLQAGRLQTILTDFPLPEHGIYAVYPQRKYLPTKV
FT                   TVLIEFLMEKLASGKFG"
FT   gene            377357..378073
FT                   /locus_tag="Shewmr7_0341"
FT   CDS_pept        377357..378073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0341"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: son:SO0372 HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1 protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41345"
FT                   /db_xref="GOA:Q0HZW0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZW0"
FT                   /protein_id="ABI41345.1"
FT                   /translation="MSSLTPNHAAALPYTWVLFDADETLFYFDAFEGLKRMFAGFGVDF
FT                   TRADFEEYQSVNKPLWVAYQDGKISAAELQTIRFEPWAAKLALTPQTLNSAFLTAMAEI
FT                   CAPLPGARELLAALQGKAKMGIITNGFTELQTVRLERTGLQHHFDILVISEKVGMAKPD
FT                   IGIFEHALELMGQPAREQVLMVGDNPHSDIQGGINAGFHTCWYNVHGHAAPAGIRPHFQ
FT                   VASHHELQQKLMPLLG"
FT   gene            complement(378375..381578)
FT                   /locus_tag="Shewmr7_0342"
FT   CDS_pept        complement(378375..381578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpf:lpl0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41346"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV9"
FT                   /protein_id="ABI41346.1"
FT                   /translation="MSYQAKFTGWDSLTIEDLLVAYRKAKADCFFENTFPTAIKFAEYE
FT                   QDLLANLNELLTQLKSDAGFEDNEALLGNFRLLPKKLSSDKKSDTTENGHVHFSKPERA
FT                   VESLFNNYDIVPEFRIVGDFPVETHIISALWINMIGRQFDAKLDYSCYGARLKRIRNDE
FT                   LFTDGDEKPFHISSIGSFVPYFQPYQKWRSDGLKAIRDELEKDRDIIAVSLDLKCYYHF
FT                   IDPLAISGKGLLETLELKLTDEEEAFTEQLSKFLSNWAEEASEFGKTVGGKKAKINGGL
FT                   VIGLTCSRIISNALLYKWDRLVLEKLSPVHYGRYVDDMFLVLRDTGTISNSLDLMNLIQ
FT                   ARMGEDIISQNAANKKVWEINQGANIQGHSKITLQSDKQKLFILQGRAGLDLLDSIENE
FT                   IYELSSEHRLMPSPDQLEHSTAAKVLSAAGSVGENADTLRKADGLTIRRLGWSLQLRHV
FT                   ETLARDLPPNQWKEQREEFYQFAHNHVLRADNLFAHFNYLPRLLGFAISMNEWEQAEQI
FT                   AVKSYRAIDTLASEVGKGKKVRINGCDAKVLKDLWGYIKGTLTWLFIDAATRYHDPSKL
FT                   FLGERSSKKKRLADLFLNQIVITLTDFEALLDLRFDVTDFEKKAPLVAAADLAKEAYKY
FT                   ILNSPSAEKLAGKRDAKKENRILKLLGNSELLDVEVFEQFINSTRKTRLSMVTKGQKIN
FT                   DSYLPYLFPTRPLSPAEISELAPECVGLSSASGKLPIYGPAVTWAKYTQVLRGVWIKPT
FT                   LLAAEQDANDNKSKKRKKYLRIGTDSKEKVVVALTNIRTEDTDWAATACNKPNLSRKRY
FT                   QKISKLVNDALKLSPKPDYVIFPELSIPLRWLNSIASRLSAAGISLIAGTEYRHTDGKK
FT                   ILSEAALVLADNRLGYPTFVKIWQPKLEPAVGEDKELTVKYGKEWDTLEKAPKPIYIHN
FT                   GFNFGVMVCSELQNSKARIRFQGAVDALMVLSWNRDLDTFSSLIESAALDVHAYTILVN
FT                   NRKYGDSRVRSPAKESFLRDIARLRGGDNDFVVAATLDIGALRAFQSRAKRWPEEGDKF
FT                   KPVPEGFRILRDRRKLPPK"
FT   gene            complement(381575..383341)
FT                   /locus_tag="Shewmr7_0343"
FT   CDS_pept        complement(381575..383341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41347"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV8"
FT                   /protein_id="ABI41347.1"
FT                   /translation="MTISQIEIRNIKGISNECFKTQLKAYKPNLLVAPNGFGKSSIATA
FT                   FSSMSTKRIELVENDHHRGDETLVPELSITVDGQKLSADRTKNEIRQQFDVLVINSGLT
FT                   PKAKKLFKGAVSSTIEVKPITICKIPAKADFSYKPADARANFGQNGKILPNIADLLKDP
FT                   RLLDAIKDVDLTKFTQVRIQTAVHAIADKVNKQNGSTAVISQWILDNCINELRAVALLN
FT                   GISEHLIQSGTVATEVEGFFAAYQIASLHAADPKTFSAAIDWLYYVTVKAQYQDLLANF
FT                   KSSTWQWAKVEEIKKKKELVICFPKAHQLSNGQRDIITLVIQLHKTLYEGSKKPLILVI
FT                   DEVFDYLDDANLVAFQYYVTSILEAYKARNQVIYPIILTHLDPGVFFDFCFNKHKIQIN
FT                   YLSSKPVGKSRDILRLVEFRDSEQYEDMEQPVRDYLDRYWFHFHPETHAITDEWPNFLP
FT                   KDWSNSDLFKSYVNSELDRYLNNKNYDSVAICFAIRLAIEHLVYCLLPNTDSQERFISE
FT                   HGTSNKLDIASGVGIDIPESYFLLGLIYNTNLHWNQGRDYVSPLVSKLSHPTIRQLIEQ
FT                   VAAAADNQRKQS"
FT   gene            complement(383365..383573)
FT                   /pseudo
FT                   /locus_tag="Shewmr7_0344"
FT   gene            384590..385012
FT                   /locus_tag="Shewmr7_0345"
FT   CDS_pept        384590..385012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41348"
FT                   /db_xref="GOA:Q0HZV7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV7"
FT                   /protein_id="ABI41348.1"
FT                   /translation="MVLVCSHTHLNVLTFTCESFRKGLMMKHLSNIFFMLVFVIGLAAY
FT                   GNTSFAWFLLCLPLVVWFWHVLGWCVRFPRLMAFAWFVLLCFQWPAAIGLSASVIIVLM
FT                   FKLRHSIALERAAKHRQQRRCLLGSYDYDFRTFSDD"
FT   gene            385664..387325
FT                   /locus_tag="Shewmr7_0346"
FT   CDS_pept        385664..387325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0346"
FT                   /product="Superfamily II helicase and inactivated
FT                   derivatives-like protein"
FT                   /note="KEGG: stm:STM2745 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41349"
FT                   /db_xref="GOA:Q0HZV6"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV6"
FT                   /protein_id="ABI41349.1"
FT                   /translation="MGFNLTETHLECLEKEERQVVGGWIKVIARTRKQSKKHGFGALIQ
FT                   WRNMDGVLLQDIVFNRVLHGDQSRLIRDVLIDSGYWLEPYPQSWSRLQRYLLQEILKAP
FT                   AGICVDSTGWHDSVYVTQDWCVGTNSEPYHYAGQLNESMLKRAGTLSQWQSQVGALCVG
FT                   NPLMIFVVGVALSAPLLHPAAVENGIFHLVGPSSTGKTSLLELAASVYSDRSFVRSWIS
FT                   TANGLAAVAAEQHDMMLGLDEIGLARPEDVDIATYHIVAGTSKLRATESGGLAKPSHWR
FT                   TLALSTGEVWLSEVFESLGKRPKAGQQIRLVEIPVFGQFGAFDVLHRFQRPQLFVDHVK
FT                   SQTSRYYGSLFPEWMNLLTSTYELAHYTKSEIQRLVDQWRTSSMSSQVIRVLQRFALVA
FT                   TALALASRNYLVPWDEEESIDSVKHVLGQWLAARGHVMNTEEHQVLARLKVLLPKWEKA
FT                   LSPMGQQNTASLLGYSRDVNGERQWLIDKSQFLRQLEMPGQYMREVMPLLQRGWLTTNE
FT                   PERATLKLMVNGRSRRFFALLPDRIFAGIQELEIDD"
FT   gene            387382..387627
FT                   /locus_tag="Shewmr7_0347"
FT   CDS_pept        387382..387627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0347"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   sdn:Sden_0315 prophage CP4-57 regulatory"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41350"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV5"
FT                   /protein_id="ABI41350.1"
FT                   /translation="MSEQTFVLPSEEVRTQVLSQSGQCERLVREPDRKMITGVSRTQWW
FT                   MMERQGLVPQRVRLSAHCVAWRLSDLLWWIEQRKAA"
FT   gene            complement(387665..388579)
FT                   /locus_tag="Shewmr7_0348"
FT   CDS_pept        complement(387665..388579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr4338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41351"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV4"
FT                   /protein_id="ABI41351.1"
FT                   /translation="MNRQSHYYRQVQLLLRIIPFVAQHDCFALKGGTAINLFVRDFPRL
FT                   SVDIDLVFLPMMERNEALQTIKSNLDTLASTITANIDNTRVVRSFLDKSDALRLLVERD
FT                   NVQIKIELSPVLRGTVYDPQVMPVSRAVEDEFGFAEMPVVNFADLYAGKICAALDRQHP
FT                   RDLFDVKQLLDNEGLTDELRKALLVYIISHPRPIAELLRPNFKDISGVYEGEFRNMADQ
FT                   DIPQAELEATRGHLVKIINSSLTPQERSFLLSFKNRTPDWALLELSGIDQLPAVRWKMQ
FT                   NLAKMTPEKHSEAYNRLQQILTI"
FT   gene            complement(388584..389369)
FT                   /locus_tag="Shewmr7_0349"
FT   CDS_pept        complement(388584..389369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypm:YP1154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41352"
FT                   /db_xref="InterPro:IPR021561"
FT                   /db_xref="InterPro:IPR033455"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV3"
FT                   /protein_id="ABI41352.1"
FT                   /translation="MRAVMLNTEARQQLQKLLPLDMIATKSWLETQGLNLHFLDNAVRS
FT                   QTLIPVAAGVYTRQEARLSWKGIVASLQRMADVPVHVGGLTALELEGLGHYLSKGNKPK
FT                   VHLYSAKMLPRWLARIDAPAQFEWHGTRRLWPETLMQDNQFLRQDSWQASLPPLHYSCP
FT                   EKAILELLAIVPNTISFEHADQLMQGLHNLSPRKLNALLKACSSIKAKRLFLWLAGRHQ
FT                   HAWLKHLTPEQYALGTGKRLIAKGGKLEPTWQITVPKDM"
FT   gene            complement(389473..390756)
FT                   /locus_tag="Shewmr7_0350"
FT   CDS_pept        complement(389473..390756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0350"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   sdn:Sden_0317 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41353"
FT                   /db_xref="GOA:Q0HZV2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV2"
FT                   /protein_id="ABI41353.1"
FT                   /translation="MGILHDKTVKKLIKEKSSVRHSDGDGLYLMTPKRGDAYWMLRYTT
FT                   PTTKLRREYTIGKVDDWSLADARDEAAKLRLAIKREGVDPVQERKKVNQNPFKTLNDLY
FT                   ADYHQLRQRQIATHEKEKSLYEREVAWRIGKVELDKIRPLDISEILRDIANGYGDKPPR
FT                   PTISNDVMRMLKRIFDHGIKLDVTRFNPASPFRPKDAGGEEQAANDPMTETEVVEFFTK
FT                   LRAIPAQFSRENYLACALLIATCTRKMELLAAPWHEFDLPNRVWHLPKNRTKKRRAIDI
FT                   PLSDAALLWLEELKIRSCGSEWVFPARRISKKARTPHVCENTLNHALKKLFEQNFFSFE
FT                   KRRLHDLRGTARTRMGKMNIPDNIAQRCLNQIPGNRTDGIYNKDAYFEERKVAHNMLGE
FT                   WLAPIVNGDEANKIVNFDMVFKSQFSRQ"
FT   gene            complement(390942..391805)
FT                   /locus_tag="Shewmr7_0351"
FT   CDS_pept        complement(390942..391805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM: YicC
FT                   N-terminal domain protein; domain of unknown function
FT                   DUF1732; KEGG: son:SO4257 conserved hypothetical protein
FT                   TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41354"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZV1"
FT                   /protein_id="ABI41354.1"
FT                   /translation="MIQSMTAYARIEHKAQWGTASWEIRSVNQRYLETYLRLPEQFRSF
FT                   EPVLRDRLRKRLSRGKVEVNLRYELADNSNNELKLNQGLAKQLLDAASWLKQEAGQGEV
FT                   NLTDILRWPGVLSSAEQDMDTIGADLMTAFDLAIDQFIEARGREGAAIKDMLLSRLDGV
FT                   SEQIAIVREHMPKVMEYQRDKLINRLAEIKGELDPARIEQEMILLAQKQDVAEEMDRLE
FT                   AHVTEARRILKKGGSEGRRLDFMMQEFNRESNTLASKSISTEITAAAVELKVLIEQMRE
FT                   QIQNVE"
FT   gene            392019..392732
FT                   /locus_tag="Shewmr7_0352"
FT   CDS_pept        392019..392732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0352"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: son:SO4256 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41355"
FT                   /db_xref="GOA:Q0HZV0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZV0"
FT                   /protein_id="ABI41355.1"
FT                   /translation="MRPSNRTPAQTRPITITRQFTAHAEGSVLVEFGETKVLCTASFTE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMDREAARGKQSGRTQEIQRLIGRALRACVDM
FT                   KALGENTIVIDCDVIQADGGTRTASITGACVALVDALNWARGKGIIKSNPLKFLIAAVS
FT                   VGIYNGEAISDLEYVEDSAAETDMNVVMTETGKIIEIQGTAEGEPFSHEELIELLGLAK
FT                   NSIREIVDVQKAALN"
FT   gene            392829..393476
FT                   /locus_tag="Shewmr7_0353"
FT   CDS_pept        392829..393476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0353"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: son:SO4255 orotate phosphoribosyltransferase;
FT                   TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41356"
FT                   /db_xref="GOA:Q0HZU9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZU9"
FT                   /protein_id="ABI41356.1"
FT                   /translation="MKAYQREFIEFALERQVLRFGEFTLKSGRISPYFFNAGLFNTGRD
FT                   LARLGRFYAAALVDSGIEYDLLFGPAYKGIPIATTTAVALCEHHDIDVPYCFNRKEKKD
FT                   HGEGGSLVGSELKGRVMLVDDVITAGTAIRESMEIIEAHQAQLAGVLIALDRQEKGKGE
FT                   LSAIQEVERDFGCGIVAIIKLADLISYLSEKPGMEAQLAAVSQYREQYGIEA"
FT   gene            complement(393571..394221)
FT                   /locus_tag="Shewmr7_0354"
FT   CDS_pept        complement(393571..394221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0354"
FT                   /product="GTP cyclohydrolase"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: son:SO4254 GTP cyclohydrolase I; TIGRFAM: GTP
FT                   cyclohydrolase I; PFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41357"
FT                   /db_xref="GOA:Q0HZU8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZU8"
FT                   /protein_id="ABI41357.1"
FT                   /translation="MALSEAAVKVQAALHERGLETPMLPNVFTPEERKDKIEFHMKEIL
FT                   TLMSLDLSDDSLADTPRRIAKMYVDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISL
FT                   TSTCEHHLVTIDGTATIAYIPRKKIIGLSKINRIVRFFSQRPQVQERLTQQVLVALQTL
FT                   LETKDVAVKMDAVHYCVKSRGVMDSTSSTTTTALGGIFKSNPATRAEFLNQSK"
FT   gene            complement(394461..396449)
FT                   /locus_tag="Shewmr7_0355"
FT   CDS_pept        complement(394461..396449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0355"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; dienelactone hydrolase; KEGG:
FT                   son:SO4252 prolyl oligopeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41358"
FT                   /db_xref="GOA:Q0HZU7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZU7"
FT                   /protein_id="ABI41358.1"
FT                   /translation="MKSLPFAALAVICLPIMPFSTFAAETSATNALSQSQLFSRGNEYS
FT                   NVKISPTGKYLSAITSVEGKNVLLVLDAQTKKLLNAIRFPSNAQVGTYEWANSERIVLA
FT                   KEYLKGWTDVPQYYGELMAVNADGSRKAYLFGYNSGEQQTGSNIKKNTPMRATAFILDP
FT                   LPDDERYMLVNAIPWNNESNLNFELLQDVYRVDLFNGTRKRITGSPIGQARFMTDHEGE
FT                   VRFVAGEDGKNITKVFYRKDGEWVNTDKLNLGLSDFKPISFADNKNSIYAAGRVGNETL
FT                   GVYRINLETGDKAEIIQDEVVDPSNFWINGTNKQLYAVEFENGYPSYAFVDNNDNHAKL
FT                   LKDLLAALPGHQVQIVSETRNGEQLVVIAFNDRNPGDYYLFDTKKLKLEYLAAARKWLD
FT                   PEKMAEVKPISFTNRDGQKIHGYLTLPFGKEAKNLPLVVNPHGGPHGVRDWWGFDSQNQ
FT                   LLAQNGMAVLQVNFRGSGGYGERFEQAGYQKWGSDIQHDIIDATQYVIDQGFADKERVC
FT                   IAGGSFGGYSALQSAVLAPDMFKCAVGFAGVYDLELMFDEGDVARTRSGTSYLKDVLGQ
FT                   DKATLKAMSPSENVAKLKANLLLVHGGDDERAPIEQLESLEKALKAHNYPYQKLVMDNE
FT                   GHGFYDDSHRAKYYDQMLSFLKTNLKL"
FT   sig_peptide     complement(396378..396449)
FT                   /locus_tag="Shewmr7_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(396585..397178)
FT                   /locus_tag="Shewmr7_0356"
FT   CDS_pept        complement(396585..397178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0356"
FT                   /product="cell division inhibitor SlmA"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO4251
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41359"
FT                   /db_xref="GOA:Q0HZU6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZU6"
FT                   /protein_id="ABI41359.1"
FT                   /translation="MAVSPKINRREHILQCLAQMLETSPGQRITTAKLASEVGVSEAAL
FT                   YRHFPSKARMFEGLIEFIEESLLSRINIIMDDEKDTMRRCQLVLQLLLIFAERNPGISR
FT                   VLNGDALLGENERLRSRISTLFAKIETQLKQILREKTLREGKGFNLDEAILANLLLAFA
FT                   EGRIAQFVRSEFKLKPTQHFDEQWRFIQHQLLQS"
FT   gene            complement(397208..397666)
FT                   /locus_tag="Shewmr7_0357"
FT   CDS_pept        complement(397208..397666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0357"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: son:SO4250 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41360"
FT                   /db_xref="GOA:Q0HZU5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZU5"
FT                   /protein_id="ABI41360.1"
FT                   /translation="MKTPIELKILDSRIGSEFPLPAYATLGSAGMDLRAMIDTTMTIAP
FT                   GETQLIPTGIAIHVADPGLAAVLLPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNR
FT                   SDIPFTLEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK"
FT   gene            complement(397667..398884)
FT                   /locus_tag="Shewmr7_0358"
FT   CDS_pept        complement(397667..398884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0358"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="6.3.2.5"
FT                   /EC_number="4.1.1.36"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein; KEGG: son:SO4249 DNA/pantothenate
FT                   metabolism flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41361"
FT                   /db_xref="GOA:Q0HZU4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZU4"
FT                   /protein_id="ABI41361.1"
FT                   /translation="MMSVSLITKNVLLGIGGGIAAYKSADLVRRLKERGFDVRVVMSQS
FT                   AMEFITPLTLQALSGHPVASSLLDPAAEAAMGHIELARWADLVIIAPATANLLARINAG
FT                   MADELITTTCLATEAPIALCPAMNQQMYRNAATQANLASLQGRGYTLWGPASGSQACGE
FT                   VGPGRMLEPLEIAELATDFFATKDVSSQPLAGQSVLITAGPTREAIDPVRYISNHSSGK
FT                   MGFALAKAAADMGAAVTLVAGPVNLATPEGVTRINVESAQNMLDAVIDNVDKKDIFIGC
FT                   AAVADYRVSDIADCKIKKSAEEMQLALVRNPDILATVASLANRPFMVGFAAETHDVETY
FT                   ARDKLKRKNLNMIAANDVSVAGLGFNADANALRVFWPQGSQDLPATDKLTLARQLLSLI
FT                   VKEKTK"
FT   gene            399006..399683
FT                   /locus_tag="Shewmr7_0359"
FT   CDS_pept        399006..399683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0359"
FT                   /product="DNA repair protein RadC"
FT                   /note="TIGRFAM: DNA repair protein RadC; PFAM: DNA repair
FT                   protein RadC; KEGG: son:SO4248 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41362"
FT                   /db_xref="GOA:Q0HZU3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZU3"
FT                   /protein_id="ABI41362.1"
FT                   /translation="MAIKDWPEGEGPRDKLLVKGAAHLSDAELLAVLLRNGLSGLNAVD
FT                   LARSLIHEFGGLRSLLCAPKHQVCRLPGVGPVKYAQLQAAAELARRVAQENLQRGQVLT
FT                   NPDLTRDYLMRQLADRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLE
FT                   KKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMVVGDREIVSFAERG
FT                   WIN"
FT   gene            399806..400042
FT                   /locus_tag="Shewmr7_0360"
FT   CDS_pept        399806..400042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0360"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="TIGRFAM: ribosomal protein L28; PFAM: ribosomal
FT                   protein L28; KEGG: son:SO4247 ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41363"
FT                   /db_xref="GOA:Q0HZU2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZU2"
FT                   /protein_id="ABI41363.1"
FT                   /translation="MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEEEKR
FT                   FVQLRVSTKGIRLIDKKGIEVVVAELRARGEKV"
FT   gene            400049..400222
FT                   /locus_tag="Shewmr7_0361"
FT   CDS_pept        400049..400222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0361"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: son:SO4246 ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41364"
FT                   /db_xref="GOA:Q0HZU1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZU1"
FT                   /protein_id="ABI41364.1"
FT                   /translation="MAKAKGNREKIKLVSTAKTGHFYTTEKNKRNMPEKMEIKKFDPVI
FT                   RQHVIYKEAKIK"
FT   gene            400527..401864
FT                   /locus_tag="Shewmr7_0362"
FT   CDS_pept        400527..401864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0362"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: amino-acid N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase;
FT                   aspartate/glutamate/uridylate kinase; KEGG: son:SO4245
FT                   amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41365"
FT                   /db_xref="GOA:Q0HZU0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZU0"
FT                   /protein_id="ABI41365.1"
FT                   /translation="MRCKQRVRTTELVDGFRHSAPYVNAHRGKTFVVMLGGEALAQNQF
FT                   RGILNDVALLHSLGIKVVLVYGARPQIDAALAANGIEPAYHEGVRITDEDSLKVIKQVA
FT                   GALQFDITARLSMSLSNTPMQGAQINLVSGNFVIAQPLGVDNGIDFCLSGKVRRIDTQG
FT                   LKRQLDNHCIVLMGPIAASVTGESFNLTAEEIATQVAIKLKADKMIGFSSQNGILDRNG
FT                   DVIAELMPNDAQNILTKLAEQGSACIGTMAFLKASIDACRNGVPRCHLVSYLDDGALLQ
FT                   ELFSREGIGTQIVTESAERLRRASISDIGGVLNLIRPLEEQGILVRRSREQLEIEIEQF
FT                   MLIERDGLVIGCAALYPFEEDNAGEFACLVVHPDYRDADRGSLLLKNIIGQARNRGYSR
FT                   LFALTTRSIHWFLEHGFVIEDVEALPQKKKQLYNYQRRSKILALDL"
FT   gene            401968..402486
FT                   /locus_tag="Shewmr7_0363"
FT   CDS_pept        401968..402486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41366"
FT                   /db_xref="GOA:Q0HZT9"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZT9"
FT                   /protein_id="ABI41366.1"
FT                   /translation="MVTQFFSLAPLTQTSILSFIILLLGLAGVLWMLWVKPMPKVAKSA
FT                   SLGILLVMIGGFSWVFYQSHNAEIALTDTELKLDIPFYRVQLARSELLVEQARLIDLKQ
FT                   EVDLAPSFKTNGIGMPGFQLGWFNLKGKGKAFVAVTDKSELVLVPTTRGYNLLLSVPEG
FT                   ERFISQLQK"
FT   gene            complement(402549..403433)
FT                   /locus_tag="Shewmr7_0364"
FT   CDS_pept        complement(402549..403433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0364"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6, transmembrane;
FT                   KEGG: son:SO4243 rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41367"
FT                   /db_xref="GOA:Q0HZT8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZT8"
FT                   /protein_id="ABI41367.1"
FT                   /translation="MPDNEYRKGILLAVSAYCMWGFAPLYFKLLHHVSATEILLHRVIW
FT                   SFVFMVIIMLFIGGFGKLRQLFKQPKQLLVLTITSLLIAANWLIFIWAVNNDHMLDASL
FT                   GYFINPLLNVLLGMLFLGERLRKLQWFAVALASAGVLIQLVSFGSIPIVSLALAGTFGV
FT                   YALLRKKVNVDAKSGLLVETAILLPVALVYLVATLDSATANMLTNDWHLNLLLMAAGIV
FT                   TTIPLLCFAGAAVRIPLSMLGFFQYIGPSIMFILAVTLFNEPFDAEKSITFGFIWSALL
FT                   VFTFDMAYKRKTA"
FT   gene            complement(403650..404114)
FT                   /locus_tag="Shewmr7_0365"
FT   CDS_pept        complement(403650..404114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0365"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: son:SO4242
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41368"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZT7"
FT                   /protein_id="ABI41368.1"
FT                   /translation="MINPIQAEVLKRVAEVFDQHVPFHNLLGLDIKRYDIDGVEVVINM
FT                   KPELIGNIHQQILHGGVTATVLDVVGGLTAFAGLVASRDDWTVEELQQRLQTLGTIDMR
FT                   VDYLRPGRGQFFTGTGSVIRAGNRVSVCRMELHNEQGTHIAFGTGTYMVG"
FT   gene            404391..406214
FT                   /locus_tag="Shewmr7_0366"
FT   CDS_pept        404391..406214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0366"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; KEGG: son:SO4241 ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41369"
FT                   /db_xref="GOA:Q0HZT6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZT6"
FT                   /protein_id="ABI41369.1"
FT                   /translation="METQLLDIHDDPLSQRLAQVFGYRDFRDGQREVIERVCSGEDCLV
FT                   IMPTGGGKSLCYQLPALLMPGITIVVSPLISLMKDQVDSLLQTGVNAAYLNSSQPREQS
FT                   LEVLRQLHRGELKLLYVSPERLLTADFIERMRSLPLSMFAIDEAHCISQWGHDFRPEYA
FT                   ALGQLKQLFPLVPMMALTATADQATRQNICERLGINPFKLLSSFDRPNIRYTVAEKLNA
FT                   ANQLRQFLLQQNGSSGIVYCSSRRRVDEVAERLTLQGFHAKAYHAGMTPQERGEVQDSF
FT                   LKDQIDIVVATVAFGMGINKSNVRFVVHYDIPKSIEAYYQETGRAGRDGLEAEAFMLFD
FT                   PADIGRVRHLIEQSEPGPQQQVDFHKLNTMAAFAEAQTCRRQVLLHYFDESALEPCGNC
FT                   DICLDPPKRYNGTEDAQKVLSCIYRLGQRFGINHLIEVLRGSKGAAIVDRGHDKLSTWG
FT                   IGKDKSHEYWLSVIRQLIHLGLASQDITRGSSITLNPSARPILKGDVALMLAEPRIQLT
FT                   NIKRKVTQSRTPLNYDRKLFARLKALRRTIAEEQDVPPYLVFNDATLAEMAAMMPTSPG
FT                   EMLAVNGVGERKLSRFGDDFLDEIAAYLAGE"
FT   gene            complement(406196..407974)
FT                   /locus_tag="Shewmr7_0367"
FT   CDS_pept        complement(406196..407974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0367"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   son:SO4240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41370"
FT                   /db_xref="GOA:Q0HZT5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZT5"
FT                   /protein_id="ABI41370.1"
FT                   /translation="MDFRVLALSLLLWLCPLWVSANDQLDALTEQVYQYPTKAFAQITA
FT                   LEKQQTTDNSSDIDRLRLSMLKCQSLLQLGENEAAINLAQMGEASAKQLKLDQARPYFL
FT                   NCQADANLNYDNIQEALPLLDSAITLARRYQQPQALIDALRLRGQLDTNTDNFSSAIED
FT                   LRIAIDIYPDITSQTQNWVWPPQAYVYAAMGNLLHATNDFPQAMYYTRLALKSEDAKGK
FT                   VRHVLLRNAARIALDNGERDYSDQLEKQAKTLLPEIGSPLELAYSYAILASIALDKGKI
FT                   DTAEEYISIAMNTFKQQNQRVAMMRSTRLLAQVRFAQHRDDAALTLMDSAIEQAEVLRQ
FT                   YSDLKWFYGILSDYYQTHGNYKLAYEFVQKRFDAAEQANESMNNTRILQFKARLNQQGL
FT                   QQLNDDEQHHNVSLLSELNVDWAYSTLFLVAMGLLGGAIWYLIDKQNNRAPTSDTSSSE
FT                   LPPLEQLELTLHSAKQGAYPLSLLLFNASQIRQVDLPPLLDKLQDKLREQDTLLCYSID
FT                   DIVIVLPYTSAVGAQKVVSQITPTIQMWQGTHKVNIGIAVMQQFDTLDSLVKRASINQL
FT                   GKLKVSDPQSDYSPAK"
FT   sig_peptide     complement(407909..407974)
FT                   /locus_tag="Shewmr7_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.945 at
FT                   residue 22"
FT   gene            408471..410039
FT                   /locus_tag="Shewmr7_0368"
FT   CDS_pept        408471..410039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0368"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: son:SO4236 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41371"
FT                   /db_xref="GOA:Q0HZT4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZT4"
FT                   /protein_id="ABI41371.1"
FT                   /translation="MSNRVIIFDTTLRDGEQALAASLSVKEKLQIAMALERLGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALSRALEKDIDAAAQALSVAEQFRIHTFISTST
FT                   IHVESKLKRSFEQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRMVEAAIHAGA
FT                   RTINIPDTVGYTVPSEFGGIIQTLFNRVPNIDQAIISVHCHDDLGMSVANSITAVQHGA
FT                   RQIECTMNGIGERAGNCSLEEIAMILATRKNLLGVETGINAKEIHRTSNLVSQLCNMPI
FT                   QSNKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESIGLNRNNLNMTSRSGRHVIKHR
FT                   MEEMGYSEQNYNLDALYEQFLHLADKKGQVFDYDLEALAFMEAQAAEDNFYQLQQLVVQ
FT                   SDSTEGVATATVRIDVGGEIKTEAATGNGPVDAAYNAIARATDRRIDIISYKLSAKGEG
FT                   QNALGQVDITAVYHEQNFHGVGLATDVVEASARALVHVMNLTCRADKVADYKQNMHKNR
FT                   ELGGV"
FT   gene            410091..411185
FT                   /locus_tag="Shewmr7_0369"
FT   CDS_pept        410091..411185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0369"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: son:SO4235 3-isopropylmalate dehydrogenase;
FT                   TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41372"
FT                   /db_xref="GOA:Q0HZT3"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZT3"
FT                   /protein_id="ABI41372.1"
FT                   /translation="MSYQIAVLAGDGIGPEVMAEARKVLKAVEARFGLNIEYTEYDVGG
FT                   IAIDNHGCPLPEATLKGCEAADAILFGSVGGPKWEKLPPNEQPERGALLPLRGHFELFC
FT                   NLRPAKLHDGLEHMSPLRSDISARGFDVLCVRELTGGIYFGKPKGRQGEGESEEAFDTM
FT                   RYSRREIARIARIAFEAARGRRKKVTSVDKANVLACSVLWRQVVEEVAVDFPDVELEHI
FT                   YIDNATMQLLRRPDEFDVMLCSNLFGDILSDEIAMLTGSMGLLSSASMNSTGFGLFEPA
FT                   GGSAPDIAGKGIANPIAQILSAALMLRHSLKQEEAASAIERAVSKALNSGYLTGELLSS
FT                   DQRHKAKSTVEMGDFIADAVKAGV"
FT   gene            411185..412609
FT                   /locus_tag="Shewmr7_0370"
FT   CDS_pept        411185..412609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0370"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   son:SO4234 3-isopropylmalate dehydratase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41373"
FT                   /db_xref="GOA:Q0HZT2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZT2"
FT                   /protein_id="ABI41373.1"
FT                   /translation="MTTPSTSTTPKTLYQKVWDAHVVATPEGEAPIIYVDRHLVHEVTS
FT                   PQAFSGLKVAGRKLRAPEKTFATMDHNTSTRSASLDALSPMARTQVETLAQNCKDFGVR
FT                   LYDIHHPNQGIVHVMGPELGITLPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVLAT
FT                   QTLRQLKAKTMKIEVRGQVTDGVTAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSME
FT                   GRMTVCNMAIEMGAKAGMVAPDQTTFDYLEGREFAPKGEDWAEAVAAWKALKTDVGAEF
FT                   DATVVLDAADIAPQLTWGTNPGQVVAIDAPVPNPADEANPTIRASMEKALDYIGLTAGT
FT                   PMTDVAINKVFIGSCTNSRIEDLRSAAKQAKGRKVASGVTAIVVPGSGQVKAQAEAEGL
FT                   DKIFIEAGFEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRTHLVSPAMA
FT                   AAAAIAGHFVDIRKPY"
FT   gene            412634..413239
FT                   /locus_tag="Shewmr7_0371"
FT   CDS_pept        412634..413239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0371"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: son:SO4233 3-isopropylmalate dehydratase,
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41374"
FT                   /db_xref="GOA:Q0HZT1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZT1"
FT                   /protein_id="ABI41374.1"
FT                   /translation="MQPFTSHTGLAVMIDSANIDTDQIIPKQFLSKVTRDGFGVHLFHD
FT                   WRYLDDAGDVPNPDFTLNKPRYRGASILLAQENFGCGSSREHAPWALADFGLRAIIAPS
FT                   FADIFYGNSINNGLLPVKLSANEVRQLMDEVASEEGAQITVDLTTCKVISPSGAEFSFT
FT                   LAESARHKLLNGLDAIGLTLSHGTQIGEYEANIPSWRR"
FT   gene            413767..415113
FT                   /locus_tag="Shewmr7_0372"
FT   CDS_pept        413767..415113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0372"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: sdn:Sden_0340 membrane
FT                   protein involved in aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41375"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZT0"
FT                   /protein_id="ABI41375.1"
FT                   /translation="MQKRLLTLAVTAALLSTTTQVHAAGFQLAEYSATGLGRAFAGEAA
FT                   IADNASVQGRNPAMLTYLEGRQLSAGGIYVMPNVDVKGDVSLSSPLLGPNPIVMNGDAI
FT                   DVADDALVPNFYYSNQLNDQWTWGLAVNSNYGLSTELPKTHAAAIFGNKTAVTTVEFNP
FT                   NIAYRVNDAVSVGGGVRIVYGEGEIGASLPGWVDSIKPGLPAQVSAMLPPGGTELKSMK
FT                   GDDIGYGWQLGTSWQINPANRVGLAYHSGVKFELDGHASGVIYDGGQNLSIEGYIPLEL
FT                   PAFAELSSYHQLTDNWAVHASVNWTDWSVFDQLVAYFPGEVKPKGSLESDLVKEENFED
FT                   NWRFALGTTYQVNNEWLVRAGVALDKTAAADEWRTTTIPDSDRLWFSVGAGYQATKNLN
FT                   VDFALTYIRATGDAPINEQQNLLNLATVSFNGEASGDVWLAGIQMSYKM"
FT   sig_peptide     413767..413838
FT                   /locus_tag="Shewmr7_0372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            415302..416786
FT                   /locus_tag="Shewmr7_0373"
FT   CDS_pept        415302..416786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0373"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: son:SO4230 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41376"
FT                   /db_xref="GOA:Q0HZS9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZS9"
FT                   /protein_id="ABI41376.1"
FT                   /translation="MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWV
FT                   EHDPMEIWASQSSVLIESLARAGIHSDEVAAIGITNQRETTIIWEKATGKPVYNAIVWQ
FT                   CRRSSEICEQLKAQGLEDYVRENTGLLLDPYFSGTKIKWILDNVPDARAKAKRGELLFG
FT                   TVDTWLLWKLTEGKVHVTDPTNAARTLLFNIHSLSWDTTLLEALDIPAAMLPEVRPSCS
FT                   VYGTTRIAGEGSEIPLAGIAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGNKAVRS
FT                   SHGLLTTVAVGAQGEVNYALEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNG
FT                   VYLVPAFVGLGAPYWDPNARGALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSG
FT                   ERLKSLKVDGGAVANDFLMQFQADITDVEVLRPSVCETTALGAAFLAGLAVGFWTSVTE
FT                   LEYKACIDKHFKPNIDASQRERLYVDWQDAVARTRS"
FT   gene            complement(416857..417177)
FT                   /locus_tag="Shewmr7_0374"
FT   CDS_pept        complement(416857..417177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZS8"
FT                   /protein_id="ABI41377.1"
FT                   /translation="MSGLDSLYAMLAQPTKPVFTPKRVVDQVSGATANAPDSHETPQSQ
FT                   LPPTLDVKVRERRKNNNVSRNKKRRASDKQQDLKEGVLLEVTDDTADTAQPPSKHIIDI
FT                   EV"
FT   gene            complement(417274..418353)
FT                   /locus_tag="Shewmr7_0375"
FT   CDS_pept        complement(417274..418353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0375"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: sdn:Sden_0344 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41378"
FT                   /db_xref="GOA:Q0HZS7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZS7"
FT                   /protein_id="ABI41378.1"
FT                   /translation="MSFSNKLNTSTADSRRPIGLILQTLHKWLGLIVGLQLLIWIVTGL
FT                   AFNLIDEQFLDANQYRTTHQTASPTTAPAPAANLLQQYQAEGIIELTLTSVLERAVYTL
FT                   ITAQQTRWFWADSLQPLSLNDAEILAIAKQSYSGSGELSAPQILTHETPFDASGPVAML
FT                   IAADEVGTRIYIDTASGTVLAHQNSQSDLKDLLFMLHFMDYAPDNGIGFNHLLVQLVSI
FT                   AALLLGLSGIYILGHKFHQGQLSLPFLRRKTAIGKLVLFTQDAQLLAEFTELSGTYLES
FT                   INQGRERLRTQCGGGGRCGLCKLRFVEQPPAPNDYDLDKLTATELEQGIRLSCQHEASP
FT                   RKLALVTKAQHRYWPQLER"
FT   gene            complement(418350..419057)
FT                   /locus_tag="Shewmr7_0376"
FT   CDS_pept        complement(418350..419057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0376"
FT                   /product="PepSY-associated TM helix"
FT                   /note="KEGG: sdn:Sden_0345 PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41379"
FT                   /db_xref="GOA:Q0HZS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZS6"
FT                   /protein_id="ABI41379.1"
FT                   /translation="MKATQIRTCHKWFALITAIQLLLWLATGAYMVWMDIEFIRGKPLV
FT                   SKVNTAIYQVKVPAYSFADFIETHPDATEISLYAYQGALYYRANVAGKLQRFSSETGEL
FT                   LPLLDKQQALDAAQRVYTGQAKFIDSTLIEQNAPSEIPTRALPVWQLALDDAMHSTLYV
FT                   SAVTGQLVSARHDYWRLFDVMWMLHIMDYETRENVNNPLLTLMSSLALLTALFGIALTY
FT                   ISFRSTPSHEEQI"
FT   gene            419575..420033
FT                   /locus_tag="Shewmr7_0377"
FT   CDS_pept        419575..420033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0377"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: son:SO4228 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41380"
FT                   /db_xref="GOA:Q0HZS5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZS5"
FT                   /protein_id="ABI41380.1"
FT                   /translation="MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACL
FT                   LLYPLHEWELIEAKLLKLSDTDKTQRSLKRMLLGYAHEVELDGNGRILLPPPLRQYANL
FT                   DKRIMLVGQLNKFELWDEQAWLQQIDECQETIRSEELANNERLADFSL"
FT   gene            420064..421005
FT                   /locus_tag="Shewmr7_0378"
FT   CDS_pept        420064..421005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0378"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: son:SO4227 putative S-adenosyl
FT                   methionine adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41381"
FT                   /db_xref="GOA:Q0HZS4"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZS4"
FT                   /protein_id="ABI41381.1"
FT                   /translation="MSQEFAHLSVLLEETVGGLNIKDDGIYIDGTFGRGGHSRQILQRL
FT                   GENGRLIAIDRDPQAIEAAKQFADDPRFQIVHGGFGQLADYVEELGLVGKIDGVLLDLG
FT                   VSSPQLDDAERGFSFLRDGPLDMRMDNSQGETAAQWLARAEIEDMAWVFKTYGEEKNAR
FT                   HIARCIAADRDKTPFLRTKDLADLIARITKNKERNKHPATRVFQAIRIYINSELDQIDQ
FT                   ALEGALTVLAPQGRLSIISFHSLEDRIVKRFIRRHSQGESVPHGLPITEDQINKSRKLR
FT                   AIGKAIMPSDEEIERNARARSSVLRIAERLDY"
FT   gene            421018..421332
FT                   /locus_tag="Shewmr7_0379"
FT   CDS_pept        421018..421332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0379"
FT                   /product="cell division protein FtsL"
FT                   /note="TIGRFAM: cell division protein FtsL; PFAM: cell
FT                   division protein FtsL; KEGG: son:SO4226 cell division
FT                   protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41382"
FT                   /db_xref="GOA:Q0HZS3"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZS3"
FT                   /protein_id="ABI41382.1"
FT                   /translation="MSKPSLNLPRIVLNDLWQHKWILLLALLVLGNAVAVVYTSHVSRK
FT                   LTTQWDQLLQERDRLDIEWRNLLLEEQSQTEHSRITRIASKDLNMSRPLPSEEVVVKVP
FT                   "
FT   sig_peptide     421018..421125
FT                   /locus_tag="Shewmr7_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.925 at
FT                   residue 36"
FT   gene            421346..423097
FT                   /locus_tag="Shewmr7_0380"
FT   CDS_pept        421346..423097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0380"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   son:SO4225 peptidoglycan synthetase FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41383"
FT                   /db_xref="GOA:Q0HZS2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZS2"
FT                   /protein_id="ABI41383.1"
FT                   /translation="MTRQAKTKQASKKQKPQLIHWRLYVVVGFVFAMFSCLVGRAAYIQ
FT                   IIEPDKLRHESDMRTLRTTSREVQRGLITDRNGDMLAVSVPVRAVWADPKQVNDNNGFT
FT                   DMRRWQALADVLHEPVEDVLEKVRSNPTKRFTYLKRQVTPAVADYITQLKLPGVFLKSE
FT                   SRRYYPGGEITAQLIGITNIDDVGIEGVENAYNSWLTGTPSKQKVRKSRDGHVVERLDI
FT                   VQEGESPNDLVLSIDQRIQQLAYRELKRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSY
FT                   NPNSRDNLQTFRMRNRAMTDTFEPGSTIKPFVVAAALEAGTVKSTDVIPTSPGWMRLGG
FT                   RQVRDATNYGDMTLARILAKSSNVGISKLALSIPVQQLLGTYQSMGLGSFSGINLTGES
FT                   AGLIQDRHRWSDFERATLSFGYGLTATTLQLARMYATLGNGGTLYPVSILKLKKPPEGE
FT                   RVISQEVAHDVLQMMVGVTEKGGTGTLAHIDGYPVAGKSGTSRKAVAGGYGDDYVALFA
FT                   GVAPVNNPKLAIVVVVNEPKGDLYYGGSVAGPAFAKVMSGALQMLNVEPISDKEQVQLA
FT                   GLAGRTE"
FT   sig_peptide     421346..421471
FT                   /locus_tag="Shewmr7_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.715 at
FT                   residue 42"
FT   gene            423094..424575
FT                   /locus_tag="Shewmr7_0381"
FT   CDS_pept        423094..424575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0381"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: son:SO4224
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41384"
FT                   /db_xref="GOA:Q0HZS1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZS1"
FT                   /protein_id="ABI41384.1"
FT                   /translation="MMLLRDLLAPWFPYAGEQTFLDLTLDSRAIRRGDVFLALPGHKVD
FT                   GRQFIDKALAQGVTAVLVHTDSIEEQGKVITTEQGVQIYFYQLAKQVSAVAAVRYPVVQ
FT                   GQSMGIVGITGTNGKTSTSQLCAQLVTLLEGKAAVMGTLGNGLWGELVDSGNTTADAIT
FT                   LMRQLHEFAGKGVNTCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMENYAA
FT                   AKQMLFRFDALRHGLVNLDDPVGAAWLSELANVPAKMWGFSIEAHTEAAFYTKNAQFND
FT                   QGVQATLVWPEGEIDIRSPLLGAFNLSNLLAALSALYLQGVDMRALAAKVPYLVPVAGR
FT                   MERFTTADNITLVVDYAHTPDAIEQALNALRRHCAGELWCVFGCGGDRDKGKRPLMGQA
FT                   AEQCADRIMVTSDNARSEDPNQIITDIIQGLTHPERALTEVDRVAAIKRVVAQAKPGDV
FT                   ILLAGKGHETYQEAAGVRHDYDERALARQLSEQSQ"
FT   gene            424572..425954
FT                   /locus_tag="Shewmr7_0382"
FT   CDS_pept        424572..425954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0382"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: son:SO4223
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41385"
FT                   /db_xref="GOA:Q0HZS0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZS0"
FT                   /protein_id="ABI41385.1"
FT                   /translation="MIPISLEALSQHLSAHRVGDDITIQALSSDSRKIGPATLFVALKG
FT                   ERFDGHDFAATAIENGAVALLVERELAFDVPQLIVADCQKAMGAIGAYVRDQVDPICVA
FT                   LTGSNGKTSVKEMIATILSAKHQVLYTAGNFNNEIGVPLTLLRLTPEDKYGVFELGANH
FT                   KGEIDYTSSLVRPHVALVNNVGSAHLEGFGSQAGVAQAKSEIYNHLQSGGTAIINADDA
FT                   FADVMRVKAKQYKQLSFSQQEGAAKRQIDVIATGHKANSEGCYRFILNYAGESCEVTLP
FT                   LAGRHQVSNALAAASVCIALGLSLKEIAEGLSQLTPVKGRMQPTQLGRVRLIDDSYNAN
FT                   PVSVGAAIAWLKEISENRCLVLGDLGELGDNAPLLHAELGQLAKQQGIDALFCTGTLTQ
FT                   HTSQAFGAEHHDSVATLVEKLIKHINQLPGQVTVLVKGSRSAAMERVVDGLTVAFGRGE
FT                   LV"
FT   gene            425955..427037
FT                   /locus_tag="Shewmr7_0383"
FT   CDS_pept        425955..427037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0383"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: son:SO4222
FT                   phospho-N-acetylmuramoyl-pentapeptide- transferase;
FT                   TIGRFAM: phospho-N-acetylmuramoyl-pentapeptide-transferase;
FT                   PFAM: glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41386"
FT                   /db_xref="GOA:Q0HZR9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZR9"
FT                   /protein_id="ABI41386.1"
FT                   /translation="MLVYLAEYLTRFHTGFNVFSYVTFRAILGLLTALMFSLWWGPKLI
FT                   ERLQLMQIGQVVRNDGPESHFSKRGTPTMGGLMILGAIFISVLLWGDLGSRYVWVMLFV
FT                   LGSFGMIGFIDDYRKVVRKDTKGLIARWKYILQSLAALIIAFFLYTTASNPGETQLVVP
FT                   FFKDVMPQLGAVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHA
FT                   QFANYLHIPHLPGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGAIA
FT                   VLVRQEILLVIMGGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISIFLVLLGLATLKLR"
FT   gene            427044..428363
FT                   /locus_tag="Shewmr7_0384"
FT   CDS_pept        427044..428363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0384"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   son:SO4221 UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41387"
FT                   /db_xref="GOA:Q0HZR8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZR8"
FT                   /protein_id="ABI41387.1"
FT                   /translation="MQSQYSHIVLGLGATGLSVVRYLCGKGITPLVMDSRRQPPGADTL
FT                   ASAFPEVQLIAGGFDCRYLVQAKQIIISPGIAIDTPEVRAALDMGIEVIGDVELFAREI
FT                   ADRKPCVLGITGSNGKSTVTTLVGEMLREAGMAVAVGGNIGIPALDLLTENADIFVLEL
FT                   SSFQLETTHSLNCVASTCLNVTEDHMDRYSDMDAYRKAKLRLYHQSRSIIFNRDDALTI
FT                   PTEPMNQNSFGLAPPEGDEWGICDSKIYHGHSEIMPITEVSLIGSHNHANLLAAMALVY
FT                   AVGVDKQVMAKVARTFTGLSHRCEVVGVKAGVTYVNDSKATNVGATVAALDGLSDHLGD
FT                   IILIAGGDGKGADFSPLVEPLTKVTHLITLGRDGNKVAALKEGAIKVDSMAAAVAKAAE
FT                   LATSGDIVLLSPACASLDMYSNFMARGDDFRSQVEQLDGE"
FT   gene            428353..429564
FT                   /locus_tag="Shewmr7_0385"
FT   CDS_pept        428353..429564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0385"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: son:SO4220 cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41388"
FT                   /db_xref="GOA:Q0HZR7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZR7"
FT                   /protein_id="ABI41388.1"
FT                   /translation="MASDARQLSLFGRVLNALPNWQRDNEVPGVQLYDRALLTAVLSLI
FT                   GFGFVMVMSASMPEAQTLTGNPFHFMTRHVGYLLGCLVIAAFVLRVEMQTWQRMSPIML
FT                   LGVFLMLLAVLVVGTTVNGATRWLSIGPIRIQVAEVAKFAFSVYMAGYLVRRHQEVREN
FT                   AKGFYKPIAVFAIYAILILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALIFAGVLAF
FT                   VALVLLEPYRMRRVTSFLDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLEYLP
FT                   EAHTDFIFAVIGEELGFIGIIAVLSVLLFVALRAIRLGNLCLAMDKAFEGYLAYAIGIW
FT                   ICFQTVVNVGASIGMLPTKGLTLPFVSYGGSSLWVMTAAAMTLLRIDYERRMSLVQAVQ
FT                   GRLK"
FT   gene            429564..430652
FT                   /locus_tag="Shewmr7_0386"
FT   CDS_pept        429564..430652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0386"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: son:SO4219
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41389"
FT                   /db_xref="GOA:Q0HZR6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZR6"
FT                   /protein_id="ABI41389.1"
FT                   /translation="MTDAGKRILVMAGGTGGHVFPALAVAKYLAQQGWQVRWLGTADRM
FT                   EARLVPQYGFDIDFIDIKGVRGNGLVRKLAAPFKVVRSILQAKAVIAEFKPDVVLGMGG
FT                   FASGPGGVAAKLAGVPLVLHEQNAIPGMTNKLLSRIANQVLCAFKNTFTQVKAKVVGNP
FT                   IRRELIALGAEPKQAADDALKVLVVGGSLGAKVFNDLMPEVVAALSKQQSITVWHQVGK
FT                   DNLTGVKSAYQQQGQEGGVNVAEFIDDMEAAYRWADVVLCRAGALTVSELAAVGLPSIL
FT                   VPYPHAVDDHQTRNAQVLVEAGAAFLLPQAILDVNKLVSKLQLLANDRAELAQMGQRAR
FT                   DVAVLDATEQVAQVCIALAEKG"
FT   sig_peptide     429564..429638
FT                   /locus_tag="Shewmr7_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.855 at
FT                   residue 25"
FT   gene            430655..432121
FT                   /locus_tag="Shewmr7_0387"
FT   CDS_pept        430655..432121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0387"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: son:SO4218
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41390"
FT                   /db_xref="GOA:Q0HZR5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZR5"
FT                   /protein_id="ABI41390.1"
FT                   /translation="MTKTERYLQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEGY
FT                   VVSGSDIAQNAVTDRLCLLGAKIHIGHGADNVQQADVVVVSTAINPENPEIIAAKELRI
FT                   PIVRRAEMLAELMRYRHGVAIAGTHGKTTTTSLIASLYGQAGRDPTFVIGGLLNSAGTN
FT                   ARLGTSRYLIAEADESDASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDFLHNL
FT                   PFYGVAVVCIDDAVVREIMPRIGRHMITYGFSDDADVQALNFHQQGHQCRFTVRRKGKE
FT                   DLDLLLNLPGQHNVLNALAAIAVATEDEIDDSAIIQALAEFQGIGRRFQHLGKFATPKG
FT                   EVMLVDDYGHHPSEVAATIKAARAGWPDKRLVMAYQPHRYTRTRDLYEDFIEVLSQVDC
FT                   LLLLEVYSAGEAPIPGADGRALCRSIRLRGQLDPIFIASPDQLAEVLPDVLQEGDLLLT
FT                   QGAGNIGALSRQLAASELGFSTAATTEVKP"
FT   gene            432273..433022
FT                   /locus_tag="Shewmr7_0388"
FT   CDS_pept        432273..433022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0388"
FT                   /product="Polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein, FtsQ-type;
FT                   KEGG: son:SO4217 cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41391"
FT                   /db_xref="GOA:Q0HZR4"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZR4"
FT                   /protein_id="ABI41391.1"
FT                   /translation="MSQVNWYLWSGIGFLWLVIGSFVFGGYQLHKFLNDASTLPIEAVA
FT                   IKGERTYTTDRDIQIALQDLMQRSFFSADITLVQQALEALPWVYRASVRREWPAKLRVY
FT                   LQEQQPVAHWNGTAWLNVHGEVFEAPSHPELEHLPYLSGPDDMGTEVLTAYAQVNSLLK
FT                   INGFTLANLSLTPRHAWHATLGNGIVLDLGREDKMARIQRFITVYPLLAKQDKPIARVD
FT                   LRYDTGLAVGWGDAQTREPIINDQKPR"
FT   gene            433003..434238
FT                   /locus_tag="Shewmr7_0389"
FT   CDS_pept        433003..434238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0389"
FT                   /product="cell division protein FtsA"
FT                   /note="TIGRFAM: cell division protein FtsA; PFAM: cell
FT                   division protein FtsA; KEGG: son:SO4216 cell division
FT                   protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41392"
FT                   /db_xref="GOA:Q0HZR3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZR3"
FT                   /protein_id="ABI41392.1"
FT                   /translation="MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRG
FT                   MDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEV
FT                   TQEDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTC
FT                   ANDMAKNITKSVERCGLKVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYT
FT                   NGALRHCAVVPVAGNQVTNDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVG
FT                   GRPSRSMSRHTLAEVVEPRYQELFELVLKELKDSGLEDQIAAGIVLTGGTASIQGVVDI
FT                   AEATFGMPVRVASPLPVKGLYEYVDQSIYSTGVGLLHYGARRVLERQFERPERQGVTSA
FT                   WNRVQSWFKGEF"
FT   gene            434266..435453
FT                   /locus_tag="Shewmr7_0390"
FT   CDS_pept        434266..435453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0390"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   son:SO4215 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41393"
FT                   /db_xref="GOA:Q0HZR2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZR2"
FT                   /protein_id="ABI41393.1"
FT                   /translation="MFEIMDTHSDDAVIKVIGVGGGGGNAVEHMVKHNIEGVEFVVTNT
FT                   DAQALRKSGAGSTIQLGRDVTKGLGAGANPEVGRAAAEEDRENIRAAIKGSDMIFIAAG
FT                   MGGGTGTGAAPVVAQIAREEGILTVAVVTKPFPFEGKKRMAYAEQGIAELAKHVDSLIT
FT                   IPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVARGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEFETVGN
FT                   HVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKRPDIQLVSKPAPRPEPVVVE
FT                   PKVEAYVEEATHVSYAAPKGNVLPASPAPAPAPAPSTKHELDYLDIPAFLRKQAD"
FT   gene            435634..436554
FT                   /locus_tag="Shewmr7_0391"
FT   CDS_pept        435634..436554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0391"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="TIGRFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; KEGG: son:SO4214 UDP-3-O-acyl
FT                   N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41394"
FT                   /db_xref="GOA:Q0HZR1"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZR1"
FT                   /protein_id="ABI41394.1"
FT                   /translation="MIFQRTVQKMVKATGVGLHSGNKVTLSIMPAPVNTGIVLVRTDMN
FT                   PAVAIPAKAEQVRETTMCTALVNDEGIRISTIEHLFAALAGLGIDNAVIEVDAPEIPIM
FT                   DGSASPFVFLLQSAGIKEQAAPKKYLKIKRPVRVEDGDKWAELKPFKGFRVNFKIDFAH
FT                   PEIARSQQHVVMDFSTSAFVKDISRARTFGFMRDIEYLRANNLALGGSMENAVVLDEYR
FT                   VLNPDGLRYEDEFVKHKILDAFGDLYVAGHAILGEFTAYKTGHALNNQLVRALLAQQDA
FT                   WELVSFEKEADVPVSFTVPGGAVYA"
FT   gene            complement(436568..437014)
FT                   /locus_tag="Shewmr7_0392"
FT   CDS_pept        complement(436568..437014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41395"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZR0"
FT                   /protein_id="ABI41395.1"
FT                   /translation="MKKPPQDLSQLLHLSGTLPDIAEKAELLLYLDQHVKQIVAGPVAE
FT                   QLKVANFRQGVLVVETTSAAWAARINFQKPKLLAQLQAETLPILTAIEVKVNPRLALYD
FT                   AKPKQAHKQLSPAAAEHIAALAENVSGTLGEKLKRLATLASRNK"
FT   gene            437042..437941
FT                   /locus_tag="Shewmr7_0393"
FT   CDS_pept        437042..437941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0393"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: son:SO4212 peptidase,
FT                   M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41396"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZQ9"
FT                   /protein_id="ABI41396.1"
FT                   /translation="MSVTVFIQGRNGVTRWQPSKRWLLLPMLLLATGAGIYQHNSAKFE
FT                   NQQASVDNDRIQREQQKKQVLELKSATESQLAMLATHVARMQAKITRLEALGQQVAKQN
FT                   KLDEDFDFSSEVGVGGLSELGSNIELGQLIDDMDKLASRIDNNNVQLSLLETVSSNHHI
FT                   DAERYVSGLPLDKGWLSSPYGLRNDPFNGRRTMHKGIDFTGREGAKVVATAAGVVTWAG
FT                   NMFGYGELVEIDHGNGLRTRYGHNKALSVAVGDVVAKGETIASMGSTGRSTGAHVHYEV
FT                   LRGGQQIDPQKFVYRKAG"
FT   gene            438002..440728
FT                   /locus_tag="Shewmr7_0394"
FT   CDS_pept        438002..440728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0394"
FT                   /product="protein translocase subunit secA"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; KEGG: son:SO4211
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41397"
FT                   /db_xref="GOA:Q0HZQ8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZQ8"
FT                   /protein_id="ABI41397.1"
FT                   /translation="MFGKLLTKVFGSRNDRTLKGLQKVVNKINALEADYEKLTDEQLKA
FT                   KTAEFRERLAAGASLDSIMAEAFATVREASKRVFEMRHFDVQLLGGMVLDSNRIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAENNRPLFEFLGLTVGINVAGLSQ
FT                   QAKKDAYNADITYGTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSILIDEARTP
FT                   LIISGAAEDSSELYIKINTLIPNLIRQDKEDSEEYVGEGDYSIDEKAKQVHFTERGQEK
FT                   VENLLIERGMLAEGDSLYSAANISLLHHVNAALRAHTLFERDVDYIVQDGEVIIVDEHT
FT                   GRTMPGRRWSEGLHQAVEAKEGVRIQNENQTLASITFQNYFRQYEKLAGMTGTADTEAF
FT                   EFQHIYGLDTVVVPTNRPMVRKDMADLVYLTANEKYQAIIKDIKDCRERGQPVLVGTVS
FT                   IEQSELLARLMVKEKIPHQVLNAKFHEKEAEIVAQAGRTGAVTIATNMAGRGTDIVLGG
FT                   NWNMEIEALENPTAEQKAKIKADWQERHDAVVAAGGLHILGTERHESRRIDNQLRGRAG
FT                   RQGDAGSSRFYLSMEDSLMRIFASDRVSGMMKKLGMEEGEAIEHPWVSRAIENAQRKVE
FT                   ARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDAESIEDTIKNIQDDVISAVIDQYIPP
FT                   QSVEELWDVPGLEQRLQQEFMLKLPIQEWLDKEDDLHEETLRERIITSWSDAYKAKEEM
FT                   VGAPVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFQ
FT                   QLLSTLKHDVISVLSKVQVQAQSDVEEMEARRREEDAKIQRDYQHAAAEALVGGDDGSD
FT                   EMMAHTPMIRDGDKVGRNDPCPCGSGRKYKQCHGKLS"
FT   gene            441391..442925
FT                   /locus_tag="Shewmr7_R0020"
FT   rRNA            441391..442925
FT                   /locus_tag="Shewmr7_R0020"
FT                   /product="16S ribosomal RNA"
FT   gene            442997..443073
FT                   /locus_tag="Shewmr7_R0021"
FT                   /note="tRNA-Ile2"
FT   tRNA            442997..443073
FT                   /locus_tag="Shewmr7_R0021"
FT                   /product="tRNA-Ile"
FT   gene            443211..443286
FT                   /locus_tag="Shewmr7_R0022"
FT                   /note="tRNA-Ala2"
FT   tRNA            443211..443286
FT                   /locus_tag="Shewmr7_R0022"
FT                   /product="tRNA-Ala"
FT   gene            443561..446453
FT                   /locus_tag="Shewmr7_R0023"
FT   rRNA            443561..446453
FT                   /locus_tag="Shewmr7_R0023"
FT                   /product="23S ribosomal RNA"
FT   gene            446675..446790
FT                   /locus_tag="Shewmr7_R0024"
FT   rRNA            446675..446790
FT                   /locus_tag="Shewmr7_R0024"
FT                   /product="5S ribosomal RNA"
FT   gene            446824..446899
FT                   /locus_tag="Shewmr7_R0025"
FT                   /note="tRNA-Thr3"
FT   tRNA            446824..446899
FT                   /locus_tag="Shewmr7_R0025"
FT                   /product="tRNA-Thr"
FT   gene            446931..447059
FT                   /locus_tag="Shewmr7_0395"
FT   CDS_pept        446931..447059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VV2890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41398"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZQ7"
FT                   /protein_id="ABI41398.1"
FT                   /translation="MFGDNSIVVPPDPIPNSEVKRNRADGSVGSPHVRVGHRQTLN"
FT   gene            448118..449652
FT                   /locus_tag="Shewmr7_R0026"
FT   rRNA            448118..449652
FT                   /locus_tag="Shewmr7_R0026"
FT                   /product="16S ribosomal RNA"
FT   gene            449960..452852
FT                   /locus_tag="Shewmr7_R0027"
FT   rRNA            449960..452852
FT                   /locus_tag="Shewmr7_R0027"
FT                   /product="23S ribosomal RNA"
FT   gene            453074..453189
FT                   /locus_tag="Shewmr7_R0028"
FT   rRNA            453074..453189
FT                   /locus_tag="Shewmr7_R0028"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(453415..454425)
FT                   /locus_tag="Shewmr7_0396"
FT   CDS_pept        complement(453415..454425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0396"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   son:SO4208 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41399"
FT                   /db_xref="GOA:Q0HZQ6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZQ6"
FT                   /protein_id="ABI41399.1"
FT                   /translation="MNIITSAFPQRRMRRMRKHDFSRRLMAENHLTVNDLIYPMFVLEG
FT                   TNRSEKVASMPGVERYSIDLLLKEAEELVELGIPLIALFPVTPAEKKSLMAEEAYNADA
FT                   LVQRAVRELKKAFPQLGIMTDVALDPFTTHGQDGIIDETGYILNDITTEILVKQALSHA
FT                   EAGADIVAPSDMMDGRIGAIRQALEAAAHVNTQIMAYSAKYSSSYYGPFRDAVGSAGNL
FT                   KGGNKHSYQMDPANSDEALHEVALDIQEGADMVMVKPGMPYLDIVHRVKTELAVPTFAY
FT                   QVSGEYAMHMAAIQNGWLAEKAIVMESLLCFKRAGADGILTYFAKRAAQWLKEAK"
FT   gene            complement(454435..456312)
FT                   /locus_tag="Shewmr7_0397"
FT   CDS_pept        complement(454435..456312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0397"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor, extracellular
FT                   region 2; Diverse 7TM receptor, transmembrane region; KEGG:
FT                   son:SO4207 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41400"
FT                   /db_xref="GOA:Q0HZQ5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZQ5"
FT                   /protein_id="ABI41400.1"
FT                   /translation="MTKFGGLLVLLLSMFISTGSFANTMSIDERTPTPLNLTPWLMVTH
FT                   SNADSQLADIQAQPKLEWHKFTNQDIQRLNQHSFWLRVNLTTGDEHLSRILALDNPLLD
FT                   KVTLYHLVDNELINTSYMGDTLLYKERPLPSNIFLYPFKLNANEQHTFYLHIVTEGNAA
FT                   IPLSLWSANDLAQIAESTAIEHGFQLGVLAAIGIFSLFIALASGSFSYSYYSGYVLCMT
FT                   LLVATINGYAFRFLWPNWPALQQLMIPVLLPLVMAFALMFTEKILQLKYYNRRMLLICR
FT                   YSAVYILLIGLLVPFIRYGTALSIEIISVAILSIVMMVLAVIQAINGQKLAKLYTIGWV
FT                   SMLTGACLSSLLYLSVIELNIKPQTPVMFGLTFEIIFMSLVLAIRYNDERKSKLRIQQE
FT                   ALKQAQKIRSAREEALKVEAETNERLEQMVQERTLELEITLRELHEVNQKLTEQSTIDS
FT                   LTGVKNRSAFDKRLLAESRISRRQETPIALLMLDIDRFKSINDQFGHLAGDQALKVIAT
FT                   TLQQHLKRPTDLVSRFGGEEFAIILPNTTADGALQVAENIRDAVTSIGLAWEGKPIPLT
FT                   VSIGVSADVISNDQHSTELLEQADKALYQAKNSGRNQVKLYAPAQTEPT"
FT   sig_peptide     complement(456244..456312)
FT                   /locus_tag="Shewmr7_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(456305..457108)
FT                   /locus_tag="Shewmr7_0398"
FT   CDS_pept        complement(456305..457108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0398"
FT                   /product="Sec-independent protein translocase TatD"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   son:SO4206 hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41401"
FT                   /db_xref="GOA:Q0HZQ4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZQ4"
FT                   /protein_id="ABI41401.1"
FT                   /translation="MPSYIDIAVNLLGSALEPDIAQIVQAAADQGVSPLIVIGSDLTES
FT                   AAAIQLCQQYPKQLYCTAGVHPHHASEWQADSKQLQTNLCQAPQVVAVGECGLDYNRDF
FT                   SPRPAQRQAFIDQLELAVELKKPVLMHERDAHDDFLSIVKEYRPHLSGALLHCFTGTRA
FT                   QMEAYIDLDLHLGITGWVCDERRGQELAELVPFIPKERLLIETDSPYLLPRSMRPKPKS
FT                   SKNKPEYLPYIAQYIANLRGENSAEFAKQCYQNSLAFFNLSQAND"
FT   gene            complement(457108..457632)
FT                   /locus_tag="Shewmr7_0399"
FT   CDS_pept        complement(457108..457632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41402"
FT                   /db_xref="InterPro:IPR016987"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZQ3"
FT                   /protein_id="ABI41402.1"
FT                   /translation="MRFTLLTGAVLLVSAQANASIEQQLTQCAAMTDKLDRLVCYDNLA
FT                   ASIRVDTIAHNATAPTATAAPVATSVAVATVAAPTVAVATNVEDNFGMEVKRVQENTTD
FT                   KIYLDVESIAEDPYGALKITFTNGQVWKQTENRKFNLKVGEKVFIEKAALGSFLMGTES
FT                   RNAKVRVKRLK"
FT   sig_peptide     complement(457573..457632)
FT                   /locus_tag="Shewmr7_0399"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 20"
FT   gene            complement(457676..458425)
FT                   /locus_tag="Shewmr7_0400"
FT   CDS_pept        complement(457676..458425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0400"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: son:SO4204 Sec-independent periplasmic
FT                   protein translocation protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41403"
FT                   /db_xref="GOA:Q0HZQ2"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZQ2"
FT                   /protein_id="ABI41403.1"
FT                   /translation="MSQQQPLISHLLELRSKLLKSIASVLLVFICSVYWANDIYHYMAI
FT                   PLMQSLPLGGSMIATDVAAPFFAPFKLTLVLSFFVAVPYVLYQIWSFVAPGLYKHEKRL
FT                   VMPLLFSSTVLFYLGIAFAYYIVFPVVFGFFANTAPEGVQVATDISSYLDFVLKLFFAF
FT                   GLSFEIPVAVVLLCWAGVTTPEDLKQKRPYIVVGAFVVGMLLTPPDVISQTMLAVPMLL
FT                   LFEGGLFAARFYTKPDDETDEEESTND"
FT   sig_peptide     complement(458315..458425)
FT                   /locus_tag="Shewmr7_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.754 at
FT                   residue 37"
FT   gene            complement(458428..458871)
FT                   /locus_tag="Shewmr7_0401"
FT   CDS_pept        complement(458428..458871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0401"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; KEGG: son:SO4203 Sec-independent protein
FT                   translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41404"
FT                   /db_xref="GOA:Q0HZQ1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZQ1"
FT                   /protein_id="ABI41404.1"
FT                   /translation="MFDGIGFMELLLIGVLGLVVLGPERLPVAVRSVTGWIRAMKRMAN
FT                   SVKEELEQELKIEQLHADLKKAESKGLSNLSPELQESIDQLKQAAQSVNRPYQVQDIPA
FT                   QENQIHNPASQSVSSEASPTASSAPTSEPNQGEDTRSNPKANG"
FT   gene            complement(458878..459135)
FT                   /locus_tag="Shewmr7_0402"
FT   CDS_pept        complement(458878..459135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0402"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: son:SO4202 Sec-independent protein
FT                   translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41405"
FT                   /db_xref="GOA:Q0HZQ0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZQ0"
FT                   /protein_id="ABI41405.1"
FT                   /translation="MGGISIWQLLIIALIVVLLFGTKKLRSLGGDLGGAVKGFKNAMSS
FT                   EEDKKALEDAEAAKPVQTAQTAQPTQQATEKKPESNKEQA"
FT   gene            complement(459195..460844)
FT                   /locus_tag="Shewmr7_0403"
FT   CDS_pept        complement(459195..460844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0403"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: son:SO4201 ubiquinone
FT                   biosynthesis protein AarF"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41406"
FT                   /db_xref="GOA:Q0HZP9"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZP9"
FT                   /protein_id="ABI41406.1"
FT                   /translation="MTLASIRRGYHVIKTLLQYGLDDVLPPKMTPWYFKLARNSLFWIR
FT                   NKHKGKSGGERLKLAMQELGPVYIKLGQMLSTRRDLLSDEWANELAMLQDKVPPFDGAL
FT                   ARQAIEAELKAPIESFFDDFNETPLASASISQVHTATLKSNGKAVVLKVLRPNVEAKIQ
FT                   ADLLLMSQTAKVIDYLLGEGNRLRPSEVIEDYRVTILGELNLKLEALNAIKLRNNFLDS
FT                   DALYIPYVYEEFCYPRLMVMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRD
FT                   NFFHADMHPGNIFISRDHPENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIA
FT                   QLYIESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQP
FT                   QLVLLEKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSD
FT                   KLPEFPELIYDNLKLGRKLLSSQQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLLFN
FT                   QDATLWSPYVCLISGAALWIIGWRSRPKNRKF"
FT   gene            complement(460841..461461)
FT                   /locus_tag="Shewmr7_0404"
FT   CDS_pept        complement(460841..461461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0404"
FT                   /product="protein of unknown function DUF1243"
FT                   /note="PFAM: protein of unknown function DUF1243; KEGG:
FT                   son:SO4200 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41407"
FT                   /db_xref="GOA:Q0HZP8"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZP8"
FT                   /protein_id="ABI41407.1"
FT                   /translation="MMPQEVVLLACAAIETGLKQLQTQAGDAYARQRQLHGKVFRIQLS
FT                   QLSWPIYLVFAKEIQVLSRYEGDADVSLHADATTLYRVTEGANLTELIKQDKLSLEGDL
FT                   NLLQSFSHYLRSIEFDFAEPLSRYLGDGPTHKLLSTGLQAKTLAFEVLRKTRSHLGQLA
FT                   IEEYRLAPHRIELIHFRDRMDDLVDDTRALEQRIAKLRDQIKP"
FT   gene            complement(461461..462216)
FT                   /locus_tag="Shewmr7_0405"
FT   CDS_pept        complement(461461..462216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0405"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferases; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   son:SO4199 ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41408"
FT                   /db_xref="GOA:Q0HZP7"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZP7"
FT                   /protein_id="ABI41408.1"
FT                   /translation="MSEGESKNTHFGYKTVEADKKADLVAGVFHSVAAKYDIMNDVMSF
FT                   GIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVGEKGEVVLADINDSMLKVG
FT                   RTKLRDRGIVGNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMNRVLKPG
FT                   GKLLVLEFSKPQHELMRKVYDLYSFKVLPKMGEIITKDADSYEYLAESIRMHPDQETLK
FT                   QMMVDAGFEQVDYTNMTDGIVALHRGYKF"
FT   gene            complement(462458..463510)
FT                   /locus_tag="Shewmr7_0406"
FT   CDS_pept        complement(462458..463510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0406"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   son:SO4198 arginase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41409"
FT                   /db_xref="GOA:Q0HZP6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZP6"
FT                   /protein_id="ABI41409.1"
FT                   /translation="MSEFIPFTQADVASLVSPRAGETKIGQCVHLANHEHSLEAILATA
FT                   KAHGAQFAILGVGEDIGPRANLGRGGATDAFTTSMRQWLNLQSNRFLSGAECLILGQVH
FT                   TADLQLQAQDGEGASLTHLRQAVEQLDERVISIVSAIQAAGLEPIVIGGGHNNAYGLLM
FT                   ATSAHYQRQVAAVNLDPHSDFRLLEGRHSGNGFSYAADRGALGYYHVLGLHEIKNSEAN
FT                   LQQLSEFGGTWHSLQQIWVRREISLTEALQQIVNKLNHTALPVGLELDVDAIAKMPSSA
FT                   STAAGIPLLDAAHYISYIASHCPCAYLHLAEAAPSCHEAGIEAGFRDVGQSISELIYAY
FT                   VQARRQFLAQ"
FT   gene            complement(463642..464127)
FT                   /locus_tag="Shewmr7_0407"
FT   CDS_pept        complement(463642..464127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0407"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: son:SO4197
FT                   regulator of ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41410"
FT                   /db_xref="GOA:Q0HZP5"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZP5"
FT                   /protein_id="ABI41410.1"
FT                   /translation="MEYNTSELCDMYLDVVDVVEPMFSNYGGCSSFGGSISTIKCFEDN
FT                   GLITEVLQEDGQGKVLLVDGGGSLRRALIDASIAEIAVNNNWEGIIVYGSVRDVDALEE
FT                   LDIGIQALASIPVGADGNSVGEVEIPVNFGGVTFLPGDHIYADNTGIILSPEPLDIE"
FT   gene            464446..464700
FT                   /locus_tag="Shewmr7_0408"
FT   CDS_pept        464446..464700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41411"
FT                   /db_xref="GOA:Q0HZP4"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR020137"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZP4"
FT                   /protein_id="ABI41411.1"
FT                   /translation="MPMEAVNTIEIIGYFASVMVAISLMMKNIVWLRWLNFVGCTLFVI
FT                   YGVFISAWPVAGMNAFVACINIYHLTKIYRAKALEQAVA"
FT   gene            465056..465568
FT                   /locus_tag="Shewmr7_0409"
FT   CDS_pept        465056..465568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0409"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   son:SO4195 PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41412"
FT                   /db_xref="GOA:Q0HZP3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZP3"
FT                   /protein_id="ABI41412.1"
FT                   /translation="MLSYITDLDKRMFYRIVGLSQRHGVYDWAKRISATGDGHVYLYLA
FT                   VGLMLTHAQGQSLFNLLLASFLIELPLYLLLKNSIRRTRPCHALVGFEKGFEPSDRFSL
FT                   PSGHTAAAFVMATSVAQVYPMAAPLAYAWALCIGASRIALGVHYPSDIAAGALLGTGAV
FT                   LLVHPVI"
FT   gene            465642..466682
FT                   /locus_tag="Shewmr7_0410"
FT   CDS_pept        465642..466682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   son:SO4194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41413"
FT                   /db_xref="InterPro:IPR005262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZP2"
FT                   /protein_id="ABI41413.1"
FT                   /translation="MRILYGVQGTGNGHLSRARVMAKALIEHNIQVDFLFSGRKPEHFF
FT                   DMECFGEYRVQAGMTFATHSGRVNVPQTVRQNCSLSLLKDIQALDLSCYDLVLNDFEPV
FT                   SAWAARRQGVPSIGISHQAALTHPVPKLGSTWFNELLLNYFAPVDVALGCHWHHFGFPI
FT                   LPPFVEVDASPIEHTHQILVYLPFEEADAIAEFFKPFTDYQFLVYHAKQPTAPLADHIQ
FT                   WHGFNRDGFKQHLASCGGVIGNAGFELASEALTLGKKLLVKPLIGQFEQLSNVAALQLL
FT                   GAGDSMMSLDMGVVKRWLKAASPNPIAYPQVGDALVKWICSGQWQHTAPLCDDLWSQVK
FT                   LPDTWR"
FT   gene            466823..468418
FT                   /locus_tag="Shewmr7_0411"
FT   CDS_pept        466823..468418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41414"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZP1"
FT                   /protein_id="ABI41414.1"
FT                   /translation="MSLKKFTQYKLLFLMLLSLGILLPFIPDQAYHIPGPDIATQNLHV
FT                   IEFNDQGQPHNDGQWQGLKARILQPNNGTAPELLIFVHGWHHSANPTDENFVAFEQFYQ
FT                   QMSASDSQRNLLGLYIGWRGDKLDPFWLDGSEDASSWIEPLDFPTILQRKAVAKRIGQT
FT                   GLSQLLDKLDVLVAEHQLLRYTVIGHSLGGLVVLHASKDRIKAAIDNEQDNPNLFLLLN
FT                   PAAPAQDFKPLDTLMSLDRQKPSMVVLQSKGDFAVKEAFNYIKDGERALGNSWAITHDI
FT                   DKCSGGNCSTPMKMPSALMAHDQIPGCMMTLPHSGWKIRARLQARRSVQTCPDANMQAV
FT                   WVLAVSDEIVSGHNGILTPDHAKALSEVMGMIDLYRNQLPKHAVESPANEDLATLAPDS
FT                   EAASSSDTQTNTPAEPVVLVEPLPEGEQPKPQDSTDSQEAPEKQTPIEQGLPIVPPSDE
FT                   HTPPQAMDGKSNEVSGDTKQEEAETTATPPAINAESQTNAEPQINTEPQTEINTTKDTQ
FT                   PNEPTQPQSKVETE"
FT   sig_peptide     466823..466915
FT                   /locus_tag="Shewmr7_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.793 at
FT                   residue 31"
FT   gene            complement(468455..469066)
FT                   /locus_tag="Shewmr7_0412"
FT   CDS_pept        complement(468455..469066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0412"
FT                   /product="DedA family protein"
FT                   /note="KEGG: son:SO4191 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41415"
FT                   /db_xref="GOA:Q0HZP0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZP0"
FT                   /protein_id="ABI41415.1"
FT                   /translation="MPEALQHLITEMTPWLQQYGYLLLFVAIAVEGFGIPAPGQSLLIV
FT                   ASLLAATGQMSLPLVLIVACVAALSGNSLGYFIGRRFGEVLLRKGWIKPQLEDKIHSVI
FT                   GQYGIAALVLSRFVEGLKQFMFIGCGLAKMPFKQFVMGNLLATSIWVTLFGLGPVLIRD
FT                   EIAPILTFYHQHKYPTWAIVSLLLVLLLHFSWRKFQVKNQ"
FT   gene            complement(469235..470155)
FT                   /locus_tag="Shewmr7_0413"
FT   CDS_pept        complement(469235..470155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0413"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein; DHHA2
FT                   domain protein; KEGG: son:SO4190 inorganic pyrophosphatase,
FT                   manganese-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41416"
FT                   /db_xref="GOA:Q0HZN9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN9"
FT                   /protein_id="ABI41416.1"
FT                   /translation="MPMYVVGHKIPDSDSICGAIALAYLKNQIGEEAVAARLGELSPET
FT                   AFILERFGFEAPEYKTSYAGEQVYIVDHSELTQAPDDIAQATIVGIVDHHKLGDLTTDT
FT                   PLECWIRPVGCSNTVIKMMYDFHQVAIPKNIAGIMMCAILSDTVIFKSPTCTTADIRCV
FT                   EALAEIAGVEDFKALGMEMFKVKSAVEGTPARDLVMRDFKDFNMNGNLVGIGQLEVIDL
FT                   SVFDSIKAELEADIKALKVEGNRHSVLLLLTDIMKEGSELLVVSDDADLVNRAYGKTPV
FT                   DGKVWLDGVLSRKKQVVPQLQAAFA"
FT   gene            complement(470299..470760)
FT                   /locus_tag="Shewmr7_0414"
FT   CDS_pept        complement(470299..470760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0414"
FT                   /product="conserved hypothetical protein 22"
FT                   /note="PFAM: conserved hypothetical protein 22; KEGG:
FT                   son:SO4189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41417"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN8"
FT                   /protein_id="ABI41417.1"
FT                   /translation="MIVDTLANRHIYQSLSPRIATALAHLASTDFSQLPVGNYPLDGED
FT                   IFVIVNDYHTKPQSTEPFEVHQKYIDVQYVVSGEEEFGYLPLADQTPSKPYFEKHDYAE
FT                   FDYESNKANASYIQLKAGMFALFFPGDMHMPGTSDTPTAVRKVVIKVKI"
FT   gene            complement(470888..473326)
FT                   /locus_tag="Shewmr7_0415"
FT   CDS_pept        complement(470888..473326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0415"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: ilo:IL2271 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41418"
FT                   /db_xref="GOA:Q0HZN7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN7"
FT                   /protein_id="ABI41418.1"
FT                   /translation="MFSFQPKGYSTLRGFMRPAVIALAVSSTLVFPVVHAEEQASSFEK
FT                   IEVVGSRIALRTATDSVAPVDIITAEQLESTGMTETAKALQFAAPSYSFPFSSVTDGSD
FT                   AVRPASLRGLSPDHTLVLVNGKRRHGSALVHLSGTVGKGSSNVDLNAIPMTSIKRIEIL
FT                   RDGASAQYGSDAIAGVINVVLKDNDQGGSVSAQAGQTYLGDGEQWRVGVNHGISLNNDG
FT                   FVNIGVEAHHKDSTNRAGLDPRQQYPKLPDGSADPREATFNRKSHQVGDAEYDNLGLFI
FT                   NAAQPFSNDSKLYAFGGISQRETKSGAFYRRALDARNLTELYPDGFLPQINPKIIDSSL
FT                   VLGYEFTLGEWNIDTSAGYGGNSFEYNIVNTLNASLGPDSPTEFDAGTLSTSEANLNID
FT                   ASRYYNFANDSEILVATGVSWRQNGYQIEAGEPNSYINGGYDNRAAGSQGFTGFTPESE
FT                   VDETRDNTGVYVELENQLTTEFYWAAALRYENYSDFGGNTSWKLAGRYDFTDNLALRGT
FT                   VNTGFRAPSVQQLYFSNISTLFNPDPTTGQLVPTESGTFNTLSPVTKALGINELDPELS
FT                   QSFSLGLVYTNDTGLALTLDAYQISIDDRIILSSSVTPNDSPAVAAALANTNAESARFF
FT                   INAVDTRTRGVDLVVSQDFDLGNWGDLRANLAYAYNKTEIQDIHFPEILDGLGPKLFDN
FT                   IEQTRMTSATPHNTGNLGLTHELGDFKTNIRLSYFGDYTVGYSTGDVNYSDQWVMDLSV
FT                   RYAATDALSFTAGVQNLFDVYPEKRPDDNNFNGIFVYPLTNTPFGFNGGYYFLEAKYTY
FT                   "
FT   sig_peptide     complement(473216..473326)
FT                   /locus_tag="Shewmr7_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 37"
FT   gene            473588..474643
FT                   /locus_tag="Shewmr7_0416"
FT   CDS_pept        473588..474643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41419"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN6"
FT                   /protein_id="ABI41419.1"
FT                   /translation="MPALRFLAGPTAFNIIREQGLHPDAFTQLLAASGGPKWLGIAGLD
FT                   KYLFTEFFKQRNTPLYTLGASSGAWRLACLAQQDPLQAYGRLEDYYIGQRYETIPTPQE
FT                   VSEQVKGIVQGILGESGGREIVNHPFIHSHLIACRAKHINRLSHKLPLAAGLAMTAATN
FT                   LISRKTLGWHFERVVFSQQLASSPFKQLADLPSQQARLTETNMNAVMLATGSIPLVLAP
FT                   VSQIEGVATGQYYDGGITDYHFDLPLSHAMGLTLYPHFYPHMSPGWFDKSLTWRRARTN
FT                   YHNALVLAPSAEFVASLPFGKVPDREDFKQLDTAQRMQYWRRSVALSERLADEFAEVCA
FT                   KGNIAAHLVPL"
FT   gene            474788..475363
FT                   /locus_tag="Shewmr7_0417"
FT   CDS_pept        474788..475363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0417"
FT                   /product="ATP-dependent protease La (LON) domain protein,
FT                   putative"
FT                   /note="KEGG: son:SO4182 ATP-dependent protease La (LON)
FT                   domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41420"
FT                   /db_xref="GOA:Q0HZN5"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN5"
FT                   /protein_id="ABI41420.1"
FT                   /translation="MQTREMALIMRDALLLPQGRIEVRVVEPGQLRMVADVLKGKYDLA
FT                   FAAMKPNGTPPCYPTATQCDIIDFNQLEDDSLSIVLEGRQRVSILSAAQTKDKLWMSRT
FT                   LPCQNWQEEPIEGEFELISAALEQFYEVNPDLLELYSQVHLEDAAWVSQRWLEVLPMYN
FT                   RDKLVLVNQPDCHKTMDFVLQLIKSHVD"
FT   gene            475416..476342
FT                   /locus_tag="Shewmr7_0418"
FT   CDS_pept        475416..476342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0418"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: sdn:Sden_0482
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41421"
FT                   /db_xref="GOA:Q0HZN4"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN4"
FT                   /protein_id="ABI41421.1"
FT                   /translation="MTHTARAAQPSFVVLPLEVVDKPTVFSFLISHFSHIGEAVWRQRI
FT                   LDGKVHWQDGSLIGLDTAYRPTARAYYYREVPVEAQVPFESPILFQDDNLILAYKPHFL
FT                   PVTPSGEYVNECLVHRLRLSTGIDTIAPAHRLDRETAGVILMTTRPETRHIYHQLFVDD
FT                   AIRKDYQAIAKLTPEIMAQYACGELTLPLHWTVKNRMQRSEPSFTMKIVEGEANTHSEI
FT                   SLVAVKGEFGLFELSPITGKTHQLRVHMQSLGMPLLNDRFYPTLYPKGPDDFTKPLQLL
FT                   AQRLRFVDPITGNKHDVQCEHLYLKND"
FT   gene            476641..478029
FT                   /locus_tag="Shewmr7_0419"
FT   CDS_pept        476641..478029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41422"
FT                   /db_xref="InterPro:IPR040572"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN3"
FT                   /protein_id="ABI41422.1"
FT                   /translation="MTSIHSTSVASNCYLSDFVWVGSYRELSWHPEFEEFNSVEELLEQ
FT                   GRSAELIVLSLQAEEQDRCLRVLRKNDSTFLSHILVCHESALSPYLANGLWDAGYDENF
FT                   QIYQLKKQQIKLDYHDDLRYKLLTYLWCHQDAILEPHSVPEKSYLYDYPLLRCFGINPE
FT                   ESFTWLGDLQKSQLIEKAELSNRLRFCPGCHSGHLNYIDVCPQCHSIDTEQQSSLHCFN
FT                   CGHVGAQASFRKLNTLCCPNCLQNLRHIGVDYDRPIENQHCNSCQTLFVDAVVEAKCLH
FT                   CQLSSKLDDLHVRNVYSFKLAIPGRTLVRQGRSQSWFALEPGEQMTSAQFYWLLDWQNK
FT                   LAKRHHQTHSILSIQMLNVDEFLATEGEAKGFAQLDALQERLRSVIRVTDACSNYTRDG
FT                   LLMLLPMTEMSQLKSIYNKLFDLKELQSASKIELSVKALTLPADIGENVGEWLTDQLVK
FT                   AKSI"
FT   gene            478026..479354
FT                   /locus_tag="Shewmr7_0420"
FT   CDS_pept        478026..479354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0420"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; chitin
FT                   synthase; KEGG: son:SO4179 glycosyl transferase, group 2
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41423"
FT                   /db_xref="GOA:Q0HZN2"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN2"
FT                   /protein_id="ABI41423.1"
FT                   /translation="MSEFNTIGYMVLDIWHQLAEHLSFFAWLVPLILLYEAPLMLLVLT
FT                   GIMRFYYTNFVQVPRQSLYKPKVSCVITCYAEGEAVKSTIDSFIEQVYDGEIEIIAVVD
FT                   GAVQNALTYQVAMAAAKACQVPNRKVVVLPKWQRGGRVSTLNAGLSVATGEIVINADAD
FT                   TSFDNDMVSQIVPYFEDPNVPAVGGALRVRNVNESILTRMQSIEYLISMQGGKTGLGQW
FT                   NLLNNISGAFGAFRRTFLIQIGGWDTHTAEDLDLTVRIKQYFKRYPDWHIPFATLAIGH
FT                   TDAPADLKTLVLQRLRWDGDLLFLYFRKHWPAFTPKLLGTGTFIFTLLYGFLQNVLMPF
FT                   VIVFYSIGIVLSYPWQFITSISLTIYGFYFVILVFFYLMVLLAISERLSQDLRLAIWLP
FT                   LYPFYALFMRLVCLFALMNEVFRRSHEESSMAPWWVLKRGRKF"
FT   gene            479354..480409
FT                   /locus_tag="Shewmr7_0421"
FT   CDS_pept        479354..480409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41424"
FT                   /db_xref="GOA:Q0HZN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN1"
FT                   /protein_id="ABI41424.1"
FT                   /translation="MKVNYQPSDKAQRPTDDSGIGVKYAAAKRGGFKGRWYLLLALVIT
FT                   PVAVVGWILLRPHLFILASGIVTTEPLEVRAPSAGDVAAVNVKRGDVLASGTHILTLVD
FT                   AQLGAQIHELEKQLSQLELNNLSLNAEILTQLQQRIDVAAEGVTRQNGLLDSFERYQRK
FT                   GVVPTADMAAVLQAHTASKMALEQAKVDLMQARQAQKTELLAGPIAQSKYNVELQLARL
FT                   KAQESQLDIKALTPTRVVDVLVQAGEHIVEDRPLVLLSGREAAVIFAYLEPKYLEYTAI
FT                   GQEATIKLPNGTRLRGEISEPTELVGRLPKQLSGPFDGEKPVLKITLKPETALPTSIEG
FT                   VPVEVSFDYLW"
FT   gene            480615..480977
FT                   /locus_tag="Shewmr7_0422"
FT   CDS_pept        480615..480977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41425"
FT                   /db_xref="GOA:Q0HZN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZN0"
FT                   /protein_id="ABI41425.1"
FT                   /translation="MTKSAIVSILLCTAVLLGAMYFGGWTKYPYVHELTTEIRKASAVI
FT                   EPKKPSAEVTQDAGNQTDVSLQQGVWDQMLDDTSPQKRPDSQLFKQNLPNQEAAAKPAE
FT                   ASDSTTSSDAVKRNPY"
FT   sig_peptide     480615..480686
FT                   /locus_tag="Shewmr7_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.654 at
FT                   residue 24"
FT   gene            complement(480979..482826)
FT                   /locus_tag="Shewmr7_0423"
FT   CDS_pept        complement(480979..482826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41426"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM9"
FT                   /protein_id="ABI41426.1"
FT                   /translation="MLRHCDASHFTLWFVSREPLSELQLTLGEQSYSLTEEEVHSVPLG
FT                   QHAFQYLLRLSRPELLTPQVVTQYRVSAQGIDDLFNHVKKLSYGDANSPHLYFSQALTQ
FT                   VWHGSCRNPHHHSEDALVAADTKLAQLIDKGANERPALLMLSGDQVYVDDVAGPMLCAI
FT                   GQVIEKLGLHHEAFHGANIAGSEAISYQPEHLYLRHKNLLPRTEYPAKTALWRWYINHP
FT                   IFTSSIAENHLVSLNEMIALYLLTWSPELWELIDLPKEVEGLSAANQLRWQREWQNLLA
FT                   FKAGLKQVRRLMAHIPVYMMFDDHDITDDWNLTAKWEQAAYGHAFSKRIIGNALIAYTL
FT                   FQGLGNAPSQFDAEVRPLLDGFFARPAPEAQDALIDELLKFEQWHYTLDTSPKLVVLDT
FT                   RTRRWRSESNLAKPSGLMDWEALMDLQQALLGQSKVIIVSPAPMFGVKVIEAVQRMATL
FT                   MGGSLLVDAENWMAHPGAANALLSIFMHRKTPEQFVILSGDVHYSFAYDISIRFRRSSP
FT                   NIYQITCSGIKNQFPEKLLPLFDKLNGWLYGHFSPLNLFTKRKRMSLRGRRPNGERSKR
FT                   LVNRSGIGILALAEDGEPTKIAVLHGDMTETRFEPPRQE"
FT   gene            483007..483927
FT                   /locus_tag="Shewmr7_0424"
FT   CDS_pept        483007..483927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0424"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal; KEGG: son:SO4174 NAD
FT                   dependent epimerase/dehydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41427"
FT                   /db_xref="GOA:Q0HZM8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM8"
FT                   /protein_id="ABI41427.1"
FT                   /translation="MANIMVTGATGLLGRAVVKQLTAAGHRVIATGFSRAEAGIHRLDL
FT                   TQAAEVEAFIAREQPEVIVHCAAERRPDVSERSPEHALALNLSASQTLAEVAKTHQAWL
FT                   LYISTDYVFDGTTPPYAEDAEPNPVNFYGASKLQGETCVLSTDNGFAVLRLPILYGEVT
FT                   QLNESAVLVLINQLLDGRPQRVDHWAIRAPTSTADIANAIAKLIQRQLHAADVSGIYHF
FT                   SATQTMTKYQMLLSLGELLGIDSAHLLPDQTPTDSAKRPQDCTLSCGRLAALGIYSELA
FT                   FKTGLTQALSQSSTALAAVGLKFKD"
FT   gene            483931..485220
FT                   /locus_tag="Shewmr7_0425"
FT   CDS_pept        483931..485220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0425"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: son:SO4173 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41428"
FT                   /db_xref="GOA:Q0HZM7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM7"
FT                   /protein_id="ABI41428.1"
FT                   /translation="MVKILGTNLQAADQVALLRTLGLSLQIGLTLFAADTFGLSLQMEP
FT                   LVHVFVLEVLYLSLTLALRKPLFAKERGLFIALSLDTLFWISWLYFSGGATNAFISLLL
FT                   LPIALAAVTLPIWAPWSLTAISTLAYSLMIFTVPESQMHHHGMDMSSHYLGMWFNFVIS
FT                   ALVLTTSVALIAKRMRRQDAQLAYMREGQLRQEQLLALGTVSAQMAHQLATPLSTLRLL
FT                   LDELREEQPEPSITVVEMETALGRCEHTLTELRLATESIRDRRQRPQKVTELVAGLKQK
FT                   TQLLMPQTELNWLNTCAPKQLEEQQILTDMSLTPAIMALIENAARASAETLGVAQVDIS
FT                   LDSAPSEGQIYLQIRDYGAGIAPSLLPQLGTLLIESPKGLGVALLLSHASLERLGAELI
FT                   LANHPQGGTVAQIRFTLLQPNASATTAEAL"
FT   gene            485217..485768
FT                   /locus_tag="Shewmr7_0426"
FT   CDS_pept        485217..485768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0426"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix,
FT                   Fis-type; KEGG: son:SO4172 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41429"
FT                   /db_xref="GOA:Q0HZM6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM6"
FT                   /protein_id="ABI41429.1"
FT                   /translation="MKRLLIIEDDQALAGVLARRLTRHGFECRLSHDASNALLVAREFC
FT                   PTHILLDMKLAEANGLGLIVPLRNLLPKVIMVLLTGYASIATAVEAIRLGADNYLAKPV
FT                   DTQTLLAAFEVNSQASALPEDEIDDSPLTPKRLEWEHIQQVLNANQGNVSATARQLGMH
FT                   RRTLQRKLLKKPVSETGPLK"
FT   gene            485800..486276
FT                   /locus_tag="Shewmr7_0427"
FT   CDS_pept        485800..486276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM5"
FT                   /protein_id="ABI41430.1"
FT                   /translation="MREYDGIEVRYRRPDADFAKSLQVLENLLGFAPEPSQLDFDLSFW
FT                   AGGSGVLDMLAISCNVTPEQWRTLKQKLDLYSPEEMVAREDCREDFIWLVADDEECSDI
FT                   LAASAQFINDNKAPFQEACDTSQSIHFGYMSDVNTWTAVWGQGSRINYAYFCQG"
FT   gene            complement(486417..487127)
FT                   /locus_tag="Shewmr7_0428"
FT   CDS_pept        complement(486417..487127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0428"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   son:SO4170 C factor cell-cell signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41431"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM4"
FT                   /protein_id="ABI41431.1"
FT                   /translation="MNILVLGGSGGIGHAMVNKLREIYPEATIHTTYKHHRPDTGRDDG
FT                   VIWHQLDITLEEEIKQLSQNIPQLDWLINCIGMLHTEDKGPEKSLQALDGDFLQHNIQL
FT                   NTLPSMMLAKHFETALKRSVSVRFAVVSAKVGSISDNRLGGWYSYRASKAALNMFLKTL
FT                   SIEWQRSMKHCVVLALHPGTTDTRLSKPFQQNVPKEKLFTPEYVAQCLVSIIANATPAQ
FT                   TGSFLAYDGAELPW"
FT   gene            complement(487153..488730)
FT                   /locus_tag="Shewmr7_0429"
FT   CDS_pept        complement(487153..488730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0429"
FT                   /product="deoxyribodipyrimidine photolyase-related protein"
FT                   /note="PFAM: deoxyribodipyrimidine photolyase-related
FT                   protein; KEGG: son:SO4169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41432"
FT                   /db_xref="GOA:Q0HZM3"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM3"
FT                   /protein_id="ABI41432.1"
FT                   /translation="MQLRQQSQQQLQHFHTVRLILGDQLNAQHSWYQQVDPKVLYLIAE
FT                   LHQENTYVTHHVQKICAFFSAMAQFASELGAAGHQVRYLTLDDTHDFVDLNALLQHYVA
FT                   QTGAIKFEYQRPDEYRLLAQLSQLKLANAVVNCVDTEHFLFPFDAIDREFPQGQHRLME
FT                   HFYRRMRKRFNILMTDGKPVGGQWNFDANNRQKLKSQDIKSLPTPLMFGHNVEDILERL
FT                   TRHGINTMGKADTRLLWPINRVQSLELLQYFCEYCLPAFGRFQDAMTQQHPAQWSLYHS
FT                   RLSFSLNAKLISPLEVINAVIEHYHANPFIEIAQVEGFVRQILGWREYVRGIYWANMPS
FT                   YASINALEATRKLPDYFWHGKTRMNCLRHALSQSLDYAYAHHIQRLMVIGNFCLLTEIA
FT                   PDEVDKWYLGVYVDAIEWVEMPNTRGMALFADGGIVGTKPYAASGSYINKMSDYCGSCH
FT                   YKIRERSGALACPLNSLYWRFMDKHRAQLSHNPRIAMLYRTWDKTDEAARQAILATAEQ
FT                   HLAQLERL"
FT   gene            complement(489220..490941)
FT                   /locus_tag="Shewmr7_0430"
FT   CDS_pept        complement(489220..490941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0430"
FT                   /product="NTPase (NACHT family)-like protein"
FT                   /note="KEGG: ava:Ava_1916 predicted signal transduction
FT                   protein containing NACHT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41433"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM2"
FT                   /protein_id="ABI41433.1"
FT                   /translation="MLEQVVVTESFKAIFNEAIAFIKSKSKSFKTLNQIKLEDAYAKAA
FT                   NVENVKTIWQIDKSVNLNEFYHPSTIKVLDQLICVDSLNIFPENGKIVIQGTAGQGKSI
FT                   LLRYLAGVNLKKGKTIPIFIELRKITEKTNLSALIAMSMSELGINIEEKDLEFIFSSGK
FT                   FTLLLDAFDEIPELCLKDTLLSIENICARNYNQQIIITSRPGSDIQKVSYFSVYNLQPL
FT                   KPPDFKPMLQKFFDDEVTVHRIMKALNENNSTITKLITTPLLLTLLAITYKTYHKIPTQ
FT                   LHEFYENIFHVLANRHDATKPGFRREYKSGLNERELEDLFCAFCFYSMIEDKSSLSRQE
FT                   ALSVTKKAIHFLSINPISEFSFLSDCIKNTCLLLEEGFSYHYIHKSIREYHSAKFISIS
FT                   PIELKEKFYTIATSNFYKYRVELEFLKVIDEHCFYKNFFLPIYRKIFDDLGISTEYREV
FT                   NYQELLLDSKIIFEKHGSEMLLHAFAFSERPALNLDYMNDLHDKLLNSIFKLVRKFEIN
FT                   QKQSEHILITEIIKNEGLEDEFNIIINECIETMFKRYSEANLKFRSKNELISNMSF"
FT   gene            complement(491414..492001)
FT                   /locus_tag="Shewmr7_0431"
FT   CDS_pept        complement(491414..492001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pae:PA0571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41434"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM1"
FT                   /protein_id="ABI41434.1"
FT                   /translation="MSEKVPCTACQTLIMPSTAERNAGLCMPCKNGNRENIEQAKAYYQ
FT                   KERELDKTCPFRALWRDIVVRVHDDKQGFHTLSEAAQHYYAVNCLSGEVYNGGFIQYFD
FT                   NSSGEHYAIAERGLEQIGALHSLALLQQAKQAVFGDHPVPTDRDQRLAATDNPVAEARL
FT                   NQLDDEFYKDLDNLDIKLESYAIQTGLVNAIE"
FT   gene            complement(492081..492467)
FT                   /locus_tag="Shewmr7_0432"
FT   CDS_pept        complement(492081..492467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0432"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   son:SO4164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41435"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZM0"
FT                   /protein_id="ABI41435.1"
FT                   /translation="MTTSTPNVTVLKLKRKSRILEISFDNGEQYQLTCEMLRVYSPSAE
FT                   VHGHGNPKLVTHKKNVNITSIEPVGNYAVKIVFDDGHDTGLFSWQVLYDLATHQVELWE
FT                   KYLARLRAEKASREPLIAMNIKYN"
FT   gene            complement(492622..493950)
FT                   /locus_tag="Shewmr7_0433"
FT   CDS_pept        complement(492622..493950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0433"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: son:SO4163 heat shock protein HslVU, ATPase
FT                   subunit HslU; TIGRFAM: heat shock protein HslVU, ATPase
FT                   subunit HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41436"
FT                   /db_xref="GOA:Q0HZL9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZL9"
FT                   /protein_id="ABI41436.1"
FT                   /translation="MSEMTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDADFR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVEQIIRDLT
FT                   DIAIKLTREQQMGKCRQRAEEHAEERILDALLPKPKNDWDSTDSDANSNTRQIFRKKLR
FT                   EGQLDDKEIDIDVAQPQVGIEIMSPPGMEEMTNQLQSLFKNMGQAPAKRRKMKIKEAFK
FT                   LLIEEEAAKLVNQEDLKEQAIELVEQHGIVFLDEIDKICKRGETSGPDVSREGVQRDLL
FT                   PLVEGCTVTTKHGMVKTDHILFIASGAFQMAKPSDLIPELQGRLPIRVELDALSADDFK
FT                   RILTEPHASLTEQYIALMATEGVTIEFAESGIESIAKAAWQVNERTENIGARRLHTVME
FT                   KLMEDISYEASDKSGSSFVIDADYVSAHLDNLVQDEDLSRFIL"
FT   gene            complement(493969..494493)
FT                   /locus_tag="Shewmr7_0434"
FT   CDS_pept        complement(493969..494493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0434"
FT                   /product="HslV component of HslUV peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   son:SO4162 ATP-dependent protease HslV"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41437"
FT                   /db_xref="GOA:Q0HZL8"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZL8"
FT                   /protein_id="ABI41437.1"
FT                   /translation="MTTIVSVRRNNQVVIAGDGQVSLGNTVMKGNAKKVRRLYHNKVLA
FT                   GFAGGTADAFTLFERFESKLEMHQGHLLRSAVELAKDWRTDRMLRKLEAMLVVADAEAS
FT                   LIITGNGDVVQPEHDLVAIGSGGNYAQAAALALLQNTELSALEIAEKSLTIAGDICVFT
FT                   NQFKTIEELNY"
FT   gene            complement(494648..495253)
FT                   /locus_tag="Shewmr7_0435"
FT   CDS_pept        complement(494648..495253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0435"
FT                   /product="methylation site containing protein"
FT                   /note="PFAM: methylation site containing protein; KEGG:
FT                   son:SO4159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41438"
FT                   /db_xref="GOA:Q0HZL7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZL7"
FT                   /protein_id="ABI41438.1"
FT                   /translation="MSRLHTSKGFTLIELVVVIIILGILAVVAAPRFINLSQDAHDARA
FT                   KAAFAAFTSGVKLYHSCWLAGGHSGYTQDLACYGDGTLDSTTTGFPLGKDTDNGSNQGT
FT                   QLQGDFCGELWQSLLDNQDFVLTSHTNWEQQQASDIDIVYWYAGGAISDPDTYCYFNYV
FT                   SDDRRLGSENWELKYYPLHGRTVIGRSSFSKSEIPPSP"
FT   sig_peptide     complement(495164..495253)
FT                   /locus_tag="Shewmr7_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.785 at
FT                   residue 30"
FT   gene            complement(495670..496278)
FT                   /locus_tag="Shewmr7_0436"
FT   CDS_pept        complement(495670..496278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0436"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: son:SO4157
FT                   DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41439"
FT                   /db_xref="GOA:Q0HZL6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZL6"
FT                   /protein_id="ABI41439.1"
FT                   /translation="MSTKLPLYLVDDDEAILDSLGFMLGQFGYQVQTFNSGRNFLAQCP
FT                   LTQAGCVILDSRMPEITGQEVQQKLLETQSPLGVIFLTGHGDLPMALSAFRKGACDFFQ
FT                   KPVSGKALVQAIEKAHRESQANFEQQSLQHKFAQLTEREQQVLTHVIQGMTNKQISEAM
FT                   YLSLRTIEVHRAKIMKKLEVSNMAELVQHLAHLNTLLPE"
FT   gene            496468..498291
FT                   /locus_tag="Shewmr7_0437"
FT   CDS_pept        496468..498291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0437"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: son:SO4155 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41440"
FT                   /db_xref="GOA:Q0HZL5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZL5"
FT                   /protein_id="ABI41440.1"
FT                   /translation="MEKASAMGLWCRAILVSVILSLTGLTLCYADEDVPVNEFKVGVLA
FT                   NHGVLQAKQRWQPMMDYLSEKVPNSRFEVVPVDFNGMRSQLLSHDLQFIVTNPGQYLHL
FT                   SNNFPLSWLATMKSRKHQGSTFTIGATIIVRADSSIRSLQDLRGKNVVASDPQALGGYQ
FT                   AAMGLLHKMGYLPEQFFGRVQFLGFPLEPLIYQVRDGNADAAIAPFCTLEEMIETGLIN
FT                   QADYRVIHPTNPPGYDCEVSTQLYPNWSFAAADTVSPRITMQITRALFDLPADHVAAIT
FT                   ADTLGWTAPVSQLKVIELFKELQLQGAPPPLYQTVYKWMEKNKEWGGVLLLIFIVSTIY
FT                   HLWLEYKFRQKSEFLVSTERQLKDKALQLERLQSAAILGEIGAGLAHELNQPIAAITQY
FT                   SEGAMLQLERLGQDNPELYDILGKINAQSIRAGAVVHRIRGLLKRRQSKAEPLNVTLVV
FT                   KEALALLRRELDRAGVQVTVLVEGHPFEVLGDSVGLSQMWVNLVKNSLDALEACEEHRA
FT                   RHLRVEIYYQPTEIKVLVIDNGEGLQRQASELMASFASTKDAGLGLGLAICKDVVSRHH
FT                   GSIEIENCKQSAHAQLPWQQGCVVTVVLPKG"
FT   sig_peptide     496468..496560
FT                   /locus_tag="Shewmr7_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.766 at
FT                   residue 31"
FT   gene            complement(498456..499616)
FT                   /locus_tag="Shewmr7_0438"
FT   CDS_pept        complement(498456..499616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0438"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: son:SO4150 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41441"
FT                   /db_xref="GOA:Q0HZL4"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZL4"
FT                   /protein_id="ABI41441.1"
FT                   /translation="MTAGKTPTQHSTQPLNRLLGETSGAFADLGTFLPLVLGLIALNQF
FT                   SPQGIFLGFGLFAILSALFYRRPIPVQPMKVIAALVIAQGLTPGMLQASAMLMGIILLI
FT                   LAFSGAITWLAKQLSQAVSVGIQLAIGLQLMWMGTKMMSDFWLLGLGAFALLFVSKFLP
FT                   LRYLAMPLVIAAGMLWQANSQTDIATSLDIPALSASLHLAWPSLNEWSSAAILLVLPQL
FT                   ALTLTNAVIATSAMAQEKFPEDAAKLTPKNLAISSGLANLLLAPFGAAAMCHGAGGLAV
FT                   QYHFGARTHLAPLIFGSTCVVIALFWDGQIAWLLGLIPVAILGSLLSIGGLQLAWSKRL
FT                   IDGKPFCIFVILATAVTCLAVNAAAGLAVGIILEQGRRTWAMLAMR"
FT   gene            complement(499896..501284)
FT                   /locus_tag="Shewmr7_0439"
FT   CDS_pept        complement(499896..501284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0439"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: son:SO4144 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41442"
FT                   /db_xref="GOA:Q0HZL3"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR024673"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZL3"
FT                   /protein_id="ABI41442.1"
FT                   /translation="MKKLIVIALAGMALQAQAANPHKDVLKGPFATGSEVTTQCLTCHE
FT                   EQATDMMKTSHWTWELEQKLPDRTVLRGKKNSINNFCVSISSNEPRCTSCHAGYGWKDS
FT                   NFDFKDKTKVDCLVCHDTTGTYVKDPAGAGEPMAKLDLAKIAQNVGEPVRDNCGSCHFY
FT                   GGGGDAVKHGDLDSSMAYPDKATDVHMDSDGNNFQCQNCHTTEKHQISGNAMGVSPGGI
FT                   DHIGCENCHESAPHSNKKLNTHTATVACQTCHIPFFAKNEPTKMHWDWSTAGDDKPETV
FT                   DQYGKHTYQKKKGDFVWEKMVKPQYAWYNGTANAYMAGDKMDPKVVTKLTYPMGDINDA
FT                   KAKIYPFKVHTGKQIYDKKLNIFITPKTYGKGGYWSEFDWNLAAKLGMEANTTMTEKGI
FT                   KYSGEYGFAATEMWWRINHMVSPKEQALNCNDCHNKGTRLDWQALGYQGDPMKNKQGPK
FT                   HKQP"
FT   sig_peptide     complement(501228..501284)
FT                   /locus_tag="Shewmr7_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(501332..503062)
FT                   /locus_tag="Shewmr7_0440"
FT   CDS_pept        complement(501332..503062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41443"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZL2"
FT                   /protein_id="ABI41443.1"
FT                   /translation="MRTPTLISILVANALFMSGQTFAAANETPADTQKMAELKQQLADI
FT                   TEQLDELNNRVDKTERHTSLDRLEITGDFRTKAHSLHYRDVVWNPAIKVNFNDFGAKAM
FT                   SGAFGMPNDPNSPLGQMMQANPDLAAAFQNGMLQGVMPYVLAQKHIQDIDNDIFYTTRL
FT                   RLNLKAKVWDNVSFAGRLSMYKNWGDSTGVQVFDSWRSFTMDGTSSGNTSGDWLRVERA
FT                   YFDWKKINGSEFYLSIGRRPSTYGPPSHYRENELRGGTPSGHLVNFNFDGATLGYNLGE
FT                   ITGVEGQVVRFCYGQGFESQWGNGEMFGDIVTKDTHLGGFNIDAINDGTNFLQFTLFGA
FT                   KDINDGFKGTMAFPTQLAGIFAPTMYQDMQKFDNFNFVTRVQPSGVIGDMYLGGIGFAR
FT                   EEANDIKWFASLGWTRAEPNGNAGMFGGMLSDAVFEAELNSTGTEIIMVPKTSDDTDTK
FT                   DGYGIYVGIQIPAPYGKFGLEYNYGSKYWTPFTQAQDDPIGSKLATRGHVGEAYYIFDI
FT                   NPKMFIKLAGLYYDYEYTGSGTPVGAPQKIDEVLAGSAYSMLPVVDKAFDVNASLTINF
FT                   "
FT   sig_peptide     complement(502991..503062)
FT                   /locus_tag="Shewmr7_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 24"
FT   gene            complement(503240..503569)
FT                   /locus_tag="Shewmr7_0441"
FT   CDS_pept        complement(503240..503569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0441"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: son:SO4142 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41444"
FT                   /db_xref="GOA:Q0HZL1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZL1"
FT                   /protein_id="ABI41444.1"
FT                   /translation="MMKTSTKIAIAVALISSLGLQAYAADGGNPKKGKHLYKKECKACH
FT                   SQGGEGGELTPMSKTMSQWDRFFDKDKHKLKPEVFNGLTEQDLKDIQQFLYDHAADSEQ
FT                   PQTCG"
FT   sig_peptide     complement(503495..503569)
FT                   /locus_tag="Shewmr7_0441"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            complement(504165..505703)
FT                   /locus_tag="Shewmr7_0442"
FT   CDS_pept        complement(504165..505703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0442"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: son:SO4139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41445"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZL0"
FT                   /protein_id="ABI41445.1"
FT                   /translation="MLLILIIIAFVVLFIFFAKYQKKKIQAEALAAGEPSAQLNHGLTL
FT                   INQGEVNSGLDYIQQAVDKGFAVAAIAMAELYSGRFPQVPADPKASEYWYRKAAEIDPQ
FT                   FLPMITLPSLVASEAQTPEQLREQVEQLKASAEAGQVEFQYELAYLYLRQPFLDPDASQ
FT                   AIYWFEKTAAQGNQDAYYHLGTLYWHDERVTPDYSKAREYFEKAVAAGDELAKDNLGHM
FT                   LAAGQGGPKDLVRAEALLSEYAAENDFRQYYLGKRFLYGEDFAVDYSKARHWLEKSCAA
FT                   DNVFAKLALAHLKLLDPQTDNDYQQARTEFETLASQWQEEALFGLGKIYEEGLGVSRQP
FT                   IKALMYYQLAAMSHITDYQDAYEKLSKRLGTLEIREAQNLCNNFLHQHPIPDEQQTYYY
FT                   LNQAEIYRKGEHPSREALQTAVTWYRKAADLGSQDGMQALVDINRHESIDKPVQTYIWS
FT                   SILLRNFGQYGMNSDQLLYQQQVLPRLTESELLYAQDEIDRIEAQLAPYLQSNE"
FT   gene            complement(505821..506657)
FT                   /locus_tag="Shewmr7_0443"
FT   CDS_pept        complement(505821..506657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0443"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pca:Pcar_0306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41446"
FT                   /db_xref="GOA:Q0HZK9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK9"
FT                   /protein_id="ABI41446.1"
FT                   /translation="MITPGLDQELQQLQGVYQLITEFLVNYSFQLIGAALVFLLGLWVA
FT                   SKVSRLVAKQCEKHHIDITLSNFVSNLIRILIIVMVGIIALGKIGISVTPMVAAIGAAS
FT                   LGAGLALQGMLSNYAAGVTIIVTRPFVVGNTIEIKGESGVVTRINLGMTILTNEEGEQI
FT                   SIPNKHIVGEILHNSFGNKLVETQFNLSYNNDPEAAISLITELLSQNPNVSQDTTPNIG
FT                   INGFNAIGLEIGVRYWVPTQSYFQHKYKINMAIYNALKQAGIEMACPVREIHLQEK"
FT   gene            506826..507305
FT                   /locus_tag="Shewmr7_0444"
FT   CDS_pept        506826..507305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41447"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK8"
FT                   /protein_id="ABI41447.1"
FT                   /translation="MRKLLLCLSFLFTPMMALAASYVAGDAINPISLQDQNEQAVSVTD
FT                   ETKVVLFSRSMKGGDIIKETLTPLAGDKFPPHLVYVADISGMPSLIAKFVAVPQMQELP
FT                   FAIGLDREGEISRLLPDTKDMATMILLDHRNIQDIAYFDSSEALSQALAKLNESQ"
FT   sig_peptide     506826..506885
FT                   /locus_tag="Shewmr7_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 20"
FT   gene            507722..508897
FT                   /locus_tag="Shewmr7_0445"
FT   CDS_pept        507722..508897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0445"
FT                   /product="ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG: son:SO4136
FT                   decarboxylase, pyridoxal-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41448"
FT                   /db_xref="GOA:Q0HZK7"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK7"
FT                   /protein_id="ABI41448.1"
FT                   /translation="MSQFQSIDVADYYDAQTFKRIEEFAKDKATPFVVIDTNIIAKQYD
FT                   DMVNSFPYADVYYAVKANPAAEILTLLKNKGSNFDIASIYELDMVTNVGVTPDRVSYGN
FT                   TIKKRQDVRAFYERGVRMYASDSEADLRMIAEEAPGSRIYVRILTEGTDTADWPLSRKF
FT                   GCQNEMAYELLVLAKELGLEPFGISFHVGSQQRDIGAWDSAIGKVKSIFDRLRDEHNIV
FT                   LKMINMGGGFPANYIDKTNQLGVYAEQITHFLKEDFGDDLPQIILEPGRSLISNAGVLV
FT                   SEVVLISKKSYTALERWVFTDVGKFSGLIETMDEAIKFPIFTHKQGELDKCVIAGPTCD
FT                   SADIMYEHYSYGLPNDLAIGDRMYWLTAGAYTTTYSAVCFNGFPPLKDYYL"
FT   gene            complement(508960..509172)
FT                   /locus_tag="Shewmr7_0446"
FT   CDS_pept        complement(508960..509172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0446"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   son:SO4134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41449"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK6"
FT                   /protein_id="ABI41449.1"
FT                   /translation="MFPEYRDLITTLKTQDAHFQRKFDEHNQLDEEIKQLEKRVGSDFN
FT                   PAVKELKSKKLHLKEEIYQILKSHS"
FT   gene            509585..510343
FT                   /locus_tag="Shewmr7_0447"
FT   CDS_pept        509585..510343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0447"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine and
FT                   other phosphorylases, family 1; KEGG: son:SO4133 uridine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41450"
FT                   /db_xref="GOA:Q0HZK5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK5"
FT                   /protein_id="ABI41450.1"
FT                   /translation="MADVFHLGLTKAMLDGATLAIVPGDPERVKRIAELMDNATFLASH
FT                   REYTSYLAYADGKPVVICSTGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGD
FT                   VIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVTASSDTFYPG
FT                   QERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESATLFTMCATQGWRAACVAGVIVNRT
FT                   QQEIPNEATMKQTEVSAVSIVVAAAKKLLA"
FT   gene            complement(510456..511208)
FT                   /locus_tag="Shewmr7_0448"
FT   CDS_pept        complement(510456..511208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41451"
FT                   /db_xref="GOA:Q0HZK4"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK4"
FT                   /protein_id="ABI41451.1"
FT                   /translation="MKKTCLCLALMLSPQAFAGDLVQWWDFSATALYGEDYDLAPSDKQ
FT                   ATVTLETAGAWKYGDWFAFQDFIYFKGDHTGMDSTTYGEISPRFSASKILGEKIAFGPI
FT                   TDLSLALTYEEGEGPVHSLLYGLGVDVAVPYFTYLNFNTYRRDAMSSGNISDGWQFTPV
FT                   FRIDIPVGSANIVLDGFIDWVFATDNSGYEENFHFNPQLKYDLGKSLFGDHKANKLLVG
FT                   IEYDLWTNKYGVKGVDQDTYSVIAQYHF"
FT   sig_peptide     complement(511152..511208)
FT                   /locus_tag="Shewmr7_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            511697..512167
FT                   /locus_tag="Shewmr7_0449"
FT   CDS_pept        511697..512167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0449"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   son:SO4130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41452"
FT                   /db_xref="GOA:Q0HZK3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK3"
FT                   /protein_id="ABI41452.1"
FT                   /translation="MEFSNLILVWSIIGIILMLAELVIPGGIVVLLGAACLVVAGALWI
FT                   GLVEGVVQSLTLWFISAIVLLLAFRQVTQKLVGGDSHVDNTDEELDIYNQIARVKQTIG
FT                   PGQTTGRVEFQGSEWPALGDGSIIAAGTEVRIICRENIALVVEPVEQATSQN"
FT   gene            512179..513114
FT                   /locus_tag="Shewmr7_0450"
FT   CDS_pept        512179..513114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0450"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: son:SO4129 SPFH
FT                   domain/Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41453"
FT                   /db_xref="GOA:Q0HZK2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK2"
FT                   /protein_id="ABI41453.1"
FT                   /translation="MFVFTLVILFVLFILYKLMLIVPMREVHVIERLGKFRTVLQPGFH
FT                   FLIPFFDRVAYKHDTREQVLDVPPQSCISKDNTQLEVDGLVYLKVMDGKLASYGIENYR
FT                   KAAVNLAQTTMRSEIGKLTLSETFSERDRLNESIVREIDKASEPWGIKVLRYEIRNITP
FT                   SRHVIHTLEKQMEAERRKRAEITLANAEKAAMINMSEGERQEAINISEGQKQKRINEAK
FT                   GTGQEIAIIAKAKSEGMAMISQALAVNGGNDAMNMLLKEQFIAQVGKILSDAQVSVVPA
FT                   EMAKLEGFFEGMEQVTQTVGGHNATSKGAR"
FT   gene            513114..514046
FT                   /locus_tag="Shewmr7_0451"
FT   CDS_pept        513114..514046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0451"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: son:SO4128 SPFH
FT                   domain/Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41454"
FT                   /db_xref="GOA:Q0HZK1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK1"
FT                   /protein_id="ABI41454.1"
FT                   /translation="MQIPLNTDVAVMVIWGLIFAIFVIKLFQSIRLVPTKSAYIVERLG
FT                   KYHSTLDAGFHTLIPFVDKVAYIHDLKEETIDVPPQECFSSDEVNVEVDGVIYISVTDP
FT                   VKASYGITDYRYAAIQLAQTTTRSVIGTLDLDRTFEERDVISAKVVEVLDQAGAMWGIR
FT                   VHRYEIKNITPPETVKNAMEMQVNAERERRALLAKSEGDKQSKINRSEGIKAETVNRSE
FT                   GEMQRRINEAEGKAEEILTLSRATAESIERLAAVIAAPGGHNALRMQLGEQYFKQLDGL
FT                   SQKSSRVVLPGNMVDFDYWMNSIGLKEKA"
FT   gene            complement(514337..514870)
FT                   /locus_tag="Shewmr7_0452"
FT   CDS_pept        complement(514337..514870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0452"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   vvu:VV12207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41455"
FT                   /db_xref="GOA:Q0HZK0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZK0"
FT                   /protein_id="ABI41455.1"
FT                   /translation="MSRITPVSNPQGEAAATLNAIKQKIGMVPNLYATVAHSSTVLNAY
FT                   LAFSEALNQGRLSAKQRELIALAVGQANECQYCLSAHTMISRGAGLSDEQIITARQGTA
FT                   ENTLDNALVKLAVTLVKQRGVITDEQLSDARTHGVDEGLVFEVLAQVSANTFTNYVNHV
FT                   ADTDIDFPKVNVQL"
FT   gene            514992..515837
FT                   /locus_tag="Shewmr7_0453"
FT   CDS_pept        514992..515837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0453"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: vvy:VV2149 AraC-type DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41456"
FT                   /db_xref="GOA:Q0HZJ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZJ9"
FT                   /protein_id="ABI41456.1"
FT                   /translation="MDALSSLIQHAAPKASLFFSGNLCQSAESEEHANGGQLHLLRRGE
FT                   LGLHQTGSAVQTISEPTLIVYPRGRHHRLQPLHFSGCDLVCARLTFRDSPLFRALPDAL
FT                   IIPLTKLEGLAPTINLLFDEAFSQRYAHNAVVASLLDLLLLLLLRHMVEHNLCESGLLA
FT                   AMTDPKLAKAIEAIHASPDTPWTIAELAKLAGMSRAQFAARFHQVIGQPPLSYVTESRL
FT                   LLAQQLLLAGQPVKFIALEVGYSGGVAFSRAFERQFGLTPTRWLQQQKSMGTEAIEPTK
FT                   "
FT   gene            complement(516283..516507)
FT                   /locus_tag="Shewmr7_0454"
FT   CDS_pept        complement(516283..516507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41457"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZJ8"
FT                   /protein_id="ABI41457.1"
FT                   /translation="MNALIEIEASEFSQLFKSGDALSIRMYMEHVHMPLDVQDKIYNEI
FT                   SALAVLEQDTIARLIETHSHSEISERLAY"
FT   gene            complement(516810..517505)
FT                   /locus_tag="Shewmr7_0455"
FT   CDS_pept        complement(516810..517505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0455"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: son:SO4124
FT                   cell division protein FtsN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41458"
FT                   /db_xref="GOA:Q0HZJ7"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZJ7"
FT                   /protein_id="ABI41458.1"
FT                   /translation="MSNRDYANRRPQAGAKQRPIRATRARPAAKKAAPRRKLPIPLILF
FT                   AFIAVGSFGYFLFSIKDTAKQEAPVEVKTEKPTKAKEPATILTPKVKEAERQAVVVTAP
FT                   VEEKPVVEAPKKDPNALPPKPKEEWTYLDELENKNVEVDIPDVVATRTPQQYQLQCASF
FT                   RQESQANQMKAVIAFQGLEAQVRQIEGTSGTWYKVILGPYERRRDAERKRHTLQNAGIN
FT                   GCQLLAISK"
FT   gene            complement(517509..519254)
FT                   /locus_tag="Shewmr7_0456"
FT   CDS_pept        complement(517509..519254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0456"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: son:SO4123 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41459"
FT                   /db_xref="GOA:Q0HZJ6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZJ6"
FT                   /protein_id="ABI41459.1"
FT                   /translation="MKSHIQSLLEQTIESFKQQGILPADFEARIQVDRTKDKSHGDLAT
FT                   NLAMMLTKAAGKNPRELAQLIIDNLPASAYVAKVEIAGPGFINFFIDDSALANQLQAAI
FT                   SDEHLGIKLPTPQTIVVDYSSPNLAKEMHVGHLRSTIIGDSVVRTLEFLGHKVIRQNHV
FT                   GDWGTQFGMLLAYMEELRAQNGEQAQLELSDLETFYRAAKLRFDESAEFATRARQLVVE
FT                   LQSGDEYCNKLWREFNDISLSHCHEVYERLGVSLTRADVHGESAYNADLEQVVKDLDAQ
FT                   GLLTQSNGAKVVFQEEFRNKEGEALPVIIQKADGGYLYATTDLAAMRYRSSVLKADRVL
FT                   YFVDLRQALHFQQVFSLAKLAKFVRNDMSLEHLGFGTMNGEDGRPFKTRTGGVVKLVDL
FT                   LDEANTRALELVRSKNPDMDEATLAEIARVVGISAVKYADLSKNRTSDYIFSFEQMLSF
FT                   EGNTAPYLLYAYTRVAGIFKRATDIDLSQAKIVLEHEKEKDLGNKLAQFGEILSRVVDK
FT                   GQPHVLCGYLYELAGAFSSFYEACPVLAADNDEQKHSRLLLSQLTANTLQKGLNLLGIE
FT                   TLERM"
FT   gene            complement(519366..521576)
FT                   /locus_tag="Shewmr7_0457"
FT   CDS_pept        complement(519366..521576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0457"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: helicase
FT                   domain protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; KEGG: son:SO4122
FT                   primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41460"
FT                   /db_xref="GOA:Q0HZJ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZJ5"
FT                   /protein_id="ABI41460.1"
FT                   /translation="MSLFVEVALPVPMRQNFTYRVDTDEQGKEIAQQPQIGIRVKVPFG
FT                   RQQLIGLVTAITDSCELVPTQLKSVIEFIDDAPLLPESLYKLTLWAARYYFCSQGQMLT
FT                   QALPVALRKGLDAAPQKIQYWQITELGSNIAPETLKRAPAQKRLLERLQQTSLTQEDVI
FT                   SLELNKAALKTLEDKGWIARHEKLAELNLDWRSQLELDEAPHRLNKEQAVAVTLLTQQQ
FT                   GYHCTLLEGITGSGKTEVYLAVLEHILKQGKQALILVPEIGLTPQTINRFKRRFKVNVA
FT                   VLHSGLTDNQRLEAWRQARCGQAAIIIGTRSALFTPMAFPGVIILDEEHDSSFKQQEGV
FT                   GYHARDLAVMRGHLESIPVILGSATPSLETLQNALSGRYHHLQLGERAGNAKKVRQGII
FT                   DIKNLPLKAGMSAPLINEIRSHLEAGNQVLLFLNRRGFAPALLCHECGHLHECDRCDAF
FT                   FTVHQSLGEIRCHHCGNQYAIPRQCHHCGSTMLMGQGIGTEQLAEALQQEFPKYPVVRI
FT                   DRDTTRLKGSLESHLSAIHKGEYKILVGTQMLAKGHHFPDVTLVGLLDVDGALFSADFR
FT                   APERFGQLYTQVAGRAGRANKPGTVLLQTHQSDNPILRDLLHRGYGEFARSQLKERQMA
FT                   LLPPAWHMVLVRAEAHSAVDADNFLNAFAALLPQDKEFEIIGPMPAPLDKKAGKFRRQL
FT                   MFQAKHRHRLQQEFERIYPLVEQLPEAKRCRWSLDRDPQDLL"
FT   gene            521680..522834
FT                   /locus_tag="Shewmr7_0458"
FT   CDS_pept        521680..522834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41461"
FT                   /db_xref="InterPro:IPR020012"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZJ4"
FT                   /protein_id="ABI41461.1"
FT                   /translation="MTKIAKSLGLFALVCSACVQAQVSHVSINSRMFDLGAYPKMRVNV
FT                   ITDNQDMTRLEFAVQQSGGEEKLMAEQLNRFLVLLTGVEDVTDPKARLLVREYRVDRWY
FT                   EVKNLPLFDNASSAASSVSQAKTAVVKSSKAATAETRQLAASSAKSDKTPVKSTKVVQE
FT                   VNLVTAEADVAPVASVVVAAVTTEVAAAPRASGFTFPEDKSDAKASSSSSSSVVASAKA
FT                   EVAKSEPSKTEAAKAEMSTPEPSTTEVASEPAVAQASADLPRVDKSKAAIDAPEVKAGE
FT                   ATATEVNTVSSTNSQSTNSGECLLDYHNETLWRIANRYAPEWKVSVYGAMLAIHDANPK
FT                   AFSKNRINALKKDATLYCPSAEILARYPEAQAAKTSFEDREAGR"
FT   sig_peptide     521680..521745
FT                   /locus_tag="Shewmr7_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            523000..523212
FT                   /locus_tag="Shewmr7_0459"
FT   CDS_pept        523000..523212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0459"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: son:SO4120 ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41462"
FT                   /db_xref="GOA:Q0HZJ3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZJ3"
FT                   /protein_id="ABI41462.1"
FT                   /translation="MKPGIHPEYAVITANCTCGNVIKVNSTAGKDLHLDVCGACHPFYT
FT                   GTQKVVDTGGRIDKFNKRFGMLGKK"
FT   gene            523724..524968
FT                   /locus_tag="Shewmr7_0460"
FT   CDS_pept        523724..524968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0460"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /note="PFAM: malic enzyme domain protein; malic enzyme,
FT                   NAD-binding; KEGG: son:SO4118 malate oxidoreductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41463"
FT                   /db_xref="GOA:Q0HZJ2"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZJ2"
FT                   /protein_id="ABI41463.1"
FT                   /translation="MSDIRQQALDYHEFPVPGKTAVCLTKPAETSHDLALAYSPGVAEP
FT                   VREIAANPDNAYRYTNKGNTVAVITNGTAILGLGNLGPLASKPVMEGKALLFKHFANID
FT                   STDIEVTHNTTEEFINTVAAIAGTFGGINLEDIKAPECFVIERELIERCNVPVFHDDQH
FT                   GTAIVTAAGMINALEIQGKLISDATFVCMGAGAAAIACMTMLVKCGANRANIYMLDTKG
FT                   VIHTGRTDLNEYKALFANDTDKRTLQDVIKGADVFLGLSGPNVIGAEEVAMMADKPVIF
FT                   ACSNPDPEIKPELAHATRSDLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRASCINDEM
FT                   KVAAVHAIAGLAKEEVPASVLKAYPKVSSLSFGPEYVLPKPMDPRLLPRVARAVAQAAI
FT                   DSGVAAITTLPHYAD"
FT   gene            525184..527094
FT                   /locus_tag="Shewmr7_0461"
FT   CDS_pept        525184..527094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0461"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; KEGG: son:SO4116 MSHA biogenesis protein MshH"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41464"
FT                   /db_xref="GOA:Q0HZJ1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZJ1"
FT                   /protein_id="ABI41464.1"
FT                   /translation="MKFTRMLTTKLTSFWLMSLAAIAFVFLLSAMMSFVQLTYKFQQQK
FT                   VTELESLLIEHYQTQPDWELESWLPPMLLAYNAVEFRLTMKSEVLFAYQGNVQTQNAMV
FT                   YTHLLDPQSGLNMTLTLPQPFEHYSVSWYELLILGVGLLAVIALVRFGHVWFSQQLDGI
FT                   EELAQRSRLILQGKHEQALATPGNGKPRLINRALTKLLEELQDAHKERGRFDKFIRSNT
FT                   FLDAQTRIGNRLFLNNRLDALSHDQGMVAHGVIYLLEMDDLDLLQQAKGESAVKELLHA
FT                   TVNSINSILQTLPNSIFARRSHNQFAIVVPHVSLIEADQLASKLLKVCLSQPLPDDVEN
FT                   QDNFYHLGCAYFTAGDNVNQLLDEADMALRAAQLQGNSNWFMYDKGAIDEEFAKGSVRW
FT                   RSFLENALVQRRFYPFSQPVMDSDGVEHHKEIFTRARDNQGALVRATLFIPMANKCGLM
FT                   PQVERQMIEQVLGLLSQEKHKNQVYSVNLSLDTLMSRAFTQWLKTTLLEYRHLTPQLIF
FT                   EVSEDIVIQHQDKLKPKLDMIRKMGARLCVDHVGQQVVGTYYIRECHFDMIKLHRSIVR
FT                   HIHLRPENQLFIRSLIGGLYRTEVQVCAEGIEVFEEWQTLQILGVGMAQGTYFSDPIEV
FT                   Q"
FT   sig_peptide     525184..525291
FT                   /locus_tag="Shewmr7_0461"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.795 at
FT                   residue 36"
FT   gene            527332..528210
FT                   /locus_tag="Shewmr7_0462"
FT   CDS_pept        527332..528210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0462"
FT                   /product="conserved hypothetical biogenesis protein MshI"
FT                   /note="KEGG: son:SO4114.2 hypothetical biogenesis protein
FT                   MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZJ0"
FT                   /protein_id="ABI41465.1"
FT                   /translation="MDKGLFARLAFWRAKQAGAALGVYVCADKLWVYAPATESLAEQWV
FT                   SYELQQNQWQQAFAELANAFPHAALQIVLSSGRYQLLVADKPNVDSDELSQALLWSIKD
FT                   MVTIPVPQIHLDYFESPLPSNKLNVAVVDKDKLRAMVQAISDQGLSVLGISIEELAMTN
FT                   LFNDENQARLVVSHHTGQELLLTVVKQGQLYMQRRVRGFTELDKAEVDELNYGLADNLS
FT                   LEIQRSMDYFESQLRQPPVASIELFADGAVDALAKLVSANFNQAVNVVNKRAVGASMAG
FT                   LAFSELSRGAE"
FT   gene            528207..528809
FT                   /locus_tag="Shewmr7_0463"
FT   CDS_pept        528207..528809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41466"
FT                   /db_xref="GOA:Q0HZI9"
FT                   /db_xref="InterPro:IPR020274"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI9"
FT                   /protein_id="ABI41466.1"
FT                   /translation="MIKSRVNLYSAALLPPKQSLTFAKLISYTLGLIAVCIILAAFSYW
FT                   QLAESQQALGQAATQKQQFEQQKAELEAQIAARKPDPELVARVELESQQLELKQLLMSE
FT                   LALRSSLTSRGFAPVLKDLAMVADASVWLNHIVINEQHFMFEGFADHPQSIPQWVGKLK
FT                   TTNTLKGQAFSSMTMDRGEDKPLAFTLTSETPEEQAR"
FT   sig_peptide     528207..528338
FT                   /locus_tag="Shewmr7_0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.603 at
FT                   residue 44"
FT   gene            528806..529456
FT                   /locus_tag="Shewmr7_0464"
FT   CDS_pept        528806..529456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0464"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /note="KEGG: son:SO4114 MSHA biogenesis protein MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41467"
FT                   /db_xref="GOA:Q0HZI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI8"
FT                   /protein_id="ABI41467.1"
FT                   /translation="MKAQFEQLAQKFDVLSQRERGLIAIAVLVLVAMLAYLPIESLWKQ
FT                   QYSTAQQLKALEQENQISMQQIDLYQQRLAMDPNQDYRQRLNLLQQQNQQIDAQLNEQM
FT                   VDMVPADYMPELLGNLLGQVQGIKLLKFTSVTPVPLLAVGEEKKLNLYSHGIRMSLEGD
FT                   YFSVLRFVEAVEAMPDKLYWKRLDYKVADYPKGKIDIELYTLSINKDFISVAK"
FT   gene            529443..529760
FT                   /locus_tag="Shewmr7_0465"
FT   CDS_pept        529443..529760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0465"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /note="KEGG: son:SO4113 MSHA biogenesis protein MshK"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41468"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI7"
FT                   /protein_id="ABI41468.1"
FT                   /translation="MSLNKPYIFIALLGISAQVSAESLRDPTLPGKGYSAAGAVTQNQN
FT                   KALVLNSIVSSGNTAYAVINNKIVSVGDSIQGVKVVRITPSSVSLSDGRKLALFQAIIE
FT                   R"
FT   sig_peptide     529443..529508
FT                   /locus_tag="Shewmr7_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.990 at
FT                   residue 22"
FT   gene            529775..531460
FT                   /locus_tag="Shewmr7_0466"
FT   CDS_pept        529775..531460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0466"
FT                   /product="pilus (MSHA type) biogenesis protein MshL"
FT                   /note="TIGRFAM: pilus (MSHA type) biogenesis protein MshL;
FT                   PFAM: type II and III secretion system protein; Secretin
FT                   domain protein; Secretin/TonB, short N-terminal domain
FT                   protein; KEGG: son:SO4112 MSHA biogenesis protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41469"
FT                   /db_xref="GOA:Q0HZI6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI6"
FT                   /protein_id="ABI41469.1"
FT                   /translation="MTAIKYITPLLSLCLMACQTTDRPQPVASKEALATSMQTASQPTP
FT                   PPPATMPDAVQRELNANAMMGGLTPPMETERRIDVSAHDVDARVFFPSLVQGTPFSVAV
FT                   HPDVQGTISLSLKGVTLSEAIQVVEDIYGYEVSREGRILRVFPAGMRTETFPLNYLYME
FT                   RDGLSLTSVSSGRISDNNNSNNNNSNNNNSNNGNFGNNSNNNNSNNGNYGNNNSSDSTN
FT                   GTFIRSRTKTDFWGELKETLSAIIGDTGGGRQVVVTPQAGLVTIRAYPNELRQVRAFLN
FT                   SAESHLQRQVILEAKILEVTLSDGYQQGIQWDNVLGHVGNTNINFGTSAGAGLSDKITA
FT                   SLGGVTSLSIKGSDFNTMISLLDTQGDVDVLSSPRVTASNNQKAVIKVGTDEYFVTDVS
FT                   STTVAGTTPVTTPQVELTPFFSGIALDVTPQIDKDGNVLLHVHPSVIDVKEQTKDIKVS
FT                   SESLELPLAQSEIRESDTVIRAASGDVVVIGGLMKSENTEVVSQVPLLGDIPLVGELFK
FT                   NRSKQKKKTELIIMLKPTVVGNDTWKNELERSKTLLDRWYPENK"
FT   gene            531467..532396
FT                   /locus_tag="Shewmr7_0467"
FT   CDS_pept        531467..532396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0467"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /note="KEGG: son:SO4111 MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41470"
FT                   /db_xref="GOA:Q0HZI5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI5"
FT                   /protein_id="ABI41470.1"
FT                   /translation="MYLKHFGLSQTPFSLTPNTGFFFGLSPHVEALQVLQTALQTGEGF
FT                   IKVTGEVGTGKTLICRKLINELPQGFHCAYLPNPYLTPAELRWAVANELGLKYTSEIDQ
FT                   QQLTGLIQQQLLALSAHGHAIVLVLDEAQALPDESLEALRLFTNLETESRKLLQVVLFG
FT                   QPELDERLKRQAFRQLRQRITFSYSLRPLTWDETDAYIRYRLAVAGYAGQALFGPKLTR
FT                   KIAEASRGIPRLINILAHKALMLSFGEGATQVRIAHIKGAIQDTEDASRGSQRWPAYMA
FT                   IALIACAAAIGALLLSGVNLQQLWGGVA"
FT   gene            532393..533718
FT                   /locus_tag="Shewmr7_0468"
FT   CDS_pept        532393..533718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0468"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: son:SO4110 MSHA
FT                   biogenesis protein MshN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41471"
FT                   /db_xref="GOA:Q0HZI4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI4"
FT                   /protein_id="ABI41471.1"
FT                   /translation="MSVINKMLQDLEKRQQGHSLSNVAVHQAQYLGRPNPSRKWLVISL
FT                   VSLLVGGLSVYAFQASYGVKSIADNIANPVMSLQTQPDNGSPQIDTSPLETETTTSTEP
FT                   TAEMAQVSPSSTEVPAKDMSASAESAPRVAQSPRVNAAQVEPTSEPITESVAASPSTDT
FT                   PNKAVLTQEQAQTQAEPQQVAVKVNQADVNANQSEVKITQTEPKASEPFVPAATQASSQ
FT                   TTPQASSQASPQAQSTGQMAIREVKLSPSQLAQKQLVLAADAEKQGQLVKAMDYYAKAL
FT                   KLDPSLHESRKQLAALHYGQGELAQAAEVLAQGRLLYPQEFEFALLLARVQHAMGETDS
FT                   ALASLAQIPDSHSLARQKWLAQTDLAQKQGQYPLVEQAYRKLLQQEPQQGKWWMGLAYA
FT                   LDSQQQFGPASQAYRTALSYSGLSTQATAFIEQRLQQLGDSQ"
FT   gene            533715..535475
FT                   /locus_tag="Shewmr7_0469"
FT   CDS_pept        533715..535475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0469"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II, protein E domain protein; KEGG:
FT                   son:SO4109 MSHA biogenesis protein MshE"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41472"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI3"
FT                   /protein_id="ABI41472.1"
FT                   /translation="MKPRLKMRLGDLLVQESIITEEQLQQALGEQRKTGHKLGRTLIEL
FT                   RSITETQLLQFLSQQLNLPLLDISKRPIPAEVVSLIPEVQARRFRALAVEDRGDTVLVA
FT                   MSDPADLQALDHLEILIAPKKLSVAVAPEQQLLQAFDNLYRRTDQIAQIAGKLEEEYAA
FT                   DQMFDLASLTSSDSDNETTVVKLLQSIFEDAVQMRASDIHIEPGEKALRIRQRIDGQLH
FT                   ETILNEVNIAAALVLRLKLMAGLDISEKRLPQDGRFHMEIKGHKIDVRMSTMPIYHGES
FT                   VVMRLLDQSAGLLTLNETGMPPHILARIRKQIKRPHGMLLVTGPTGSGKTTTLYGILSE
FT                   LNTADRKIITVEDPVEYQLPRINQVQVNHKIGLDFSNVLRTTLRQDPDIIMVGEMRDQE
FT                   TVEIGLRGALTGHFVLSTLHTNDAVTSALRLLDMGAASYLVASALRVIIAQRLVRRVCH
FT                   NCGVEYQPTAQEKAWLNSVSRQDFSSAKFRIGTGCQSCNGSGYRGRIGIFEILELDEKM
FT                   IDAMRTGNPQDFARAALQSPNFTPLAESALQYLSEGMTTIEEVAKLVEDVSESQVPLSR
FT                   DIISQQGVEA"
FT   gene            535478..536698
FT                   /locus_tag="Shewmr7_0470"
FT   CDS_pept        535478..536698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0470"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   son:SO4108 MSHA biogenesis protein MshG"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41473"
FT                   /db_xref="GOA:Q0HZI2"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI2"
FT                   /protein_id="ABI41473.1"
FT                   /translation="MPVYQYRGRSGQGQAVTGQLDAASEGAAADMLLARGIIPLEVKVA
FT                   KEAKSFTLAQLFSSKVGLDELQIFTRQMYSLTRSGIPILRAIAGLSETAHSQRMKDALN
FT                   DISEQLTAGRPLSSAMNQHPDVFDSLFVSMVHVGENTGKLEDAFIQLSGYIEREQETRR
FT                   RIKAAMRYPIFVLIAIALAMVILNIMVIPKFAEMFSRFGADLPWATKVLIGTSNLFVNY
FT                   WPLMLIILLGTIIGIRYWHHTEKGEKQWDQWKLHIPAVGSIIERSTLSRYCRSFSMMLS
FT                   AGVPMTQALSLVADAVDNAYMHDKIVGMRRGIESGESMLRVSNQSKLFTPLVLQMVAVG
FT                   EETGQIDQLLNDAADFYEGEVDYDLKNLTAKLEPILIGIVAVIVLVLALGIYLPMWDML
FT                   NVVKGGK"
FT   gene            536737..537231
FT                   /locus_tag="Shewmr7_0471"
FT   CDS_pept        536737..537231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41474"
FT                   /db_xref="GOA:Q0HZI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI1"
FT                   /protein_id="ABI41474.1"
FT                   /translation="MQSQQKAESDLLRVYGRLVSLTLILIILAVIGFKYFATMPQLAAR
FT                   NVELEHTRFLNVLAMVRSQWLSLGKPQEMRLDWEVFSEQSSNNEQTFVMMSAQGWPQPN
FT                   QLDDQACQQLWQQLMGQGTGDESLIGSYFAKDNSCRYRAPNGDSIGYQLNSGRVIFLTF
FT                   P"
FT   gene            537308..537925
FT                   /locus_tag="Shewmr7_0472"
FT   CDS_pept        537308..537925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0472"
FT                   /product="methylation site containing protein"
FT                   /note="PFAM: methylation site containing protein; KEGG:
FT                   son:SO4106 MSHA pilin protein MshB"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41475"
FT                   /db_xref="GOA:Q0HZI0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZI0"
FT                   /protein_id="ABI41475.1"
FT                   /translation="MKTKQDGFSLIELVIVIVILGLLAATAIPRFLNVTDDAEDASVDG
FT                   VAGGLSTAVSFVRSQWEVDGRQNSSVILDGTSVSLDPRFGYPTGTSGTDATAMTDASCQ
FT                   QVFNTVLQSAPRNVLYSQDARNQRYTVRVIDGAGGSSNAINGTSVSGLDLCVYHQVASL
FT                   VLNQTTGVPTPAPDLSTAGAKGVVYNPGTGKVLSFTQTPFTP"
FT   gene            538010..538534
FT                   /locus_tag="Shewmr7_0473"
FT   CDS_pept        538010..538534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0473"
FT                   /product="methylation site containing protein"
FT                   /note="PFAM: methylation site containing protein; KEGG:
FT                   son:SO4105 MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41476"
FT                   /db_xref="GOA:Q0HZH9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH9"
FT                   /protein_id="ABI41476.1"
FT                   /translation="MKRQQGFTLIELVVVIIILGILAVTAAPKFINLQSDARASAIQGM
FT                   KGAIQGANSLVYSKAALAGKEKEATYKLDIAGTSSDDDDDVDIVYGYMAATQDALEAGM
FT                   DVKFDVGTSPTDTGSNDWVINASGNSATIWQRGAPADVTTTGSEASCKIVYTAAASAGA
FT                   LPTITLTDNGC"
FT   sig_peptide     538010..538090
FT                   /locus_tag="Shewmr7_0473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.693 at
FT                   residue 27"
FT   gene            538855..539343
FT                   /locus_tag="Shewmr7_0474"
FT   CDS_pept        538855..539343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0474"
FT                   /product="methylation site containing protein"
FT                   /note="PFAM: methylation site containing protein; KEGG:
FT                   son:SO4104 MSHA pilin protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41477"
FT                   /db_xref="GOA:Q0HZH8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH8"
FT                   /protein_id="ABI41477.1"
FT                   /translation="MRRFSSGRQFGFTLVELVTTIILIGILSVTVLPRLFSQSSYSAFS
FT                   LRNEFMAELRQVQQKALNNTDRCYRVVVSATGYQVSQFASRDNTGCTDSLLSPNPLSSQ
FT                   AFQGGAQLVLISNNAKSFYLDFDINGRASLACNGPCINVIANDTVAINISSEGYIYAN"
FT   gene            539333..539911
FT                   /locus_tag="Shewmr7_0475"
FT   CDS_pept        539333..539911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0475"
FT                   /product="methylation site containing protein"
FT                   /note="PFAM: methylation site containing protein; KEGG:
FT                   son:SO4103 MSHA pilin protein MshD"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41478"
FT                   /db_xref="GOA:Q0HZH7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH7"
FT                   /protein_id="ABI41478.1"
FT                   /translation="MRINPRLFSISASIKASSKAKPQQGFTLIELVVGMLVIAIAIVML
FT                   SSMLFPQADRAAKTLHRVKSAELAHSVMNEIWGKRYDQNTNANGGVPACGSPLGAPCSS
FT                   VTNLGPSEWKWPDEGEGRNDFNDVDDYHGLTQNATMLNSSKTYAQVYPNYQLSVSVAYG
FT                   SAPNTKLVTINVTTPDNEVITYNLVRSNY"
FT   sig_peptide     539333..539503
FT                   /locus_tag="Shewmr7_0475"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.244 at
FT                   residue 57"
FT   gene            539911..540774
FT                   /locus_tag="Shewmr7_0476"
FT   CDS_pept        539911..540774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0476"
FT                   /product="methylation site containing protein"
FT                   /note="PFAM: methylation site containing protein; KEGG:
FT                   son:SO4102 MSHA biogenesis protein MshO"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41479"
FT                   /db_xref="GOA:Q0HZH6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH6"
FT                   /protein_id="ABI41479.1"
FT                   /translation="MRSLSAKRMARSKRGFTLVEMVTVILILGILVVGVSSFIIFGTRI
FT                   FVESSSVDQVLSQSRFAVERMTRELRSALPNSVRLNGNGLTYQCVEFVPIEASTTYLSM
FT                   PIAPSAAALTGTVILNATDNIKDNQYIWIYPLTDSDVYNSARQKRAQIKTFTPLGESPN
FT                   PANQVTLTFMASTRFAEASPRQRVYFGSSPVSYCFEKAPSSNELTLKRYTGYGLNVSLP
FT                   TPSSMSAGVLMAQNVANALNDSADLPLILTPSSLVNNAMVHLQPRFNVNGETFQYRHQV
FT                   QVINVP"
FT   gene            540764..541219
FT                   /locus_tag="Shewmr7_0477"
FT   CDS_pept        540764..541219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0477"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /note="KEGG: son:SO4101 MSHA biogenesis protein MshP"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41480"
FT                   /db_xref="GOA:Q0HZH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH5"
FT                   /protein_id="ABI41480.1"
FT                   /translation="MSPNLFSLSRSAYRQCLAHRQGGSALIIGIFVITVMFLLAAALIK
FT                   IVEDADTGLTQEVWGTRALAAANSGADAALAQLFPLNAPANATATCTSVANSWTPPNVV
FT                   GFHACNVSLSCTSYSVGTVTQFRINSKAVCESGDTRVSRQVEVEARG"
FT   gene            541212..544979
FT                   /locus_tag="Shewmr7_0478"
FT   CDS_pept        541212..544979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0478"
FT                   /product="MSHA biogenesis protein MshQ"
FT                   /note="KEGG: son:SO4100 MSHA biogenesis protein MshQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41481"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH4"
FT                   /protein_id="ABI41481.1"
FT                   /translation="MVRCLAFLNLAQLNKAHYMRWVASNLLLLFYFFSLPSAYAAIDCN
FT                   SVFPGPIQSFSSSGELYMQSNALVENYNALDVCFKKVKNFHEMNASACGIGKCQITGTP
FT                   SLARAAPTFVSSSTSASNVVANWTTPVVELGTTVGYGQRFDSSRWDIGQLTINTGGNVT
FT                   VSDTYSTYVIKDLTFYNSGTMTLKAGKTYIIDGDLNLNSGILNIVGTGDTKLYIKGNFT
FT                   IALSSVFNAPTSLDVYVGQKLELQSNAQIQGSYYVADDAVLQNSAVLIGRLSAKNVTLQ
FT                   SSSKVIYDAGTPPLQCFNDNFSQSALSNDWVVSRSSGSFTPAIVSGRMRLTEAKSNQST
FT                   ASTYQRLFPAANNLVEIQFEHYAYGGSGADGIAVVLSDAAITPQPGAFGGPLGYGFKPG
FT                   INGFAGGWLGVGIDEFGNFSGEGGSINLSGQRRQSVAVRGSGSGTSGYRYLRGTCNNGT
FT                   TNTSGNCLSPTVDGNNVSPAHRYKITIDSQVSGQSMVKIERNTGSGFVTLIPAFNAIDQ
FT                   QGQAATPSDFLLSLTGSTGGSNNNHEIDNVQICALRSNPIGAQIDHFEFDHTGQGLTCN
FT                   PETVTIRACANASCSQLFTDPLTATLLPESTSEGIWIGGNQVSFNNGSTQLQLRRNTPG
FT                   VVTLGVKGSNPTTKPLSKTLCRIGNGGLSENNCSLTFADSGFVFDVPDKRANRPEQVLV
FT                   KAVKKSDVTQQCVPSFQSQTKTLNFWSSYHTPSAPISPKAVTINNTAIGTSSASPTTLN
FT                   LKFDTNGQASISVNYPDAGKLQLDAQYIGSGNEQGLVMTGSDQFVSVPAGLCVKPVDAS
FT                   ASCPSADMSCNAYRKAGQNFGMTVQAMAWEDDRDTDFCSGNLPTPNFSDQAMTLTSKVF
FT                   APNIASGGHDGALGVASYSHAIQANNLNSITNQTISEVGVFQIAAQASPNYLGVASSLN
FT                   IPIGYSANIGRFVPDRFLVGDISVVPACGSFSYMDQLFPMSMSLKALNIGGAVTQNYFP
FT                   PFSLATAKLVGENNNNGIDLQSRLSALPVNAASWVQGVATVDGTYRAYLNRVTPNVTTN
FT                   LYQDGPFELLDIGVQLMDNDPRPNGLFSYVASPDMNAATTGNCTNCNAKKITSQILRHG
FT                   RVVMDNTYGPETEILRMPTRAEYWNGTNWVLNGDDSCTIATYSLESQVDNAGLGYNFDP
FT                   DLTTGQSINRSGATSAFQAGQFDLLWRALTSSGNLYRGQVTAPLNVPSWLEWYWDWNGL
FT                   SPTSLSDPRASAFFGRYRGHDRIIYWREVN"
FT   sig_peptide     541212..541334
FT                   /locus_tag="Shewmr7_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.845 at
FT                   residue 41"
FT   gene            545323..546372
FT                   /locus_tag="Shewmr7_0479"
FT   CDS_pept        545323..546372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0479"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: son:SO4098 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41482"
FT                   /db_xref="GOA:Q0HZH3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH3"
FT                   /protein_id="ABI41482.1"
FT                   /translation="MFKKLRGIFSNDLSIDLGTANTLIYVRDEGIVLNEPSVVAIRGER
FT                   SSSGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQVHNNSF
FT                   FRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAERIKHT
FT                   IGTAYPGDEVLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPP
FT                   ELASDISERGMVLTGGGALLRDLDRLLMQETGIPVMVADDPLTCVARGGGKALEMIDMH
FT                   GGDLFSEET"
FT   gene            546417..547478
FT                   /locus_tag="Shewmr7_0480"
FT   CDS_pept        546417..547478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0480"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: son:SO4097 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41483"
FT                   /db_xref="GOA:Q0HZH2"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH2"
FT                   /protein_id="ABI41483.1"
FT                   /translation="MKPIFVRGISNQFRLTLAIILSVILLAANHRLEPARESLSSALSP
FT                   IQYLASVPSAILDWSSESFATRNMLALQNKELLRQQLLMSERLQRFEHLRQENERLRAL
FT                   LGSPAYQDSRKMVAEVMEVASDPSHHYVVLNHGSRSGVFVGQPVVDAQGVVGQVVQVSE
FT                   MTSRVLLLSDVSHGLPVRITRNDVRLVANGTGELDEIELRHVAKSTDIRVGDLLVTSGL
FT                   GNRFPEGYPVARVMEVLTEDGQSYARVTAQPLAALDRIRYLLLIWPSPDSGVTLPNQLP
FT                   VPAADRPAEEAKPDAGTGSANPQGAAANASAPSSAAPNATAPNTTVPNTGATPSNTNGA
FT                   PNAATTQPPAEVH"
FT   gene            547478..547966
FT                   /locus_tag="Shewmr7_0481"
FT   CDS_pept        547478..547966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0481"
FT                   /product="Rod shape-determining protein MreD"
FT                   /note="PFAM: Rod shape-determining protein MreD; KEGG:
FT                   son:SO4096 rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41484"
FT                   /db_xref="GOA:Q0HZH1"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZH1"
FT                   /protein_id="ABI41484.1"
FT                   /translation="MSLQAANGRLVVWLTLFVGLLSQIMPLPSIVEAWRPDWLLMILIY
FT                   WSIALPHRYNILTAWLMGLALDILLGATLGVRSLAMSLVIYIAILHCQRLRNFPKWQQS
FT                   LVVMVLIVIYHLIIYWVEFVMDGAKFHTDLFLPALSGLAFWPWIFWILRRVRRHYKVR"
FT   gene            547969..548553
FT                   /locus_tag="Shewmr7_0482"
FT   CDS_pept        547969..548553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0482"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: son:SO4095 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41485"
FT                   /db_xref="GOA:Q0HZH0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZH0"
FT                   /protein_id="ABI41485.1"
FT                   /translation="MNLVLASTSPRRKELLTHIGLGRAEFSFSQVAPDIDETPKAGELP
FT                   RDYVQRLAAEKALAGLALCSGMSQPAVLGSDTIVVLENEILGKPVDEADAKRVLRALSG
FT                   KAHTVMTAVALAKADQTSVRLVETLVRFCVLSDADIDAYVASQEPMDKAGSYGIQGLGG
FT                   CFVESIEGSYSCVVGLPLVETRELLSEAGIR"
FT   gene            548707..550173
FT                   /locus_tag="Shewmr7_0483"
FT   CDS_pept        548707..550173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0483"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: son:SO4094 ribonuclease G"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41486"
FT                   /db_xref="GOA:Q0HZG9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG9"
FT                   /protein_id="ABI41486.1"
FT                   /translation="MGSELLINVTPSEARVALVEHGVLQEVHIERRMKRGLVGNIYKGK
FT                   ISRVLPGMQAAFVDIGLDKAAFLHASDIVPHTECVADVEKGHFVVRDIAELVRQGQDIM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGSSHVGVSQRIEQEEERSRLKKITLPFVD
FT                   EDGGFIIRTAAEGVGEDELAQDAAFLRRVWSKVSERRQRRGVALLYQDLALPVRIVRDF
FT                   VGTELDRIQVDSRRTFAELQAFAQEFMPEIADKIEHYSGPAPIFDLYDVENEIQRALGR
FT                   KVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNLEATQAIARQLRLRNLG
FT                   GIIIIDFIDMLSDEHKTRVLNSLNSALAKDRVKTNVSGFSGLGLVEMTRKRTRESLEHV
FT                   LCGECPACQGTGSMKTVETVSYEIFREIIRLNRAYDADEFLLYCSPAVYNSLSGDESHL
FT                   VAELEVYIGKRIRLQNEPMYSQHKYDVVMM"
FT   gene            550173..554426
FT                   /locus_tag="Shewmr7_0484"
FT   CDS_pept        550173..554426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   son:SO4093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41487"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG8"
FT                   /protein_id="ABI41487.1"
FT                   /translation="MATLFTAKKLSRFCWQLLALILVLFALTVSLIRGLLPQVDGVRQH
FT                   LVEYVKSEYQIDVQVGELSAQWQAFGPAVTVDNLVIPPQEKLPVAVLVRNVQIKLDFWQ
FT                   SLLTTSPRIEDVNFDGVHIALDIDKLSGTKAQGAAKQTSQTDWLYKLLLKQLERFSLTD
FT                   ASVQLLSLQHEYRPIHIRHLNWRNSGERHRGAGEIYLDNNAQENESLSLQLDIHGDATA
FT                   PDTLKGQIYLAAQSLDLGEWASRQPNPYDPSKKLPLEGVVNLKAWFDFAHRSVSAGLVQ
FT                   FEPSWLQWSMEGEPQKFEIQSGSISWLPKETGWEISSTDLDFVTNGEHWPDLKLAAKQQ
FT                   DDALYAYVSRVDLPTLFPLLPLFPGVDLAVLQQWFHLAPEGSVGPIRLYQSAKQPLLAS
FT                   THIKQLHWQKVEGIPNTNPLDLALQWQHDSLVFSLPEQTYTLDFGEQFSAPLVLHGAAL
FT                   TGAFDTQKATLSVPQVQLENDDIGVSAALKLDFSAAASMSLAANVAVKNAANADRYFPV
FT                   KAMGEALVEYLDGAIKAGQSQNAQVLWQGALAHFPFEDNSGVFQAAFSLDNAEYQFQPD
FT                   WPAVTALSLDALFENARMDIWVNQGKLMNVVADGAHVFIPELGEHSLLKIQADLATNGS
FT                   AATQVLQASPLADTVGKTLSVVQVQGAVTGSLDICIPLYEGEAEDIRGQIAFDNTPVFI
FT                   AQPGLQLKAVTGTVQFANEIVEGKGIQSRLFEQPFEFSFATKPEGKDFALNVDMKSRWD
FT                   LSRLPQELQNPLSEFYQGKVAWGGNLNMVFDDQGYQIQANVGSDLVGASLKLPGVFAKP
FT                   EDEPRPLMAEFSGDQQTATLRVKLDKQAEFIGGFEAEKGTQFSYFDLLLGRLFDVGEVS
FT                   NTEQGHIQIDVTSGKLINWLPVINAFVGTDHQPVRTGILVEEASHSALFPSVAGIDANI
FT                   GKFDLLGQGLTELRLSAKPNENGWRFDAVASEFEGTVDFYPNWMTQGLKVTANKFYFSP
FT                   EVKPEGEGDFAADQVLTNLPPVAVNVEDFRFFDKPFGKLVLQASPQASGYRIQTLSLTT
FT                   PEVSLQGNGIWQQQNGQNQTELTVSLNASQFNYLSQQLGIDPGVNEAPLKVNAELAWQG
FT                   APYAFSLETLNGKMKFELGKGHLSQVSDKGARIFSLFSLDSLVRKLSLDFSDVFGQGMY
FT                   FNSFSGNLQIDNGVVKTTDTEMDAIAGNMKVRGYTDLTSESLNYDIRFVPQLASSVPTV
FT                   VLISTSAWTLGLGAFALTKVLEPVIEVISEIRFRVTGTMSEPVVEELERKSKEIEIPES
FT                   ILPMVGGELPAPTEGAEPKTDAAPVKNSDPIKTNATPHVEPEKNNEQPAPDADKPKVEP
FT                   VKAVDEDTSPQAPTLPKVEPAEPPKAEPEQPKPVSPKVALSINTIQGDSHAHQPVAMSE
FT                   QSRRQRESVVYRIAA"
FT   sig_peptide     550173..550259
FT                   /locus_tag="Shewmr7_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.760) with cleavage site probability 0.379 at
FT                   residue 29"
FT   gene            554350..555198
FT                   /locus_tag="Shewmr7_0485"
FT   CDS_pept        554350..555198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0485"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: son:SO4092 hydrolase,
FT                   carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41488"
FT                   /db_xref="GOA:Q0HZG7"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG7"
FT                   /protein_id="ABI41488.1"
FT                   /translation="MRISLLQCQSSRDVSANLLFIESQLEELTRQRLQWDKDAPHLVVL
FT                   PECSLLFGGHESQQLAYAGDSHLSPLKSALSALAARYCVYMVAGTIPALAEDGRVYSRC
FT                   YLFDDKGDTLGQYDKLHLFDVDVADGTKQYRESETFCPGNHISVIDTPFGKIGLTICYD
FT                   LRFPDLFRALRLAGAEIITVPSAFTKVTGEAHWQVLLQARAIETQCFILAAAQWGAHNE
FT                   GSRETWGQSMVIGPWGEVIVEQKTGTGWVHADIDVAEVHSIRSKMPVAQHNRFTAPNLK
FT                   P"
FT   gene            555263..556756
FT                   /locus_tag="Shewmr7_0486"
FT   CDS_pept        555263..556756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0486"
FT                   /product="microcin-processing peptidase 2. Unknown type
FT                   peptidase. MEROPS family U62"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   son:SO4091 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41489"
FT                   /db_xref="GOA:Q0HZG6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG6"
FT                   /protein_id="ABI41489.1"
FT                   /translation="MSELPILAKLSERTAMPFLAQVEQSLLKGGLALDGLQSYLNTIHQ
FT                   HKVDFSDLYFQGSRHESWVLEDGIIKDGSFHIERGVGVRAISGEKTGFAYADDITPAAL
FT                   SAAAEAARGIAGAGEQAKVQAFKRQQVFALYDSLDPIAAMEEVKKINLLKEADAYIRSL
FT                   DSRIIQVVISLAGVHEEILVAASDGTLAADIRPLVRFNCSVILEENGKRERGSAGGGGR
FT                   HDYSVFMVTDETGLPMCFAFAREAVRQAQVNLNAIDAPAGEMPVVLGNGWPGVLLHEAV
FT                   GHGLEGDFNRKGSSAFSGMVGEQVASKLVTVVDDGTLANRRGSLSIDDEGVQTQRTVLI
FT                   EDGILKGYMQDKLNARLMGVAPTGNGRRESYAHLPMPRMTNTYMTAGESDPSEIIKSVK
FT                   KGIYAPNFGGGQVDITSGKFVFSASEAYLIENGEVTQAIKGATLIGNGPEAMSQISMVG
FT                   NDMALDKGVGVCGKDGQSVPVGVGQPTLKLDRLTVGGTA"
FT   gene            556819..558288
FT                   /locus_tag="Shewmr7_0487"
FT   CDS_pept        556819..558288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0487"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   son:SO4090 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41490"
FT                   /db_xref="GOA:Q0HZG5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG5"
FT                   /protein_id="ABI41490.1"
FT                   /translation="MLSFAKEIRVTTLEVLMKLSRLAWLCLLPLPSLLPLAANAQPSSF
FT                   TEAWQQVLKVSDKLQAQSQEVNRAKGEQEAGESLNLPSLSLNGSYTHLEKPIELDLRDL
FT                   NPLASLDPATLPPALGGALASIPGSLFVTPFTEQDIFRASLQAMWPIYTGGQITAAQGI
FT                   HAAMVAEKQQELQLATRDLFTQLVDRYYAVDVTQSLVSTQTELVASLTKHVDHALALER
FT                   EGQIAKVERLNAQVALDNAKVNLGSARRQHEMAVIALSRMLQQSDVSTNSPLFVLPQAP
FT                   SLGDLTQVTLSQHPALKLLEAKEAQANGLVSLEKGKYHPTVFLFGNYTLYEDDSLFSKV
FT                   EPDWMVGVGVKVPLLSRDGRSGKVEAAKSALLQARYTKAQTRQDLSLLLDQSYRQLLQA
FT                   EEEVKALNTSLELASENLRLREIAFNQGLSTSIDRVDAELKLSAVKTQQLGASYRYVQA
FT                   YARLMAISGQLDEFIGRSATGAQSQETINAR"
FT   sig_peptide     556819..556941
FT                   /locus_tag="Shewmr7_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.978 at
FT                   residue 41"
FT   gene            558278..559252
FT                   /locus_tag="Shewmr7_0488"
FT   CDS_pept        558278..559252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0488"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   son:SO4089 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41491"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG4"
FT                   /protein_id="ABI41491.1"
FT                   /translation="MRANRILALTALVALGLILAYGLKLAYSPAPSLLQGQIEAREYNV
FT                   SSKVPGRVEQVLVRRGDSVSEGDLLFAIHSPELDAKLMQAEGGRDAAKALQQEANNGAR
FT                   TQEVMAAKEQWLKAQAAATLAKTTYTRVENLFNEGVAARQKRDEAFTQWQAAKYTEQAA
FT                   LAMYQMAEEGARVETKAAAAGNARMAEGAVKEVSAIMADSQMRAPKSGEISEVLLQAGE
FT                   LAPSGFPVVSLIDMQDAWAVFQVREDQLKRFKKGDKLPLTIPALDKTVEFTVAHISVMG
FT                   DFATWRSTESGHDFDMRTFEVELRPTAPIPDLRVGMSVLLSAE"
FT   sig_peptide     558278..558340
FT                   /locus_tag="Shewmr7_0488"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.710 at
FT                   residue 21"
FT   gene            559258..560547
FT                   /locus_tag="Shewmr7_0489"
FT   CDS_pept        559258..560547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0489"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: son:SO4088
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41492"
FT                   /db_xref="GOA:Q0HZG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG3"
FT                   /protein_id="ABI41492.1"
FT                   /translation="MAKSPSESKPLNKFQNAAHPASSGFLAQLVALVRRELRALWRDPW
FT                   QLALISYIPLLGILCLWWLFSAGLPRQLPVAIVDQDHSQLSRMLTRQLKANPVTEPRSF
FT                   TDLPSAVAAMQQAQVYAVVVFPHDMKKDLLTGHKPTIDVRYNSQFLLVGKLLSSQIQLS
FT                   LGDGLLQIAGLKQLMTGTPKSQVAVNLSPVKSQTTALFNRNNNYIGFLVPPVLVALWQL
FT                   LSMLVMANSLNRELHLNAAQSEEGISNRLTEHFWPKVLGKILLFSPILMLQGGFILAWL
FT                   YLYLALPFAGSLALLLVAQLFMLLAVWSLVLFIFVLMRDSARVISFCTALFAPAFAFMG
FT                   ITFPTHEMPQLAQWWRLIMPSSHYIESHVSVVSYGAAWPTVAQQLSSYWGFIGLLPLIY
FT                   LLAHKLLPMTVKAQAEATEYHAAPLPAKGQ"
FT   gene            560549..561700
FT                   /locus_tag="Shewmr7_0490"
FT   CDS_pept        560549..561700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4087 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41493"
FT                   /db_xref="GOA:Q0HZG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG2"
FT                   /protein_id="ABI41493.1"
FT                   /translation="MNLWQLVLTELKAIVSDKAIAVTLFGGVLFYSVLYPLPYLHQVPT
FT                   EQQLIVVDLDHSSLSRQLIRHADASAKIQVIGQVGSITEAKRFIETGKAHGLLVIPEGF
FT                   RRDLLLGKGVTLSYGGDASYFLIYSAVAEGLVSAGMDAGKQVQLIGMLAQGKNPKEAEQ
FT                   NLNSLHLNSVPAFNPSLGYTPYVVPGLFLLILHQTLLIGTGILGAGQWRSRSYWQQVSP
FT                   LQLVCGRILAFMLIYMVFTSFYVGYCYHWYKVSIQASLGLVALWLLPFLLATAAAGVAM
FT                   STLFSRRDLPTQVLLLISMPILFVSGFVWPIALIPEPLVLGSQIIPAVPAIMGMLELNQ
FT                   MGASWASVLPKWLQLWGLFVLFFGLAILGIKRRARALAEPSTS"
FT   gene            561869..562270
FT                   /locus_tag="Shewmr7_0491"
FT   CDS_pept        561869..562270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41494"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG1"
FT                   /protein_id="ABI41494.1"
FT                   /translation="MRKITLVSLAMGTCLLAACAAKPPIVAQEKTVEVDGINLVFGGSY
FT                   DTERKNISLSVNGDSVMKGTFPPYTPTQNLSGKYKGYTISSQCYFGSVLSSQGGAFGAI
FT                   AGVIQSTKSSSGDKCDMLVNGKIVESLYF"
FT   sig_peptide     561869..561931
FT                   /locus_tag="Shewmr7_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.741 at
FT                   residue 21"
FT   gene            562764..564095
FT                   /locus_tag="Shewmr7_0492"
FT   CDS_pept        562764..564095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0492"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   son:SO4081 amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41495"
FT                   /db_xref="GOA:Q0HZG0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZG0"
FT                   /protein_id="ABI41495.1"
FT                   /translation="MSQQNPGLKQSLSLWQVVVMGLAYLTPMAVFDTFGIVSEITSGHV
FT                   ATSYLLALAGILFTAFSYGHLVRKYPYAGSAYTYAQKTFSPNVGFMVGWSSLLDYMFMP
FT                   MINMLLAKIYLTAMFPNVEPWIFIFGLVAVMTVLNLRGIDLVANFNGVIVFVQIAIILV
FT                   FIGLMAHSLSLGEGEGVIASVRPFYSEEISLAPLFTGATILCFSFLGFDGLSSLSEETK
FT                   DAKRVIPRAIVLTALIGGVIFVSVSYFLQLFFPDISRFQQLDAVLPEIALYVGGNLFQS
FT                   VVLVATTIAVLASGMAAHAGVARILYVMGRDNMLPNKGFGYIHPKWRTPAFNVILVGLL
FT                   ALSAVSFDLEMALALVNFGALVAFTFVNLSVIVQFYIKEKRNQSLKDHFQYFALPLCGA
FT                   ATIGVLWLNLEPQSLELGLIWAAVGVLYLALRSLRLRKAVELQN"
FT   gene            complement(564149..566638)
FT                   /locus_tag="Shewmr7_0493"
FT   CDS_pept        complement(564149..566638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0493"
FT                   /product="Ig domain protein, group 1 domain protein"
FT                   /note="PFAM: Ig domain protein, group 1 domain protein;
FT                   KEGG: son:SO4080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41496"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZF9"
FT                   /protein_id="ABI41496.1"
FT                   /translation="MRFSNTFCNLTLLSIGLFGLWGCNGPSDEDNGGTDASDGIYKLSI
FT                   DFKTLSGSQCGSFTSLQSFPKDAGFCAVAKLNKGSAKVSNQRVNFTTDLGALTPESKLT
FT                   DNNGEAVVIVSNPDLLINAGTITATTTPSDSSTALSATRNFEFTGTIDGTGASIAPKLS
FT                   ASILSGANVVTRFKVDEAVQLQAIFLDAESKGITDAKVSFSAGSATLTPASTLTDKQGI
FT                   AQVTYTPSATELGANALTVTVEYQGQSLQSSSLYEVLSKDAVNEAGTLKLGSFNGSSFT
FT                   EGKLASTLTAQADGSYKISAGGSFGVTASLVLEASDGTVTRVQTPSSISFSSDCTASNN
FT                   ASLDSPVTTLSGNASSTFQDTSCSGNSERNDQIVATTVVGNQTLTANFPFTLQRQTLAS
FT                   LSFEAAEPNQIRIKGAGGTGSSESSLVSFKVTSANGQPAAQQKVSFSLDTVVGGLSFAN
FT                   GSASAESLTNSQGIASVRVLSGTVPTPVRVVASAVDADTKEVISSQSEQLTVNTGLPQQ
FT                   LGFSLSTTIFNPEAGDYDGETATITARLSDSFGNPAPDDTTVNFNTEGGQIAPSCLTQN
FT                   GACSVTWTSGAYRPQDHRITILAYALGHETFFDTNGNNQFDSADGGAITNACLFNGVAT
FT                   NCSGNGMDVETFHNSGFSDLPTAFRDDNENFSYDSGERYFDNLARDTYPVADGKFNGPQ
FT                   CEGSLCGTGQANKIYVRKALVLSMSGSQAYISVQQDGVLLASVNDIKPVAAGTESKFVV
FT                   FVHDSAKQIMPAKTQIELCVDCNGTPDTIEVANTLTGKNGLGTPLSFTASAGSQISVVA
FT                   TTPKQVKTTLNFTVPTL"
FT   sig_peptide     complement(566570..566638)
FT                   /locus_tag="Shewmr7_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.652) with cleavage site probability 0.546 at
FT                   residue 23"
FT   gene            complement(566669..567202)
FT                   /locus_tag="Shewmr7_0494"
FT   CDS_pept        complement(566669..567202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0494"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   son:SO4079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41497"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZF8"
FT                   /protein_id="ABI41497.1"
FT                   /translation="MKIVGDSEHFKQPYDSDEEYVSKTEDKRDCEAAQKVGMELVSLSK
FT                   TQLDKIELDEHLYDSIQQAHKIKPKTEAYRRHMQYIGKLMRNVDVEPIKAALAIVLNKN
FT                   NNETAKLQMFEKMRERLLSQGDSEIQTLVEHYPQLDRQKLRTLVRQATKELAKGPESKS
FT                   SKELFKYLRSEIQD"
FT   gene            567378..568721
FT                   /locus_tag="Shewmr7_0495"
FT   CDS_pept        567378..568721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0495"
FT                   /product="microcin-processing peptidase 1. Unknown type
FT                   peptidase. MEROPS family U62"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   son:SO4078 PmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41498"
FT                   /db_xref="GOA:Q0HZF7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZF7"
FT                   /protein_id="ABI41498.1"
FT                   /translation="MSLNRIDSELAALKDAVAVALEYANKLGTNAAEVAISKQQGLSVS
FT                   TRLKEVETVEFNKDGALGITVYRDGCKGSSSTSDLSPEAIALAVKAADDIARYTSADPF
FT                   SGLADKALMATEIRDLKLYYPEEISPDELAQLAIRAETAALDADPRINNSDGASANAHT
FT                   SVKVYGNSHGFLNGYCSSRYSLSCSVIGEDSDGSMQRDYDYTIARKFSEMLSPESVGLK
FT                   TAQKTVSRLGARKIATSRLPILLSPEIATGLIGHLVGAISGGSLYRKSSFLLDAIHTQI
FT                   FPDWFNIEEQPHLLGALASANYDSEGVATQDRRIIDRGMLESYLLTSYSARKLGLTNTG
FT                   HAGGIYNWTLAHTGQSFDELVKGMGTGLIVTEVMGQGVNMVTGDYSRGAAGFYVENGEV
FT                   QFPVEEITIAGNLKDMFRGIQAVSKDFDLRSSIRTGGILLSEMKVAGN"
FT   gene            complement(568830..570971)
FT                   /locus_tag="Shewmr7_0496"
FT   CDS_pept        complement(568830..570971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0496"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: son:SO4077 TonB-dependent receptor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41499"
FT                   /db_xref="GOA:Q0HZF6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZF6"
FT                   /protein_id="ABI41499.1"
FT                   /translation="MEDKTMAANTSTIPHGFKCSAIASALTLALGASVASQAMADETNQ
FT                   TQIERIQVHGEQSIGRNALGAADALLKDQGVDFSEAGGVSALPVLNGMMGDRIKVLVDG
FT                   ADITASCANQMNPPLSYVSANQISSVEVVAGVSPVSAGGDNIAGVIKVNSLKPKFSDSD
FT                   NLSFESGEISSGYRSTSDAFLLGAKAGIASKNLSFSYQGAYEDANSYHDGHGDKVLDTL
FT                   YRAQNHALTAAWRDDKQQLAIKLTHQAIPFQGFSNQYMDMTDNKSYGALVRYLRDLDND
FT                   GEFSAQLNWHSVKHEMGFFTPEKTGKMPMNTEGSDYSYQLHWRLPMGEDSTLLVGQEYY
FT                   NYQLDDTWPAVPGTMMAPNDYININDGERRRAAVYGEWQQNLTPVWWLSAGVRYEYVTT
FT                   DTGEVQAYSNMPMMGMPNMDAEAAKAFNAMDRSRDDNLIDTTLLARYQLSAKQQLEFGL
FT                   ARKNRAPNLYERYSWGRGVMATTMIGWYGDGNGYVGNPDLKPETAHTLSAVYKFAGDEW
FT                   QFSTTAWYSAVTDYIDAEVIGSFNRSGLANGKRNILKFTNEDAHLYGAKLSANYLLADT
FT                   DSGKWQMQGKLNITRGERDEGNEPLYQIKPLQTELALSHQLGDWENRLSWQWVATKDKV
FT                   DDRRLENETDSYSLLNLSSSIKWQELSLTFAINNLFDTYYELPLGGVNLAEFKADSSGG
FT                   FSQVAGSGRSFELGASYRF"
FT   sig_peptide     complement(570849..570971)
FT                   /locus_tag="Shewmr7_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 41"
FT   gene            complement(571132..571977)
FT                   /locus_tag="Shewmr7_0497"
FT   CDS_pept        complement(571132..571977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41500"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZF5"
FT                   /protein_id="ABI41500.1"
FT                   /translation="MQFAVIYRPLLSLVFLLVSLFPSLAQAFSSSECIITMGYRTSERL
FT                   PFIQHEPNNQGFYHDIYQAAAERIGCKLRITRAPKMRILRDLKLGNIDFYPGLSFSEER
FT                   AQFAFFIPNGLSERAIGISRAGAADIRSLEQLSQSGMTLLIAPGSYDFNGLPETMSVRK
FT                   PPELDVPKALDYLLASQGDFFIYDQATISYYLKQRDMGQFKLHPNCCQQPQAMYLGFSK
FT                   KSRHFRGQHNPNYRADLPVSADNSPNRLAEDSKAYEFAKALAAMDAEGETQRIYFNHFG
FT                   "
FT   sig_peptide     complement(571894..571977)
FT                   /locus_tag="Shewmr7_0497"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.880 at
FT                   residue 28"
FT   gene            572233..572460
FT                   /locus_tag="Shewmr7_0498"
FT   CDS_pept        572233..572460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0498"
FT                   /product="protein of unknown function DUF331"
FT                   /note="PFAM: protein of unknown function DUF331; KEGG:
FT                   son:SO4073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41501"
FT                   /db_xref="GOA:Q0HZF4"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZF4"
FT                   /protein_id="ABI41501.1"
FT                   /translation="MAKLKETSVLEHENGRGTITDNALKAVVTSSLFRMRTEKPKKGKG
FT                   SYNRKAANRKGYQHRGDTPFDFMGVCLTGA"
FT   gene            complement(572762..574192)
FT                   /locus_tag="Shewmr7_0499"
FT   CDS_pept        complement(572762..574192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0499"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /note="KEGG: son:SO4072 MiaB-like putative RNA modifying
FT                   enzyme YliG; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   MiaB-like tRNA modifying enzyme YliG; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; protein of
FT                   unknown function UPF0004; Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41502"
FT                   /db_xref="GOA:Q0HZF3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZF3"
FT                   /protein_id="ABI41502.1"
FT                   /translation="MTVETFNPKQTTTLETPAKTLEAASADSTATGNRIGFVSLGCPKN
FT                   LVDSERILTQLRIDGYEVTNSYDNADLVIVNTCGFIDAAVEESLDAVREALEENGKVIV
FT                   TGCLGAKENQIREVHPDVLEITGPHSYEAVLKHVHKYVPKPEHNPFTSLIPQTGVKLTP
FT                   KHYAYLKISEGCDNRCTFCIIPALRGDLDSRPAGSVLDEAKRLVESGVQEILVVSQDTS
FT                   AYGKDKGGRTDFWNGMPVKQDITSLARQLGKMGAWVRLHYIYPYPWVDDLIPLMAEGLI
FT                   LPYLDIPMQHASPRILKMMKRPGRVDRQLEAIQRWREICPDLVIRSTFIVGFPGETEED
FT                   FEMLLDFLREARLDRVGCFKYSEVEGAVANTIAELISEDVKEDRYHRFMEVQAEISAER
FT                   LARFVGRTMDILIDDVDEEGAIGRSFADAPEIDGMVFINGETELEPGMLVRAVITHSDE
FT                   HDLWAELVDADAEDDIEA"
FT   gene            574613..575323
FT                   /locus_tag="Shewmr7_0500"
FT   CDS_pept        574613..575323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0500"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   son:SO4070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41503"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZF2"
FT                   /protein_id="ABI41503.1"
FT                   /translation="MKHSLLAVLVAGGLFSGVFTAKAMAADVDFPHIETMGVSQIQVEP
FT                   DMAELNVEVAVTEKEAKAAKDNSDAAVAKFIARLTAAGITKEQIQSANLNLQPQYVYAQ
FT                   DKAPELSGYTASRQITVTISDLARLNTILDSALEEGINRVNNIALKSSKEAEYVAKARQ
FT                   AAIVDAKQKAESLAKGFGENLGKVWQIRYYDQRPVQPVMLRMNAKADAMGAAESYQYGQ
FT                   VTIEDRVEVVYKLK"
FT   sig_peptide     574613..574690
FT                   /locus_tag="Shewmr7_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            575594..576385
FT                   /locus_tag="Shewmr7_0501"
FT   CDS_pept        575594..576385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0501"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: son:SO4069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41504"
FT                   /db_xref="GOA:Q0HZF1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZF1"
FT                   /protein_id="ABI41504.1"
FT                   /translation="MSSNALYTDLSGYYDLMCSDINYQQQSASIHRLHQFLGNNGKQHL
FT                   DLACGTGPHVRHFIDLGYQCRGLDINQPMLDMAMRRCPEAQFNLQDMTAFYLEQPVDLI
FT                   TCFLYSIHYSAGIERLKSCIASVHRALNDGGIFCFNSVDKHRIDNRLSIKHFAEFEGHH
FT                   FAFESGWHYSGQGENQSLNLSIAKSLQPFTQQADVDVDVDTSAHQTELWQDQHTMVATS
FT                   FAELQALLAPYFEVHIFEHDYEKIVPWDLSSGNALFVCVKI"
FT   gene            577157..578359
FT                   /locus_tag="Shewmr7_0502"
FT   CDS_pept        577157..578359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0502"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); KEGG: vfi:VF1044 RNA-directed DNA
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41505"
FT                   /db_xref="GOA:Q0HZF0"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZF0"
FT                   /protein_id="ABI41505.1"
FT                   /translation="MAFRYDFIKRNRNSISNIPNLLDALGIEEVQFEQFKNLNDLDKYK
FT                   PSSVPKSDGKSRTVYNPAQLIRLFQRRINTRIFHPKHSQGGLISWPSYLFGSIPNNPQS
FT                   PENSNKNYITCAGMHCGAKSILKMDISDFFDNIHHREVINIFEGLLKFPNDVSQTLADI
FT                   CCYKGNVIQGALTSSYIASAVLFDVEPNVVRRMHEKHLVYTRLVDDITISSKIYDYDFS
FT                   YAKNIVIDMLRKKGLPTNEDKTIVINSSTKEGLVHGLRVCFKEPRLPADEVGKIRASVQ
FT                   HVERFARDAEFRTSREYRRIYNRCLGRVNRLKQLGHNQYQNLKDRLIKIEPKPCKADIK
FT                   KARSLVRKVKTLHKDYGSGYRYRRLYYKAQYELNILQRTFSVTADSLRKQLRRVKPTYE
FT                   Q"
FT   gene            578349..579059
FT                   /locus_tag="Shewmr7_0503"
FT   CDS_pept        578349..579059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF1045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41506"
FT                   /db_xref="GOA:Q0HZE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE9"
FT                   /protein_id="ABI41506.1"
FT                   /translation="MNNKNEMSILILVLKILAWVGGITTSLIAIFYYLDSGYYEQDLCF
FT                   ETKCIKAFFNIFYSIPEFVDFYLKVVVAVITILGVFYALSNYLNSTTTSRLNVHLLHLN
FT                   TFKDYVVSEVNKEVRLNSKSIDILKWYNLAFPQSRDGSLKVGGEYISNIKLIINEINNS
FT                   NDIYQGNKLVEFQYNKHQSNIKLSLLSIGIMIDRMPKKDFFEVENEVFKLINKVNKELC
FT                   NVSADLIVPMTKYR"
FT   gene            complement(579498..580601)
FT                   /locus_tag="Shewmr7_0504"
FT   CDS_pept        complement(579498..580601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0504"
FT                   /product="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="PFAM: SAICAR synthetase; KEGG: son:SO4066
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41507"
FT                   /db_xref="GOA:Q0HZE8"
FT                   /db_xref="InterPro:IPR014106"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZE8"
FT                   /protein_id="ABI41507.1"
FT                   /translation="MSLADSVLAVNNDLPIRTDSPVHSGKVRSVYWLTDADSRRLIQTK
FT                   GYNVPEDTPLAIMVISDRISAFDCIFHGEGGLKGIPGKGAALNAISNHWFKLFAENGLA
FT                   DSHILDIPHPFVWIVQKARPIKVEAICRQYITGSMWRAYSKGERVFCGITLPEGLEKDQ
FT                   KLPDLLITPSTKGILTGIPGVPAQDDVNISRSDIEANYQAFGFEKVEDIDLYEKLLKDG
FT                   FKVIAKALADLDQVFVDTKFEFGYVTDKNGNSKLIYMDEVGTPDSSRIWDGAAYRDGKI
FT                   LENSKEGFRQFLLNHFPDPDILLNKDRMPEREALARDNALPLEAMMDVSRTYTGIAEKV
FT                   TGAAIPLPANPKADIIKILREEYDLIV"
FT   gene            complement(580588..580899)
FT                   /locus_tag="Shewmr7_0505"
FT   CDS_pept        complement(580588..580899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41508"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE7"
FT                   /protein_id="ABI41508.1"
FT                   /translation="MVSLFEQNGTGFPRLNRPDSLWRQPCSACYFYPLSRPSLSYLSPE
FT                   NILFALRFNLTNLLCALSDKLLVNNKKVAKHLRLKHTATNKKLVPTLSIQRNTRHESC"
FT   gene            581306..581932
FT                   /locus_tag="Shewmr7_0506"
FT   CDS_pept        581306..581932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0506"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: son:SO4064
FT                   mcbg protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41509"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE6"
FT                   /protein_id="ABI41509.1"
FT                   /translation="MTDVKTPMMARAAAEGRYFFSQQFLALAESQTQWQELEFEECEFH
FT                   DCQFSDSTFRNCKFIDCRFVGCNLSLLKVPLSQFNGVRFEECKLVGIDWTRAAWPRLSF
FT                   AAPFSFSTCILNDCSFMGLQLDEMVLEGCKAQDVDFREGKFNRANFSYSDFRHSLFGRT
FT                   ELMEADFSEATDYDIDIFNNKIKGAKFSRDEAIRLLNGLEITLVD"
FT   gene            582409..584703
FT                   /locus_tag="Shewmr7_0507"
FT   CDS_pept        582409..584703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0507"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: son:SO4062 polysulfide reductase,
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41510"
FT                   /db_xref="GOA:Q0HZE5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE5"
FT                   /protein_id="ABI41510.1"
FT                   /translation="MEVTMIELNRRTFLKGAGASGATCALASLLPGSLAALESKQLKGM
FT                   GKDIASICEMCSTRCPISARVIEGKNVFISGNKAAKSFGGKVCARGGAGHSLLYDPQRI
FT                   VKPLKRVGERGEGKWAEISWDEAYQLIADNLNKIKQAYGPEAVAFSSKSGSQEKHLFHL
FT                   ATAFGSPNTFTHASTCPGGYEIAAKAMFGTKVKRDLSNSKYIINFGHNLYEGINMSETR
FT                   GMMAAQMDKGAKLVVFEPRFSIVADKADEWYAIRPGTDVAVALALCHVLIEDNLYDKAF
FT                   IERYVEGFDAFAAEVKAYTPEWAETVSDVPAKDIRRIAHEYAAKAPHAVVDFGHRATFT
FT                   TEEFEMRRALYAANILIGNIERKGGIYLGQKPGDYNKLAGESVAPLLGKPGVKDMPKPT
FT                   AKRIDQVEEQYAMMWSSGGIYQTILDATLTAVPYQLHGWVMSRTNPMQTMTDRARVVEA
FT                   LKKLDFVAVCDVYISETAAYADVILPESTYLERDEEIADKSGKNPAYYVRQRVVETLGD
FT                   TKPSWQIFKDIGHKLGLSEFYPWDNMETLQLLQVNRDTALLRRIKDEGFVSFGKPIMLR
FT                   EPKMVAEFTKAYANAKAVDEDGTYGSLLSFKTPSGKIELTSAKVEAMAPGRGVIKFREV
FT                   HLKKADELYFIQGKVAVHTNGATHNIPMLANLMSDNAIWVHPVTAGKLGISNGDPIRLT
FT                   SSVGSEEGHALVTPGIRPDTVFAYMGFGSKNKELVRATGKGIHCGNLLPHQTAPVCGMN
FT                   IHTTGVTLAKR"
FT   sig_peptide     582409..582519
FT                   /locus_tag="Shewmr7_0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.666 at
FT                   residue 37"
FT   gene            584716..585282
FT                   /locus_tag="Shewmr7_0508"
FT   CDS_pept        584716..585282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0508"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: son:SO4061 polysulfide reductase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41511"
FT                   /db_xref="GOA:Q0HZE4"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE4"
FT                   /protein_id="ABI41511.1"
FT                   /translation="MTKRYVMVHDENKCIGCQACNVACRSENGVPEGVTRLQVRVEGPF
FT                   GEMPHLHFKYHRVSCQQCEDAPCVKVCPTGAAYVGEDGIVSIHSDKCVGCMYCVAACPY
FT                   KVRFMNPETKVADKCNFCKDTRLARGEEPACVTVCPTDALVFGDANDPQSEVAMLLNTK
FT                   ITYQDKTHLGTQPRVYRVPTKRGGI"
FT   gene            585285..586229
FT                   /locus_tag="Shewmr7_0509"
FT   CDS_pept        585285..586229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0509"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /note="PFAM: Polysulphide reductase, NrfD; KEGG: son:SO4060
FT                   polysulfide reductase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41512"
FT                   /db_xref="GOA:Q0HZE3"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE3"
FT                   /protein_id="ABI41512.1"
FT                   /translation="MNNTWGDMAQYDPVTWHWIIAVYLFMAGLSAGSLLIGIGLRWFNK
FT                   EQAQGETSILKAAAIIGPVAICLGLACLVFDLTKPFHFWLILINYNFQSVMAIGVLALL
FT                   AYSPLAFAYAILVLRDELPKWGLGFLVPIAKLLMPFRKPIEVLLFILAIGVGAYTGFLI
FT                   SAMNAYPMLNTAVLPALFLVSGLSAGAAANVVLALVMFKTDSHDKTLAKMHGLELPVMA
FT                   IEIMFLFMLFCALYFKGGAAAAALASLTSGVWASVFWIGVVGIGFGIPLLFMLLPTATR
FT                   HSKGAMIMVACASLTGVLALRHFIVYAGQSYLS"
FT   gene            complement(586343..587086)
FT                   /locus_tag="Shewmr7_0510"
FT   CDS_pept        complement(586343..587086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0510"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   son:SO4058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41513"
FT                   /db_xref="GOA:Q0HZE2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE2"
FT                   /protein_id="ABI41513.1"
FT                   /translation="MFSLIDPQTLAIASVIVFLGALTQSLIGFGLAVVASPLLYIVDPE
FT                   LVPAPVIMMGFSIALLTLLRERGHLEFNGLQYALIGRVPGGFIGASLLLFAPQPILGLA
FT                   IAGIVAVAVVLSLYKLTLPVNKATLFGAGVVSGIFGNIAAIGGPPMAILLAGKDASKFR
FT                   AALSAFFIFSSTIALVILGVTGLLEIKHLWLSLMLLPSVFLGYLVAGKLVGNVDKHKTK
FT                   MATLALCAISALVLTVKSVIELLPQ"
FT   sig_peptide     complement(586979..587086)
FT                   /locus_tag="Shewmr7_0510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.717) with cleavage site probability 0.504 at
FT                   residue 36"
FT   gene            complement(587188..587502)
FT                   /locus_tag="Shewmr7_0511"
FT   CDS_pept        complement(587188..587502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0511"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG: son:SO4057
FT                   met repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41514"
FT                   /db_xref="GOA:Q0HZE1"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE1"
FT                   /protein_id="ABI41514.1"
FT                   /translation="MTEWNGEYISPYAEHGKKNEQVKKITVSIPLKVLKVLTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAYTGQPLPNDADLSKDCPDSIPAEAKRLMDEMGIEWEDME
FT                   "
FT   gene            587707..588888
FT                   /locus_tag="Shewmr7_0512"
FT   CDS_pept        587707..588888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0512"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: son:SO4056 cystathionine gamma-synthase;
FT                   TIGRFAM: O-succinylhomoserine (thiol)-lyase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41515"
FT                   /db_xref="GOA:Q0HZE0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZE0"
FT                   /protein_id="ABI41515.1"
FT                   /translation="MTAGKLVTERQLATLAVRQGIESDTQYGAVVPPIYLSTNYAFDGH
FT                   KNPREFDYSRSGNPTRSILGDALAKLEKGATGVVTCTGMAAITLVTTLLGPDDLLVVPH
FT                   DCYGGSYRLFTNLAKKGQFKLLVVDQTDTQALEQAIAQQPKMVWIETPSNPLLRVVDIE
FT                   AIAKASHAVGALVVVDNTFLSPILQQALLLGADIVIHSTTKYINGHSDVVGGAVIAKDP
FT                   QLGETLHWWSNTLGLTGSAFDSYQTLRGLRTLAVRIREHQSNAQRIVDVLTSSPVVSKV
FT                   YYPGLADHPGHAIAAKQQKGFGAMLSFELKGGEAEVVAFLGALSLFSVAESLGGVESLV
FT                   AVPATMTHRAMEPQARYEAGIKDTLLRLSVGIEDAEDLVADIQAGLAAVAACQ"
FT   gene            588900..591293
FT                   /locus_tag="Shewmr7_0513"
FT   CDS_pept        588900..591293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0513"
FT                   /product="aspartate kinase / homoserine dehydrogenase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: son:SO4055 aspartokinase II/homoserine
FT                   dehydrogenase, methionine-sensitive; TIGRFAM: aspartate
FT                   kinase; PFAM: aspartate/glutamate/uridylate kinase;
FT                   homoserine dehydrogenase; homoserine dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41516"
FT                   /db_xref="GOA:Q0HZD9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD9"
FT                   /protein_id="ABI41516.1"
FT                   /translation="MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKT
FT                   TNFLYKLLSLRDSNQLWQEELQVLISYQQGLIEQLLSNEQARDLRERLTTDKAQLISLL
FT                   SLDSRNDYQISHVVSFGERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQE
FT                   SRAKVQALLAAHPNERLVITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWT
FT                   DVEGVFNADPNKINDAKLLKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSY
FT                   ASHTDFTLIAPHSSSASAPVVTNLNAVVLFGFKIAGDVANLLEQLVEAGLTPLAHWVSA
FT                   HQRLELAYTAENQKQVQKLLDAQAEALGIKDLQINTELGLVALVSADAEHYRRSFARLL
FT                   SRDAKPLFSGDLSLVTLVPQSQVNLLTQKVHRRCAGPRKRIGVLLLGVGNIGEAWVKLF
FT                   KSVSPSLNQELEARVELVGLVSSSKALIKSTAVDLENWQQEFDAEATPWQYEHLFEQLE
FT                   QLNCDELIALDISASASLTLQYPEFFERGIHMVSANKLAGSGPLPFYRELKEQLGYRRL
FT                   FWRYNASCGAGLPIQHALNDLRNSGDTVEAVGGIFSGTLCWLFEKYDTSKPFSELVVEA
FT                   RGLGITEPDPRDDLSGRDMQRKLLILAREIGLEIELEDIELRSLVPAHLADIPLEQFLA
FT                   RIAELDDELQQQYGAAAEQNKVLRYVASLDNSGAALKAEVGLQWIDANHPYANLTPGDN
FT                   VFVIRSAFYQGNPLIIRGPGAGREVTAAAVQSDLTQICRDLLQE"
FT   gene            591597..592490
FT                   /locus_tag="Shewmr7_0514"
FT   CDS_pept        591597..592490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0514"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: son:SO4054 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41517"
FT                   /db_xref="GOA:Q0HZD8"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD8"
FT                   /protein_id="ABI41517.1"
FT                   /translation="MAFHHAQHSHSLNQSLSELNGDINVSFEFFPPSTPEMEQILWNSI
FT                   RRLEPLNPKFVSVTYGANSGVRDRTHGVIERIQKETNLVAAPHLTLVDASDEELLDLAK
FT                   HYWKSGIRDIVALRGDLPAGSPKPTRFAADLVRLLRSVADFDISVAAYPEVHPDAANAQ
FT                   ADLINLKRKIDAGASRAITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVTNFTQLKR
FT                   FAGMTNVSLPSWLHKQFDGLENDAGTRQLVGANVAIDMVKVLSREGVKDFHFYTLNRAE
FT                   LTYAICHTLGVRPKAV"
FT   gene            complement(592557..592673)
FT                   /locus_tag="Shewmr7_0515"
FT   CDS_pept        complement(592557..592673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41518"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD7"
FT                   /protein_id="ABI41518.1"
FT                   /translation="MRLKTIFPNATSMQTARAGDELAQLSMRLTTLLSQFKI"
FT   gene            592858..593334
FT                   /locus_tag="Shewmr7_0516"
FT   CDS_pept        592858..593334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0516"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: son:SO4052
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41519"
FT                   /db_xref="GOA:Q0HZD6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD6"
FT                   /protein_id="ABI41519.1"
FT                   /translation="MMQKELERLKELSLAEHLGRLHRLWRTVADVELAPLGLTHPRWTA
FT                   LWKLLRLGDNVSQKVLADALEIELASLMRTLGQLEEQGLVERYCCTKDKRARIVSLTPA
FT                   GKDVLKQVEARIIQVRAELLAGISASELSEFERIISLISDNALAKLAKCTEILE"
FT   gene            593343..594401
FT                   /locus_tag="Shewmr7_0517"
FT   CDS_pept        593343..594401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0517"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   son:SO4051 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41520"
FT                   /db_xref="GOA:Q0HZD5"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD5"
FT                   /protein_id="ABI41520.1"
FT                   /translation="MTPDQQFARLVKIAMLGFVAVFGYFMFADAMMPLTPQAMATRVVT
FT                   KVTPQISGKIQTINVKNNQVVAKGDLLFQVDPAPFELAVSQAKLALEQVRQDNAELDAS
FT                   LLAAKAEVNASSTTAQQKRREAKRLDALYATHGVSQQQRDQADSDAAAAEANLLAANAR
FT                   LEKLKVSRGLYGEDNLRMRQARNALEQAELNLSYTQIHADQDGVVTNLQLEVGSFASVG
FT                   QPLLALVSDKLDIIADFREKTLRGVNASYPALIAFDGEPGRLYRAQVSSVDAGVSAGQF
FT                   DANGRLAAPQESDRWVRDAQRLRLHLVLDDDAMNGLPAGARATVQLLPDNALFSLLAKV
FT                   QIKVISLLHYIY"
FT   gene            594418..595446
FT                   /locus_tag="Shewmr7_0518"
FT   CDS_pept        594418..595446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41521"
FT                   /db_xref="GOA:Q0HZD4"
FT                   /db_xref="InterPro:IPR016926"
FT                   /db_xref="InterPro:IPR022604"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD4"
FT                   /protein_id="ABI41521.1"
FT                   /translation="MLLRHNPLTTNDLRQCLRIATGGTIGFTLCKLFGWSNGVFFTVTP
FT                   MLLLGLVPVMSGHAMRQLLASSAMAGLEVGLLGGFFGSHPGLMMPIVFLLFLYRFAAMS
FT                   RGSLFLFGANGVLSLSIMLHFASYPGTDLNDLIFSNFWATGLSVVIAYLMTALWPDVEP
FT                   RPAYKPGPKAPHRMRHEALLGASIATLSFLVFQIFDLRDSMSAQATTLLLLFPMHWNGA
FT                   LDYARKRALGTLLGVSFGVMVQLFLYDWSGLLILIVPLLWIGLMLFAQAHVKEASGSGV
FT                   GFGAMTTLGILFGQYLTPGNDLIFSALYRVSSIFVAIVATLFLCYLLHKLLNSFEATRF
FT                   GY"
FT   gene            595637..596263
FT                   /locus_tag="Shewmr7_0519"
FT   CDS_pept        595637..596263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0519"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: son:SO4048 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41522"
FT                   /db_xref="GOA:Q0HZD3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD3"
FT                   /protein_id="ABI41522.1"
FT                   /translation="MNIKIRTLTKGIALIYGCALTSVAIANPTTVPPAGQICVTCHGAE
FT                   GEGIEPLGPRLAGLSKEYITTQLQHFQAGVRQNATMMPMAMTLQGDGIEQVASYFSAKS
FT                   PKTEVKPVIRGEQVTFSDDTARLAYQGDWSRGLPACVTCHGPSGLGGGLFPRLAGQQAS
FT                   YIKTQLLAWQAGTRKGDVDGMMANVANKLTAAEVDALANYFANLK"
FT   sig_peptide     595637..595717
FT                   /locus_tag="Shewmr7_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            596274..597329
FT                   /locus_tag="Shewmr7_0520"
FT   CDS_pept        596274..597329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0520"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: son:SO4047
FT                   cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41523"
FT                   /db_xref="GOA:Q0HZD2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD2"
FT                   /protein_id="ABI41523.1"
FT                   /translation="MKSSAILLLAAMGVLTAQVQAANELPDKQAPLPSVPKNPDQSYLT
FT                   PRPLSAIPEGAFGDKVRLGYQLFVNTQQLRDKYVGNELNCANCHMDAGRKANASPLWGA
FT                   YFAYPAYRKKDDKVNTFQERVQGCFNYSMNGKAPAAGSPELVALSAYAYWLGMSGLMDA
FT                   ANLDGPVPELSDAELVKGAKREDFPLPDTLAKAMTVDQRANLPGRGYPEIPKPEFAFSP
FT                   ERGKTVYTAHCQACHGADGQGQAIAGVYSLPPLWGPKSYNWGAGMHRVNTAAFFIYENM
FT                   PFAKSIQLTNQQAWDVAAYINSHERPQDPRNKGDVKQAQEKYHNDNDYYGVEVDGKVLG
FT                   TASYPVFPKKS"
FT   sig_peptide     596274..596339
FT                   /locus_tag="Shewmr7_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 22"
FT   gene            598061..598444
FT                   /locus_tag="Shewmr7_0521"
FT   CDS_pept        598061..598444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41524"
FT                   /db_xref="GOA:Q0HZD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD1"
FT                   /protein_id="ABI41524.1"
FT                   /translation="MQTYFIFAAIVTVIVGVVHSMLGEILIFKKLRKRGIVPTESAPPL
FT                   QARNVKILWATWHLASAFGFGIAGILLSLSNSKLSPDPIVIYPLLFAFIVGSLLVLFAT
FT                   RGKHPGWVGLLVVAVLIYLGGVA"
FT   gene            598935..599408
FT                   /locus_tag="Shewmr7_0522"
FT   CDS_pept        598935..599408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41525"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZD0"
FT                   /protein_id="ABI41525.1"
FT                   /translation="MFICTLNRYECLDDGMIIPTLMKKPLLFLRYHTDTIRITVPKHLP
FT                   ESQFDTAQICPLCQGANQCAMTLGADISDCWCAKQRFPNLTQLLSGDLAAGLSTGDTAG
FT                   LSADKLAKLLSQPATACICETCLSRIKRELTVSISEDKNSPSGLGDGLGYEVK"
FT   gene            complement(599413..600528)
FT                   /locus_tag="Shewmr7_0523"
FT   CDS_pept        complement(599413..600528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0523"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: son:SO4043 TonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41526"
FT                   /db_xref="GOA:Q0HZC9"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC9"
FT                   /protein_id="ABI41526.1"
FT                   /translation="MLDGKILPLASLFALALSTSLPLNASENTFSQAYSDYQTALKQGD
FT                   NAQIEASAKWAFELGETQYAKDSVDLANLAMNWAGAIEKQVAPYPFAEENLPKTAKANE
FT                   LYQLALTNYKVHYGKEALELIDPLLGAAQTAVEAKDAKNDLLDAITIAEKSDNKKLIAD
FT                   VKMAAFNRLSNTELYTRSVRNYAFEAYETYKDILPENALDRVKATYVVGTVEYAEKHDD
FT                   KAIPLLLEVVKQFEALNYTHPYALSSHAYLVELYERQGKRDESTAHCIAIGKMRPWADM
FT                   QEQQPLFRTEPKYPKSYLMQRKSGYVTLNFTVDEMGFVKNPEVLESKGGVLFEKSTLKM
FT                   IEEWRYAPKFEHGKPVSAQTTVRIDYFTDKS"
FT   sig_peptide     complement(600451..600528)
FT                   /locus_tag="Shewmr7_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(600652..601494)
FT                   /locus_tag="Shewmr7_0524"
FT   CDS_pept        complement(600652..601494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0524"
FT                   /product="hydratase/decarboxylase family protein"
FT                   /note="KEGG: son:SO4042 hydratase/decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41527"
FT                   /db_xref="GOA:Q0HZC8"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC8"
FT                   /protein_id="ABI41527.1"
FT                   /translation="MSQTDAKAQLESINAAAQELAQRRAKGEAGALLQEVLRPKDFPHA
FT                   FAIQQTIAQQFSNQSNPIAGWKCLLPTAEKTVVAPIYQHDVYIETAECPLYPSSKGLAR
FT                   VEPELAFEIGSDLPPRATPYSEAEIDAALGRTRLALELIKSRYQNPSEANHFDALADGL
FT                   VNQGLWLGPEISTSAETGHFALSVEVAAGGRQASETLQKAAVHPNGFPKAGLYWLVNFL
FT                   SAQGIGLTRGQYVITGSYAGVLDLPLNQHCQFHYGELGQFGLQFVAKYVTPKERQANR"
FT   gene            601814..602803
FT                   /locus_tag="Shewmr7_0525"
FT   CDS_pept        601814..602803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0525"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: son:SO4040 integral membrane domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41528"
FT                   /db_xref="GOA:Q0HZC7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC7"
FT                   /protein_id="ABI41528.1"
FT                   /translation="MNQSHSGSLATNHAQLGLLFISVAVLFWGMLPIALKLSGSFIDPV
FT                   TLTWFRFLVALLVSILVQWSAGSLKQFTALDAKVWLRLILAGLFLMLNYVSFVYSLDYL
FT                   APGAAQLNFQTSPFFLAFGGVLFFKERLNAVQLSCFATLALGMLMFFHPYLDFSATDNH
FT                   EIWLGVMIVQFSALSWTTYALLQKSLLNRLSPANVLLVIYALGIFAMAPFSDFSQFAQM
FT                   DSFDWQVALFCAANTLIAYGCFGQSMKYWPTAQVSAMLALTPVFSFSATAFVVSIGWWP
FT                   DVFKADKLDALSLFGIGVIIVSVMVVQLLPLYRQRRARRLQPASQTTE"
FT   gene            602812..603444
FT                   /locus_tag="Shewmr7_0526"
FT   CDS_pept        602812..603444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0526"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: son:SO4039 hydrolase, haloacid dehalogenase-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41529"
FT                   /db_xref="GOA:Q0HZC6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC6"
FT                   /protein_id="ABI41529.1"
FT                   /translation="MITRLTDIQLEQIRGVIFDLDGTLAHSNPDFKGLRAALGIGSGTD
FT                   ILEHIHSLDTTMAKMQALEIVHDYELESSRQASWIEGAQALIAFLKMRQLPLAILTRNM
FT                   PEAAKITIEKLGIDIPLVLTRYDAEPKPHPQGIHLICEQWQLNPADILYVGDYLFDLQT
FT                   AQNAGSRCALYCPEEVPDYAQAADLLIANYQSFIDAWTLVMRSDSVR"
FT   gene            complement(603479..603847)
FT                   /locus_tag="Shewmr7_0527"
FT   CDS_pept        complement(603479..603847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41530"
FT                   /db_xref="GOA:Q0HZC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC5"
FT                   /protein_id="ABI41530.1"
FT                   /translation="MKKALTAGLLSAFIAPGSGHFYLKHKRSALVFFSLAVVSLMLLLM
FT                   QIYQVAQVIALEIQNGTLPLDVGVISAEITQQTQTTMANANELLYGFLVCWLVALLDSI
FT                   RLGLKQDKQDALASNTPN"
FT   sig_peptide     complement(603788..603847)
FT                   /locus_tag="Shewmr7_0527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.737 at
FT                   residue 20"
FT   gene            complement(604239..606107)
FT                   /locus_tag="Shewmr7_0528"
FT   CDS_pept        complement(604239..606107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0528"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA, RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   KEGG: son:SO4034 ATP-dependent RNA helicase DeaD"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41531"
FT                   /db_xref="GOA:Q0HZC4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC4"
FT                   /protein_id="ABI41531.1"
FT                   /translation="MSSSERTFRELGLSENLLRALDELGYEKPTPIQSASIDPLMAGKD
FT                   ILGQAQTGTGKTGAFALPLLNKVTSQAVPQILVLAPTRELAVQVAEAFSSYAKFMKGFH
FT                   VLPIYGGQSMHQQLNALKRGPQVIVGTPGRVMDHMRRGTLKLETLQALVLDEADEMLKM
FT                   GFIDDIEWILEHTPEQRQLALFSATMPEQIKRVANKHLKDATNISIAASHTTVDSIEQR
FT                   FVQVSQHNKLEALVRVLEVENTEGIIIFVRTRNSCVELAEKLEARGYASSPLHGDMNQQ
FT                   ARERAVEQLKNGKLDILIATDVAARGLDVERIGHVVNYDIPYDTEAYVHRIGRTGRAGR
FT                   TGMAILFVTSREMRMLRTIERATNSRISPMKVPSPETVAERRLSRLGEQLAQTMTQDLD
FT                   FMREAVAQLCQQLEVDTDLLAAALLHQVQQERPLQLPAIQERTRDERNERSERGAERGE
FT                   RGERRSRESRPLPASLGSAEALKDNPDLKMCRYVIDVGRDNGVGVGNIVGAIANEANID
FT                   SRYIGAIQLYDAVTTVDLPDGMPKEVLQHLKKVRVCGKPLNIREAGDQVFVDSGRGARS
FT                   DRRPRGDRPMGERKPRSASGDKPFADRKPRSDKPAGERRPRKPREE"
FT   gene            complement(606304..607344)
FT                   /locus_tag="Shewmr7_0529"
FT   CDS_pept        complement(606304..607344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0529"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M20; peptidase M28; KEGG: son:SO4032
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41532"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC3"
FT                   /protein_id="ABI41532.1"
FT                   /translation="MGNLAQAFTAITRPRAQGIALSLLRLCILSLCLGLTACANQPVEY
FT                   TCSPKAIRLNWAKPSVLKQTVATLSAAELMGRKTQTQGAAKTRNYLHSQYQQLGLTPWA
FT                   ETFEVPFEYATLFSQETGSNMVALVPTRQPTHRWRIVVAHYDHLGMSGSKIYHGADDNA
FT                   SGVAALLALAAHWQAQLSAAPDSLPNINLMFVATDAEEPGLFGSTALVEQLKQRMPEAQ
FT                   FELMLNLDMIGHPTRPYAIYLEGSRNFYQFPQFRPMLNANNHLCIKLSHPKPVGRSIQS
FT                   TDWLRASDHYPFHKAKIPWLYFGVPTHPQYHTPEDTPDTLDYVFLAAVTESAFEILRLN
FT                   GDFLKN"
FT   sig_peptide     complement(607225..607344)
FT                   /locus_tag="Shewmr7_0529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.701 at
FT                   residue 40"
FT   gene            complement(607429..607767)
FT                   /locus_tag="Shewmr7_0530"
FT   CDS_pept        complement(607429..607767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41533"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC2"
FT                   /protein_id="ABI41533.1"
FT                   /translation="MPTHRPSLTSLSSANVLLIACLGLTLVALTIAAIDPLIGQPKRLQ
FT                   VTVLDSTADSSLLALPDGRITTLAQGGLTKNTQVTICARTHLVSGLEHFNLSRHQEATL
FT                   SPEIHVLD"
FT   sig_peptide     complement(607669..607767)
FT                   /locus_tag="Shewmr7_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.507 at
FT                   residue 33"
FT   gene            complement(607880..610732)
FT                   /locus_tag="Shewmr7_0531"
FT   CDS_pept        complement(607880..610732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0531"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: son:SO4030 excinuclease ABC, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41534"
FT                   /db_xref="GOA:Q0HZC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC1"
FT                   /protein_id="ABI41534.1"
FT                   /translation="MDKIEIRGARTHNLKNINLTIPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLFARVGEPRCPTHGQPLAAQTVSQMVDKVLEMPEDSRLMLLAPVVNGRKGEHV
FT                   KLLEGLSAQGYIRARIDGEVCDLTDPPALDLHVKHTIEVVVDRFKVRSDIQQRLAESFE
FT                   TALELSGGIAVVASMDEGNTEELIFSANFACPHCGYSMAELEPRIFSFNNPAGACPTCD
FT                   GLGVQQFFDPDRVITNPELSLAGGAIRGWDRRNFYYFQMLSSLADHYKFDVEVPFEQLS
FT                   DKVRKIVLYGSGKDSIAFKYINDRGDVVVRTHPFEGILNNMDRRYRETESNAVREELAK
FT                   FINTQACQSCGGSRLREEARNVFIGDLNLPKLTVWSIGEALDYFDKLEFSGQKAQIAEK
FT                   VLKEVRDRLGFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLQTLIHLRDLGNTVIVVEHDEDAIRIADHIIDIGPGAGVHGGEVICDGP
FT                   IEKIVACDESVTGQYISGKRNIHISTPRTPYDPKQVIELYGARGNNLRNVDLTVPVGLF
FT                   TCVTGVSGSGKSTLINDTFFRIAHKQLNGATVDEPAPYDRIVGMEQCDKVVDIDQSPIG
FT                   RTPRSNPATYTGIFTPIREIFAGTQESRTRGYQVGRFSFNVKGGRCEACQGDGLIKVEM
FT                   HFLPDVYVPCDACKGKRYNRETLEVRYKGKNIHEVLQMTVEDAREFFDAVPAIARKLQT
FT                   LMDVGLSYVRLGQSATTLSGGEAQRVKLAKELSKRDTGKTLYILDEPTTGLHFADIQLL
FT                   LDVLHRLKSHGNTIVVIEHNLDVIKTADWIIDLGPEGGGGGGTILVTGTPEEVAEHPTS
FT                   HTARFLKPLLERDAKLAKQS"
FT   gene            611141..612508
FT                   /locus_tag="Shewmr7_0532"
FT   CDS_pept        611141..612508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0532"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   son:SO4029 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41535"
FT                   /db_xref="GOA:Q0HZC0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZC0"
FT                   /protein_id="ABI41535.1"
FT                   /translation="MGNNGLSGTEKKVAFSLASVFGLRMMGLFMIMPVFALYGQHLEGF
FT                   SPLWVGIAIGAYGLTQAVLQIPMGILSDKYGRKPVILAGLVLFAIGSLIAANADTIYGV
FT                   VFGRAVQGMGAIAAAVLALAADLTRDEQRTKVMAIIGMCIGGSFALSLLVGPIVAQHLG
FT                   LSGLFLLTAGLAVLGMLIVQLLVPNPISHAPKGDTLAVPAKLKRMLTDPQLFRLDAGIF
FT                   ILHLVLTAVFVALPLDLVDAGLVKEKHWMLYFPAFVGAFFLMVPLIIIGVKRKNTKAMF
FT                   QIALVIMMFALAAMAMFSNNLWVLSVAVLLFFTGFNYLEASLPSLIAKFCPVGEKGSAM
FT                   GVYSTSQFLGAFCGGMLGGGAFQLVGAVGVFIVALVLMGVWLLLTLGMKNPVLLKSYTL
FT                   EAAVKDKAQARDMASQLSQLMGVVEAIVVLDEKVAYLKVDEHFDLREARAVLGSAQ"
FT   gene            612616..613326
FT                   /locus_tag="Shewmr7_0533"
FT   CDS_pept        612616..613326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0533"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: son:SO4028 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41536"
FT                   /db_xref="GOA:Q0HZB9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB9"
FT                   /protein_id="ABI41536.1"
FT                   /translation="MASRGVNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQ
FT                   GQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVID
FT                   QSGSMQMLGGRNQGQSQGQGQGAPMGGMQQNAGYQAAPAQTAPAQNQYAPAQQSYQAPA
FT                   QQPQSGYTQQPAQQSYGQQQAQPHAQPQQGGYAPKPAAPAYQAPSAPAQRPAPQPQQNF
FT                   TPDLDDGWDDDIPF"
FT   gene            613558..614151
FT                   /locus_tag="Shewmr7_0534"
FT   CDS_pept        613558..614151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_3019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41537"
FT                   /db_xref="GOA:Q0HZB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB8"
FT                   /protein_id="ABI41537.1"
FT                   /translation="MEDVISQENNPLKSEEKQIAVDSNIQRIPLFHVSLAKLIIMFVAT
FT                   FGLYQIYWFYKQWQALKEYYDLDAWPIARCIFTVFFTHSLFVYVNEYIKEDNRNYRWNH
FT                   SALATVYVLLVVVSSILNQIEFLPTFLILISIFIPLAVLYPLYEAQKAINFALEPLDYE
FT                   DNSSLTWLNWVWIALFGFYWAMVIYALTVLVRLA"
FT   gene            614434..617265
FT                   /locus_tag="Shewmr7_0535"
FT   CDS_pept        614434..617265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0535"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG: son:SO4022
FT                   peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41538"
FT                   /db_xref="GOA:Q0HZB7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB7"
FT                   /protein_id="ABI41538.1"
FT                   /translation="MNHFKRIQFKHLWLWLLFIIVALPLRAVEAPLWPELANLPLSQRV
FT                   HTGTLTNGLHYLLVNNKTPEQAVIVRMRVDVGSVMETDAEQGLVHLLEHMAFSGSTGLA
FT                   AGEMIPTLQRLGLSFGADTNAVTEFQQTVYQFNLPSNSQDKVDTALFLMREIAGNLLLD
FT                   PAFIEREKAVVLSELRERSSADLENYRHQLAFLMPQTVLSQRFPVGEATSIKNANREKL
FT                   LSLYQRFYTPSRTTLIVVGDIDVGSIEQKIKQQFTDWQAAPQAAGVKAQSIGMVQAKAA
FT                   VEASAFFDPSLQTSVSLGLLKPQTPKPDTIALREQDILLELAHGILYRRLESQLLHSQG
FT                   LYGVNLQIGHEYDIAYGTQMTLGTQENNWQQGIALLEQTLRQALEFGFSQQEIDQQLKR
FT                   MHKGYQLNAAGSNTIHSLNIAESLVSAVASRRVPVEPEWQLALFEKLMPSITPQKLQQL
FT                   FKQTWDGTPYLYLTNNKPIDNIEKQLLAAYAESQKQAVKAPETKAIAEFAYSQFGEPGQ
FT                   IVADQRDAATGIRKLQFANGVRLNLKPTDFNQGVTLVSLNIGFGEVPFPELDGLSYLFN
FT                   SAFVQGGLGLHDWDSLRDIFAGQDISVSLSLREQSFGGEISTNAAELRTQLGVLTAYLV
FT                   DPGMEKQAEQLFREQVIAEQQSIHSNPQLEFSNQFARIAHNGDKRYGYGNPEEILKRQF
FT                   TELAPSFHSAVQQGAIELAIVGDFEEDKAIAEVAQTLGAIARQQLPKGQTIVPVFPKVP
FT                   AQISLIHYGQVDMAALAQVWPTTDMSNLREQVGLGLLEQVLSILLTENVREKAGASYSP
FT                   SAFSYNDLNPTGYGYLGLFSVTTKSMLPEVAQYYAAAVKQVQAPAGISEDLLNRARQPV
FT                   LEWMQMAPQSNNFWLDLASTAQSQPDRFAGFNQRLALVKQITPAELSQLALKYLKDNKR
FT                   LTIETLPAPVTAQ"
FT   sig_peptide     614434..614517
FT                   /locus_tag="Shewmr7_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.865 at
FT                   residue 28"
FT   gene            complement(617427..620144)
FT                   /locus_tag="Shewmr7_0536"
FT   CDS_pept        complement(617427..620144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41539"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB6"
FT                   /protein_id="ABI41539.1"
FT                   /translation="MQGILNYYKQCFQHDSAEINLWASHKLAEQDQLLLQHEDELSSGF
FT                   LPRLPVPFAPASALMARSALYLREKVLLHCCLFFCGSVELNGEKRKVVTPLLYRECQLQ
FT                   LDGDNIYLECNHTLTGSGQFTINEPLLEKLVVEGHSLSQELRDNPTDVSGWIAWLRAGQ
FT                   ADVDTGHLLHFPKLIDEAEFTRLSRKRGPFLVSRSQVILAERSFASRGILHELDKLITA
FT                   PSLSAPLQALFGHAPSQDPESIHVDTQEDYLPGLLSRAQIQALKVAANHTLGQISGPPG
FT                   TGKSYTIATVAAEQVLRGMSVLVVAHTDVAVDVIADKLQQQFQLGSSLIRAGSPQFIKV
FT                   LKNQIDEMLHGQHPAVDQEVTDIVLRLAKQQLANVTRKQANMETGFIRHCRHAIRRGQK
FT                   LATLEQKQSRWRLGFYQWFNRSGIKQFAQQWDVLDRLTALIEQKESLSLKYLQLATGYR
FT                   LNQLLKHKRSTLVSFASALRARQSAKQLEGFYKTDFDALKQTFPIWLSSLASLHRVLPM
FT                   QVQMFDLVIIDEATQANIAACLPALQRAKAALVVGDSKQLRHFSFLSRAKQTQIQTQLG
FT                   LAADCRGLMSYRDASMLDLVSQSLERQSQVVFLNEHFRSKPELIQFSNQQFYQGMLKVM
FT                   QHRPCTSSGHLHRVHVTGSRDSKGINAIEAEALIQKLSQLIDEQENALVPASIGVLSCF
FT                   RNQTEYLSQQILARFSAQQIERHQLRIATPFGFQGEERDIMLLSFSITPKDSRAAVYLN
FT                   RADMFNVAITRAKQMQWLFLSVQEHELPSNNLLATYLASAGQFQAAHHYVDSLDSFGQS
FT                   VAHAIEEKGISVWRAYHIAGLELDILCRYGNQYLAIDLIGYPGPWADFFDIDMYKLLQR
FT                   AGIKLIPVSYGLWCQQRELCIQHICQQLGIPQPR"
FT   gene            620503..621876
FT                   /locus_tag="Shewmr7_0537"
FT   CDS_pept        620503..621876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41540"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB5"
FT                   /protein_id="ABI41540.1"
FT                   /translation="MLNNKLKGFAVLTFACLGVTACGGSDNNKDEDTSKTDTYVQFYNA
FT                   SVGSTATALKIGDKTYESVSYADAMPRFTSTPGVSAVEVMGKDASNKDISLYKEDIDLK
FT                   TATDHFFVLHGDFASPSLLNINYSRTELDKQNAEADKSKMQLLIAHTAMDAPAYDAYIA
FT                   KADQSFADAVMLGSVSYGDVSTPQILDTGDYKVYLAPAGTTNVSYTTASINFKSKVPYK
FT                   LILRESFGASDAKISLDSVDSTTNVRNHVALESSVGFRVFNGLAAHNVDVKVVSNKQEA
FT                   LFGNVAPFGVTAYQGAEFNDFGVSVFDHTSQAKLLDNVLITLNQDDIKTIFIYEQATEE
FT                   GSQVKAMEMKQTQTPSPYSFKFDILSFADKSNLTLYFLKANDTIETATYKISAINPTAP
FT                   QSLVVPKGEYSIKVIAVENGTKTVVYASEMMDFNNEDNVTMVLNKDASTSFGYNLVKL"
FT   sig_peptide     620503..620574
FT                   /locus_tag="Shewmr7_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.478 at
FT                   residue 24"
FT   gene            complement(621942..623366)
FT                   /locus_tag="Shewmr7_0538"
FT   CDS_pept        complement(621942..623366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0538"
FT                   /product="MLTD_N domain protein"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Lytic
FT                   transglycosylase, catalytic; MLTD_N domain protein; KEGG:
FT                   son:SO4017 transglycosylase, Slt family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41541"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB4"
FT                   /protein_id="ABI41541.1"
FT                   /translation="MRKTFRHPSAFAALVVAMLTAQLSGCATTSAQTSPTEYAAALPEA
FT                   EGTSEQTTQPQHVEAEVIDERYTDVWEKIQHARTIDVHDDAEVRKQRNFFDDKQKFMTQ
FT                   VTQRAEPFLYYIVSQLEARNMPLELALLPIVESGYNPLAQANGPAGLWQMIPATGRNFG
FT                   LTINSAYDGRKDALASTDAVLDYLQHLHDTLGNDWINAVAGYNSGELVIKAAIDRNKAK
FT                   GKPTDFWSLNIPARQVQTVPKWLAFIQIIRAPSHYNLKVMPIANRPFLERLPAPNGVEL
FT                   SQIANAARITKAEFKTYNPGYRQSVIPSKGKYQIALPIENIGQYQENQHKLYAQKRYDS
FT                   QSYIVKSGDSLGSIAAKFDISVKELKQANNLSSDRIKIGQELTLLTPMTSEDNASTETP
FT                   KQSKAQTTSQSTKAKTSSKTADKPAAKASTYKVKSGDSLDKIARKNKVKLADLMKWNQL
FT                   NAKSIIKPGQELKLSE"
FT   sig_peptide     complement(623271..623366)
FT                   /locus_tag="Shewmr7_0538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.826 at
FT                   residue 32"
FT   gene            623535..624878
FT                   /locus_tag="Shewmr7_0539"
FT   CDS_pept        623535..624878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0539"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; leucine-rich repeat protein;
FT                   SMART: tyrosine protein kinase; serine/threonine protein
FT                   kinase; leucine-rich repeat-containing protein, typical
FT                   subtype; KEGG: son:SO4016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41542"
FT                   /db_xref="GOA:Q0HZB3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB3"
FT                   /protein_id="ABI41542.1"
FT                   /translation="MQTLAQLKAGQLQGVTRLQLVENLTEFPREIFDLADTLEILDLSN
FT                   NQLSSLPEDLHRLTQLKILFASNNRFEVLPEVLGQCPKLEMIGFKANQIRSVPETSLPL
FT                   QTRWLILTDNQITALPERMGQLHRLQKLALAGNRLTALPESMAQCRNLELVRLSANALA
FT                   ALPNWLLKLPKLTWLAFAGNPFSHTLVDPHADVACVPNVSLADIALGEKLGEGASGIIY
FT                   QGRWLNPAMVDATGAEQIAVKLFKGEVTSDGYPADELDCCLTSGEHPNLIKVLAHISQQ
FT                   DQLGLVMELIPQGFNNLGLPPSLETCTRDTFKGGTEFSLKGIAKIAQQLAETLAHMHAQ
FT                   QISHGDVYAHNMMINPQMALLFGDFGAASNLAKLPPLARDAMQAIEVRALGCLIDDLLP
FT                   FAGADEDEAMRAQLRQLKDLCMQPDLSCRPRFTDIAKTLAAQHLSSRA"
FT   gene            624972..626753
FT                   /locus_tag="Shewmr7_0540"
FT   CDS_pept        624972..626753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0540"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: son:SO4013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41543"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB2"
FT                   /protein_id="ABI41543.1"
FT                   /translation="MSLIYKVVWLGIILSLSLFNSAPVWAGFWDSLWQRELPVDQTTPP
FT                   KDAQRFEFSGSLPSHTQLELVGYYTSSVCTRKEIRFPNGDIANPYRATLNKSSVLRQSL
FT                   ESGATATSFGLSLALQGGGDCDWQLEDLVLDLTLLPSHPVWQKVQSLKDKYLHTSPLLT
FT                   SNELPAKASPHDGFYLSQELTIEPVFAGSEEDTNLVAALPLSLNPVYYPVLIYSPKTDS
FT                   PFEVKLKSNLQSSSRLWSSSVTKLVRFDKQPVLRVQFNPEILPDYQVNVWRQPELISVH
FT                   YPDGTEYRYPRGDVHLYAYGKPESMLNTLSESRKAEDKRLLAQIYWAGHALTQDKEKAR
FT                   KFYREAAEGDDLIAIQWMQSQAAYAGEVELSRYWLQRAARLGDVEAKLELIRQPFETIL
FT                   QGKPNTAEAKSAEVKAWQQLNQLVSQGVPEAMSMMALYQALPWSPYHDSATALANYRLS
FT                   VQADPALAISAASDYYYLLEDFEQSQEFWQIAAERDLYAAAEYADILLKPDTRDVHQVR
FT                   IWLEKVVSQGAKQGMPRDVLGRAYFQLASLLDTGEGGSVEPERALALYQHSIELAKSFT
FT                   NDYEAKAKARVQALEKL"
FT   sig_peptide     624972..625052
FT                   /locus_tag="Shewmr7_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.988 at
FT                   residue 27"
FT   gene            626918..627916
FT                   /locus_tag="Shewmr7_0541"
FT   CDS_pept        626918..627916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0541"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   son:SO0640 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41544"
FT                   /db_xref="GOA:Q0HZB1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB1"
FT                   /protein_id="ABI41544.1"
FT                   /translation="MSELPHDYTHIYLEQPGAPEVMQLTRSPLPVPSAGQVLIRNCAVG
FT                   VNGPDIKQRMGIYPPPPGASPIIGLEVAGEICALGEGVTQWQLGDKVCALVPGGGYGEY
FT                   TLTYAVHCLPIPQGFSEVQAAALPETFFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTA
FT                   ISLAKHLGATVITTTGQDEKRDYCSGLGAHLVVNYNTQNFVEEVMAFTQGKGVNVVFDI
FT                   AGGDFINLNLQALALDGRMVSVSTQRSAKAEVNILQLMAKRIVWTGSTLRPQTVEAKAE
FT                   IAKQLAEHVWPLLDSQQIVPHICATFPLAEAAKAHALMQSGEHRGKVVLTL"
FT   gene            628239..628643
FT                   /locus_tag="Shewmr7_0542"
FT   CDS_pept        628239..628643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41545"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZB0"
FT                   /protein_id="ABI41545.1"
FT                   /translation="MYNTAKKQVWYGELRTSKGTAIVVHDNQLPEASPGRIYLYNTERD
FT                   AIVEYVEDIVKVNLHDLDDAAVKAAEAKFSGAWKAARAQFMGKHQARIDLNNVKESGPV
FT                   RKAKAEVEPEIETDAIGADFDEDWGDDFDD"
FT   gene            complement(628753..629784)
FT                   /locus_tag="Shewmr7_0543"
FT   CDS_pept        complement(628753..629784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0543"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: son:SO0693 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41546"
FT                   /db_xref="GOA:Q0HZA9"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA9"
FT                   /protein_id="ABI41546.1"
FT                   /translation="MVRFSVLDPWTDPRGGEIERVRIDNGIIALEVLSLGGIIRSLWTP
FT                   DKQGQRANIVLGCDSAEDYLTQNAHLGAIAGRFANRIAMGKMQYQGQEYQLDINQASNC
FT                   LHGGREGFNRKNWHLGQLPDGVRLSLVSPDGDMGFPGNCTVQLDYRLAANNLYVEILAS
FT                   VDKPCPVSLTQHSYFNLDGLPNNHQHQMQIDATRYLTMNEVGIPTGIAEVKNSIFDLTQ
FT                   GVTLGDKLQDPALASTQGYDHCYLLDNPDCALRRFGCLSSPVSGRAMTVFTNQPGVQLY
FT                   CANFLAGTLGRNQQSLNAYQGVCIEPQKLPDSPNQPQLGDDAWLIPGKIYHHISRYQFD
FT                   IEG"
FT   gene            complement(629910..631055)
FT                   /locus_tag="Shewmr7_0544"
FT   CDS_pept        complement(629910..631055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0544"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="KEGG: son:SO0694 galactokinase; TIGRFAM:
FT                   galactokinase; PFAM: GHMP kinase; GHMP kinase, C terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41547"
FT                   /db_xref="GOA:Q0HZA8"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA8"
FT                   /protein_id="ABI41547.1"
FT                   /translation="MSNPAQRATKLFVQTFGTKADDLYQAPGRVNLIGEYTDYNDGFVL
FT                   PAAINFHTVIAVKRREDNKFRAVADAFPGQIKEWSFGKDTEINPEDGWVNYLKGLTVAM
FT                   ANTGLIAKGLDLAVVGDVPLAAGLSSSGALVVAFGTAISDSSQLHLSPMAVAQLAQRGE
FT                   YRYVSSACSIMDHMICAMGEPDHALLIDCLDLDSEPIAIPENLSLIIIDAHIEKQRLAA
FT                   INQQRREECAQAADFFGLDALRHLDLRQLESAKDQLDDTLYRRAKHVVTENKRTQSAAR
FT                   ALEQNNLSKFSLLMAQSHQSLRDDFEVTLPEFDTLVDIVGQVIGERGGIRMTDGCVVAL
FT                   VDHELTDAVVSAVEHAFYEQTGIDATVYLCSASAGAGRIDS"
FT   gene            complement(631341..632978)
FT                   /locus_tag="Shewmr7_0545"
FT   CDS_pept        complement(631341..632978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0545"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; sodium/hydrogen
FT                   exchanger; KEGG: son:SO0695 glutathione-regulated
FT                   potassium-efflux system protein KefC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41548"
FT                   /db_xref="GOA:Q0HZA7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA7"
FT                   /protein_id="ABI41548.1"
FT                   /translation="MEPAILIITLICGMLVSRIGLPPLIGYLVAGFVLFVFGIEKESLP
FT                   LLQELANLGVTLLLFAIGLKLDIRSLFKAEVWAGSSIHLVLSMVLFIPILKILGLIGLS
FT                   QLDGLSVAQLSLIAFALSFSSTVFAIKVLEDKGDVQSLYGRVAIGILIMQDIFAVVFLT
FT                   ISKGAVPSVWALALLLLPLAKPLIYKAFDRVGHGELLVLFGLVMALVVGAWLFESVGLK
FT                   PDLGALIIGIFLAGHKKASELAKSLFYFKELFLVAFFLTIGLNGLPTVSDVVLAALLVL
FT                   LVPLKILLFVYILTRFKLRSRTSMLASFNLGNFSEFGLIVAAVATSKGWLPPQWLVIIA
FT                   VALSFSFLFAAPLNATVGNIYQRFQQRLIRLEKPPLHPEDRPIAIGNPRFLILGMGRIG
FT                   SGAYDELRARFDGEILGIEHKQELVDLHRANGRNVVQGDAADTDFWEKLDKAPNLELVL
FT                   LAMPHHAGNLFAVEQLKKLNYQGKLSAIVQYGDDAASLRASGVHSVYNLYEAAGAGFVD
FT                   HVIHELLPDSETRAAVEANAEDTNSRTA"
FT   gene            complement(633131..634972)
FT                   /locus_tag="Shewmr7_0546"
FT   CDS_pept        complement(633131..634972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0546"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; Thioredoxin domain; KEGG: son:SO0696
FT                   thiol:disulfide interchange protein DsbD"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41549"
FT                   /db_xref="GOA:Q0HZA6"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA6"
FT                   /protein_id="ABI41549.1"
FT                   /translation="MKKLLSLIFTALLFLTPLTLSGNAFANSFGFLKSEPELMPVDQAF
FT                   AFDFKQEGNKVTLNWVIADGYYMYRDKLKFSVNGAELGTIDLPKGKPHNDEYFGEQEVY
FT                   YTYIDIPVGLKQADDNGTLTVTFMGCAEGKLCYPPTKRDVTLKAVAANDGQIATGADSS
FT                   ETTEPTATADAKQTGSALSQPITQQDSLSQMLSNDSLLWTLVIFFGLGIGLALTPCVFP
FT                   MYPILSGIIVGQGQKLSTAKAFTLSMAYVQGMAITYSILGLVVASAGMKYQAALQHPAV
FT                   LIFLAILFFVLSLSMFGLYDLKLPSSWQEKMNSISNNQKGGNLVGVFLMGVISGLVASP
FT                   CTTAPLSGALVYVAQTGDLLQGFLALYVLSMGMGVPLLIIGTSGGKLLPRAGAWMNIIK
FT                   TVFGFLLIAVSIVMLGRIWTGVVSDVLWSLWGISFTGYLMHQNKLSAFNWKQTVRSVLL
FT                   TLTLLASFSYGFQAVMGHFGFTHAPMGGVATTEEEHGFKRIKSIEDLDREIAAATAAGK
FT                   PVMLDLYADWCVACKEFEAITFKDAEVLARMNKIVLLQADVTKSDAIDVALLEKYNVLG
FT                   LPTLLMFNEQGEQREDLRVTGFMGPKEFAAHLDHLVK"
FT   sig_peptide     complement(634892..634972)
FT                   /locus_tag="Shewmr7_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(634969..635292)
FT                   /locus_tag="Shewmr7_0547"
FT   CDS_pept        complement(634969..635292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0547"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   son:SO0697 periplasmic divalent cation tolerance protein
FT                   CutA"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41550"
FT                   /db_xref="GOA:Q0HZA5"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA5"
FT                   /protein_id="ABI41550.1"
FT                   /translation="MQAQYLVVSTSCPDEVQAKRIARALVDARIAACVHISAPIRSIYA
FT                   WEGKICEEQEISLHIKCLQSRYAELEQLVLKLHPYQVPEIIAVPVTHGLPAYLDWIKDN
FT                   TQP"
FT   gene            635516..636136
FT                   /locus_tag="Shewmr7_0548"
FT   CDS_pept        635516..636136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0548"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   son:SO0698 FxsA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41551"
FT                   /db_xref="GOA:Q0HZA4"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA4"
FT                   /protein_id="ABI41551.1"
FT                   /translation="MFLILFLLFVLIPVVELSVLIRVGEVLGTWTTIGLVLFTAVLGVS
FT                   LVRSQGLSTLMQVQQKLTRGEAPGQEIVEGMMLAMAGVLLVIPGFVTDFIGLLLLTPLT
FT                   RRPIAALVFKRMQLRVVSGLQGGMHGGFGAGPFGPHSGSQSNPFGQSPFEQHTHSDGNV
FT                   YEGDFEHKADPSDKRPESHQLTDQDLDAKANEPKDAQPKDPKP"
FT   gene            636327..636710
FT                   /locus_tag="Shewmr7_0549"
FT   CDS_pept        636327..636710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA3"
FT                   /protein_id="ABI41552.1"
FT                   /translation="MHLTKLKLMSGLLSVVTCSLITYSAVAGPLDPNCDPEKVAKNAAV
FT                   KATTGVSGRCTPEKAAERKAEDAKDAVGDAKDKVTDKVDDIKPDDKLSDKASDALKQDK
FT                   HEHDKHDKKEGVDAKKVVKKVVN"
FT   sig_peptide     636327..636410
FT                   /locus_tag="Shewmr7_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.840 at
FT                   residue 28"
FT   gene            complement(636892..639981)
FT                   /locus_tag="Shewmr7_0550"
FT   CDS_pept        complement(636892..639981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0550"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   ppr:PBPRA2318 hypothetical transporter, AcrB/D/F family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41553"
FT                   /db_xref="GOA:Q0HZA2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA2"
FT                   /protein_id="ABI41553.1"
FT                   /translation="MNIAEYSIRHKVISWMFVLLLLVGGGVSFTGLGQLEFPEFTIKEA
FT                   LVITAYPGASPEQVEEEVTLPLEDALQQLDAVKHVTSINSAGLSQIQIEIKENYDKTSL
FT                   PQVWDEVRRKVNDTAGQLPPGTSTPKVFDDFGDVYGILFNLSGPDYSNRELSNYADYLR
FT                   REIVLVPGVKKVSVAGSVTEQVVIEISQQRLSALGLDQSYIYGLINNQNVVSNAGSLVV
FT                   GDNRIRIHPTGEFSSVQDLARLIVSPPGSTELIYLGDIANIEKDYDETPDVLYHNRGET
FT                   ALSLGISFSSGVNVVEVGKSVSQRLAELESQRPIGMNLDTVYNQSLAVDDTVNGFLINL
FT                   LESIAIVIAVLLLFMGLRSGLLMGLILLLTILGTFIVMKVLGIELQLISLGALIIALGM
FT                   LVDNAIVVTEGILIGLRRGKTRLEAAKQIVSQTQWPLLGATVIAIIAFAPIGLSQNAAG
FT                   EFCRSLFQVLMISLFISWITAITLTPFFCHLLFKDAPADDDEEQDPYKGWFFSLYRVSL
FT                   TFALRFRLASIVLVGVMLVSAVIGFGHIKNVFFPASNTPIFFVDIWMPEGTDIKGTERF
FT                   TADIEKLLLKQAEEQHSGLKHLTSVIGQGAQRFILPYQPEKGYPAYAQLIIEMEDLASL
FT                   KVYMPELETLLNQRFPQAQYRFKNMENGPSPAAKIEARFYGDDPEVLRALGAQAEAIFN
FT                   AEPSMDGIRHDWRNQVPLIRPQLENAQARETGISKQDLDNALLINFSGKQIGLYRETSH
FT                   LLPIVARAPAEERLQADSLWKLQIWSTEHNTFVPATQVVSQFETQWENPLVKRRDRMRM
FT                   LAVLADPKLGSDETADSVLRKVKDKVEAISLPTGYHLEWGGEYETAGEAQTAVFSSIPM
FT                   GYLVMFLITVFLFNSVRQPLVIWFTVPLALIGVSAGLLLFDAPFSFMALLGLLSLSGMV
FT                   IKNGIVLVDQINLELGEGKPAYAALVDSSVSRVRPVLMAAITTMLGMIPLIPDAFFGSM
FT                   AITIIFGLGFASLLTLIVLPVMYSLAFNIKPNAVAGAVNN"
FT   sig_peptide     complement(639889..639981)
FT                   /locus_tag="Shewmr7_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.360 at
FT                   residue 31"
FT   gene            complement(639985..641067)
FT                   /locus_tag="Shewmr7_0551"
FT   CDS_pept        complement(639985..641067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0551"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ppr:PBPRA2319 hypothetical membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41554"
FT                   /db_xref="GOA:Q0HZA1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA1"
FT                   /protein_id="ABI41554.1"
FT                   /translation="MKSYRLLPLAALLPALLTACTPAESSVQATAIRPVKLFEVVQLEG
FT                   GDFRTFPARVSANSRAELSFRISGELTDLALVEGQQIRQGSLLAKLDDRDAHNNLMTRE
FT                   AEHELLAADFQRKTELLKRKLISQAEFDSTQAQLKSAKAALAAARDQLSYTKLIAPFSG
FT                   TVAKRLVDNHQIVQANQGILTLQNNNLLDVSIQVPEAMAASLNTYVQQQNFTAKVRFSA
FT                   LAGMEFDAKFKEYSTQVTPGTQAYEVVFSLPQPKDIQLLPGMSAELTLALVKTPGQTAS
FT                   AIVPVTAIDKRDQDGQVQVWVYQSQSGEIKPTAVTLGRVTSQGIEVLGGINKGDLIVSA
FT                   GLSQLADGMKVKPLRWQRGV"
FT   sig_peptide     complement(640990..641067)
FT                   /locus_tag="Shewmr7_0551"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.848 at
FT                   residue 26"
FT   gene            641197..642189
FT                   /locus_tag="Shewmr7_0552"
FT   CDS_pept        641197..642189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0552"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0701 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41555"
FT                   /db_xref="GOA:Q0HZA0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZA0"
FT                   /protein_id="ABI41555.1"
FT                   /translation="MKTEDLALFHRIAETGSLIEAADLLNLPKSTVSRRLQALEDELNI
FT                   KLFHRQSRSMTLTSAGSHFYQRSLNILAQLDETLFEMTNDDAEISGHLRIQMFPIHSMN
FT                   VLMRAIFRFMDLHPKLTVEVINSAEAVDMVKNNLDVAFVVEPALDTLDLVVRPIFTTDL
FT                   RFYASPDYLAKHGTPKTSQEIESHNVSLFRLSNGKIFNELWIGEEQAVRVRGNFCSNSV
FT                   QVAVEFALQGRGIVYAPTEVVSEYVTAGQLVTLLPEIDPHPGECYLAYPSRRYVSLASR
FT                   RFIDFIIQELAPNGVPTNMSADGNSARRCKPSEEPFPPNDVRFCLKSTT"
FT   gene            complement(642277..643635)
FT                   /locus_tag="Shewmr7_0553"
FT   CDS_pept        complement(642277..643635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0553"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: son:SO0702 MATE
FT                   efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41556"
FT                   /db_xref="GOA:Q0HZ99"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ99"
FT                   /protein_id="ABI41556.1"
FT                   /translation="MQDRHGLLSAPIGRVLLNMSLPNLIGIMTILGFSLADTFFISQLG
FT                   TEALAAISFTFPVTLIISSIAIGIGAGVSTNLGRLIGSGNATRAKVFLHDALLLTFILI
FT                   ASLSALGSIFITPLFSLLGANDTSLPLIHDYMMYWYVGAPLLVLLMVGNQGLRSTGDTR
FT                   SPAMIMTLAAIINLILDPLLIFGIGPFPRLEIQGAAIATLFSWLIALSLSGYLLIIKRR
FT                   MLERAAFDIDRMRANWSKLAHIAQPAALMNLINPLANAVIMAMLAHIDHSAVAAFGAGT
FT                   RLESVLLIVVMALSSSLMPFIAQNLGAGQTQRAKQALLLSLKFILVFQTLLYIPLAFFA
FT                   QPLASLFSTDPQVLEWLSFYILILPCAYGPLGIVIIFATALNAYHRPMSSLVINLCRLV
FT                   LLMLPLAALGSYIDGVKGLLLALPITNLLMGIACYYLAQRICEPTKVTTADAI"
FT   gene            643863..644153
FT                   /locus_tag="Shewmr7_0554"
FT   CDS_pept        643863..644153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0554"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: son:SO0703 chaperonin
FT                   GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41557"
FT                   /db_xref="GOA:Q0HZ98"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZ98"
FT                   /protein_id="ABI41557.1"
FT                   /translation="MNIRPLHDRVIVKRLEVESTSAGGIVLTGSAAEKSTRGEVLAVGN
FT                   GRILENGTVRPLDVKVGDVVIFNEGYGVKKEKIDGQEVLILSEADLMAIVG"
FT   gene            644211..645848
FT                   /locus_tag="Shewmr7_0555"
FT   CDS_pept        644211..645848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0555"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: son:SO0704 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41558"
FT                   /db_xref="GOA:Q0HZ97"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZ97"
FT                   /protein_id="ABI41558.1"
FT                   /translation="MAAKEVVFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFG
FT                   SPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGL
FT                   KAVAAGMNPMDLKRGIDKAVAAAVIELKNLSQDCADSKAIAQVGTISANSDESIGEIIA
FT                   TAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHPFVLL
FT                   VDKKISNIRELLPILEGLAKTGKPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDVAILTGGTVIAEEIGLELEKATLEDLGTAKRVVITKDNTTIIDGNGEQA
FT                   QIEARVSQIKQQIEESTSDYDKEKLQERMAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVPGGGVALVRVASKIADVEVANEDQKHGVVIALRAMEAPLRQIATNA
FT                   GEEASVVANTVKNGSGNYGYNAGNDTYGDMLEMGILDPTKVTRSALQFAASIAGLMITT
FT                   EAMVAELPKADAPDMGGMGGMGGMGGMM"
FT   gene            647011..648660
FT                   /locus_tag="Shewmr7_0556"
FT   CDS_pept        647011..648660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0556"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="KEGG: hch:HCH_03956 retron-type reverse
FT                   transcriptase; PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); HNH endonuclease; Group II intron,
FT                   maturase-specific domain protein; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41559"
FT                   /db_xref="GOA:Q0HZ96"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ96"
FT                   /protein_id="ABI41559.1"
FT                   /translation="MSTALVVPAFSHPAISWHTIDWYAAERQVRELQVRIAKATKQQQW
FT                   RRVKALQRMLVRSFAGKVMAVKRVTENRGKRTPGVDEELWSTPEAKWQAVFRLKRQGYK
FT                   PKPLRRIYIPKANGKRRPLGIPTMLDRAMQALYLLALEPVSETAADRNSYGFRPMRSTH
FT                   DAIEQCFVNLSRKNSSEWVLEGDIKGCFDNISHDWLLANIPLDKQVLSRWLKAGFMESG
FT                   RLNPTDAGTPQGGIISPVLANMALDGLEAVLESHFGKKNTKASYKTKVNYVRYADDFII
FT                   TGISEELLVNEVKPVVEAFMAERGLTLSPEKTVITHIDEGFDFLGQNVRKYNGKLLIKP
FT                   SRKNLRNVLQKVRDIVKSHKTAKVVTLISLLNPVLRGWANYHSHIVAKETFNYVDYRVW
FT                   KLLWQWCRRRHQNRQKRWIKAKYFKTAGPRNWVFSGMTVDGFTKRLVYTNDTAIKRHTK
FT                   IKGEANPYDLAFEEYFEQRLERAWRDSMQGQRRLLILWLRQQKCCPICRHKITKETGWN
FT                   IHHIVERVRGGSDEMDNLVLLHPNCHRQLHSS"
FT   gene            649718..649954
FT                   /locus_tag="Shewmr7_0557"
FT   CDS_pept        649718..649954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0557"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   son:SO0705 transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41560"
FT                   /db_xref="GOA:Q0HZ95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ95"
FT                   /protein_id="ABI41560.1"
FT                   /translation="MTSPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKG
FT                   EDVYISTVFKILDGLGIDIVSAQTSDTETNGWY"
FT   gene            649988..651259
FT                   /locus_tag="Shewmr7_0558"
FT   CDS_pept        649988..651259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0558"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: son:SO0706
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41561"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ94"
FT                   /protein_id="ABI41561.1"
FT                   /translation="MHLGDSIIGELSFGATTDTFAVHYTKDWQQSGFPLSPTIPLDGTG
FT                   TSNQISMFLVNLLPENKGLDYLIESLGVSKGNTFALIRAIGLDTAGAIAFVPKGVLLPE
FT                   TQLRPIKAEEVIQRIEDPTMWPMEIWDGKPRLSVAGVQPKLNLFYNGKEFAFAEGTLSS
FT                   THIVKFKKHHHLVINEFITMRLAKVIGMNVANVDIVHFGRYKALCVERFDRRYMSNEQR
FT                   VLRRHIVDSCQALGFSVSKKYERNFGSGRDVKDIREGVSFNRLFSLAAKCRNPVAAKQD
FT                   MLQWALFNLLTGNADAHGKNYSFFMTPSGMEPTPWYDLVSVAMYEDFEQQLAMAIDDEF
FT                   DPNSIYAYQLAAFIDGLGLPRNLLISNLTRIARRIPQAIAEVILMLPPLDEDEASFVSQ
FT                   YKTQLLARCERYLGFVDEVRDVEV"
FT   gene            652056..652652
FT                   /locus_tag="Shewmr7_0559"
FT   CDS_pept        652056..652652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ93"
FT                   /protein_id="ABI41562.1"
FT                   /translation="MIRKITLILAMVLSVFCGAVQAKAIYRLNSSLDVQRQYTTQIIRE
FT                   LSESDIEVIVFDSNRQLLSHKIVIGNMPENLCAENIPAEDVTRFGHAYKYWFSDQLEYC
FT                   EIDPKAFPYSYDAVVSERDIEPSIIVLHIPNDIPADLELPEAKLIQYIFQLIPMADFSS
FT                   LYPAFSIRLTKNGTLVVKEGKYTFQLLLLSKGDMK"
FT   sig_peptide     652056..652124
FT                   /locus_tag="Shewmr7_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            652649..656296
FT                   /locus_tag="Shewmr7_0560"
FT   CDS_pept        652649..656296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0560"
FT                   /product="putative outer membrane adhesin like protein"
FT                   /note="TIGRFAM: putative outer membrane adhesin like
FT                   protein; PFAM: von Willebrand factor, type A; KEGG:
FT                   tcx:Tcr_0105 VCBS"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41563"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ92"
FT                   /protein_id="ABI41563.1"
FT                   /translation="MIQENKLSKVAICVGFALTSSSAMAANSWLSRVNTVTEQQEKSIV
FT                   SANHMQAVSAMSSDSSNAVFDITVSLYNNPKGNEQKAYEEILGYFADGVCEQSNGEHKL
FT                   GKISIFRENKHRSKSDIIWGDREWPRANTAGFGANGMHIWFGDVFPNGAGQGKDHNMLT
FT                   DPLGAGYTLAHEWGHYAYGVYDEYKGNAVSGAANATLTTDVATDSIMSNQWQARNGDMK
FT                   WLNHSTANNIGDVNRTAQGRVYGKSAWEVLTQDVKDDPKSGRKTAQPTRTRYTTLANNA
FT                   PDASNPVKTELPAAQSSCRDQLKFVWVEGDIDMQIVMDRSGSMYGSPINNAIQAAKTLV
FT                   DATAEGSTAMGLVSFSSRSSVKQDFAVQQIPKPDTGIKQALKAAIDNIYASGSTALFDG
FT                   SSLALDNLITYQTAAASGAPGVVFVLADGDDNSSIKNEATVITAYQNANVPIFSFGYGS
FT                   ASPTGPLVTMANATGGKYFSSPTTLSEIIDAFLQANAIATDNQNLVSSTVNVANDASAT
FT                   QEIHIDSGLDNVNIFVNHKGSASDLQLTLKDASGNNVAGVSFDCVTVTGGQSCNVNVPN
FT                   SVIASLGHGEWQLELTNTNVNRPLDATVNVSAEPSLVGSYTVSVEGFAGNAVTYPSPMI
FT                   LTTALTKDKLITGANVLATIKDPMGNTTNLEMFDNGQGGDAVAGDGIYSAVAPYNQNGI
FT                   YQVEVNVDNKDSKARYTATGLFTPTLDGSEPVQEALPTITENFVRIAKTSLVVSDVPYY
FT                   DGDDSHYIATKLETTNAGINGVIDSAGDLDFYVLENIDMSKDLVVRVTDASLGMKPKLT
FT                   VYKPDASTAIVDNVTLATNPSATNYVFSKLAKSELESTLYVVVSHEDDTAATGGYQVSA
FT                   GEPLNTDVPPNNVPVANSDALTIWAGQKVTISPLANDTDADGDTLVIDSVTTGATKGAV
FT                   AVSGNIISYDSGSAFANETPGSTVLDSFAYIITDNKGGFAEATVDVSVKINTPPTATPD
FT                   AISVNENATVTISPLTNDTDADGHTFTLSAKQASLKGKLTDNGDGTFIYDPNGQFNDLV
FT                   KGETANEVFSYTITDEIGATSTTEVTISVVGINAAPVAVADTAVTTKSGSIQIDLLAND
FT                   TDADGDTLTITAIDVGSLKGKVTNNNDGTVTYSPNGQFGHLYQGQSATETFTYTISDGD
FT                   AEMTASVTVTINGEGQAPVEPEKEGSSGGSLSWFVLLLAPLAFMRRRVK"
FT   sig_peptide     652649..652726
FT                   /locus_tag="Shewmr7_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(656469..657314)
FT                   /locus_tag="Shewmr7_0561"
FT   CDS_pept        complement(656469..657314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0561"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: vvu:VV20150
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41564"
FT                   /db_xref="GOA:Q0HZ91"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ91"
FT                   /protein_id="ABI41564.1"
FT                   /translation="MDLNLVRTFLVVAECQSYTKAAEHLQLTQPAISSAIKRLEKCYGE
FT                   NLFIKQGRGIELSSKGQQLIPAFRQALSIIENAMNMRTQFNVCCNESLMSTLFSIDNIS
FT                   LQESPPEKDQLFEHLRQEKIDIIVDSIRTRDSAFMVEEIYLEPLVVICRRGHPRIQHSL
FT                   TKEAFYNEEHVFYSGTWEKIRAFELLANEPIEDRKMALVCHSIASIALNICQSDAIAVI
FT                   PLAFAEQWAEKLNLQILTCPIITDLIPYHLMYHKREIKNPYHKKIREEIKAKIKALSQQ
FT                   "
FT   gene            657456..658973
FT                   /locus_tag="Shewmr7_0562"
FT   CDS_pept        657456..658973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0562"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: vpa:VPA0683 putative
FT                   arylsulfatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41565"
FT                   /db_xref="GOA:Q0HZ90"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ90"
FT                   /protein_id="ABI41565.1"
FT                   /translation="MSTGKKPRSNKFVLNACTLALGAASVTAYAADKPNILVIFGDDVG
FT                   YWNLSTYNNGMLAYSTPNIDSIAAEGTKFTNFYAQQSSTAGRSAFITGQMPKRTGLSKV
FT                   GIPGAPEGISEKDPTIATMLKNLGYATGQFGKNHLGDRDEHLPTNHGFDEFFGNLYHLN
FT                   AEEEPENVDYPKDPAFRKKFGPRGVIHSYADGKIEDTGPLTRKRMETVDGEFLDAAESF
FT                   IEKQVKADKPFFTWFNTTRMHNYTHVPDSYAGKTGAGFYADGMKQHDDEVGKLLKKIKD
FT                   LGIDDNTIIIYTSDNGPMVDMWPDAGMTPFRSEKNTGWEGAFRVPGMIKWPGHIKPGTT
FT                   KNGMVSLEDFFPTLVAAAGGEGIEKELLKGKKVGKQTYKVHLDGYNQLPYFTDKTQESA
FT                   RKEFVYWSDDGDLLALRYNQYKFHFMIQEHETGFAVWQYPFTKLRVPLIFDLSVDPFEK
FT                   GDKGMGYNTWMYERAFLMGPAMSKVSEIMETFKEFPPRMEAGTFVPR"
FT   sig_peptide     657456..657548
FT                   /locus_tag="Shewmr7_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            659042..660349
FT                   /locus_tag="Shewmr7_0563"
FT   CDS_pept        659042..660349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0563"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: vpa:VPA0684
FT                   putative arylsulfatase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41566"
FT                   /db_xref="GOA:Q0HZ89"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ89"
FT                   /protein_id="ABI41566.1"
FT                   /translation="MAKTSMRASTILDVVPLKSAAKALGEHPDYQRRFHVMAKPGGAKC
FT                   NIDCQYCFYLHKEGLLHQPKQPEMDDATLEAFVKGYIESQDGDEIVFSWQGGEPTLLGV
FT                   DYYRKVVQLQKKYQPVGVKIENDLQTNGILLNDEWCQFLAEHNFLVGLSIDGPEELHNK
FT                   YRVTRSGKPTFHLVMAAVEKLKQYKVRFNALVTVNRHNVKYPLEVYRFVTKELGATYIQ
FT                   FNPVVEPSDFKTTAPQFWNSSMVPSVGSELAKPGHPMSVVTDWSVDADDWGKFLIVIFE
FT                   EWINNDLGRVLVNLFETAVAQVMGKPAQLCITAEFCGKGLAIEHNGDVFSCDHYVYPEY
FT                   KIANVRERPLNEMAFSTRQLTFGMAKRDSLPQYCKDCPYLKLCWGECPKNRLLKTPDGE
FT                   EGLNYLCPGIKAFFDYSLPILTGLAVLLGQPHGTNG"
FT   gene            660333..661334
FT                   /locus_tag="Shewmr7_0564"
FT   CDS_pept        660333..661334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0564"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: vpa:VPA0685 MoxR-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41567"
FT                   /db_xref="GOA:Q0HZ88"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ88"
FT                   /protein_id="ABI41567.1"
FT                   /translation="MEPMANTQTHAHGDILALIEQVESQVVGQRTVIRSLILGLLCSGH
FT                   VLLEGLPGTAKTRSVKALANALAISFGRIQFTPDLLPSDVTGTEVLHEAEGKSTLRFQP
FT                   GPVFNQIVLADEINRAPAKVQAALLEAMAEGTITVAGQTHVLPELFMVLATQNPIEQEG
FT                   TYPLPEAQMDRFLIKASVEYPTKEAERDIVRLVRSEENGVFSAEKPQTITIDPASILKA
FT                   RQQIAAVTLSDMVENYIIDLVMATRQPEQYPQSKLASWLMIGASPRASIALDKCARALA
FT                   WLNGRDHVLVDDVREVAILVLGHRLSLSYEALADGVNQRDLVHELLDVVSIG"
FT   gene            661340..662335
FT                   /locus_tag="Shewmr7_0565"
FT   CDS_pept        661340..662335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0565"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   vpa:VPA0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41568"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ87"
FT                   /protein_id="ABI41568.1"
FT                   /translation="MALASLAASSRTQSSMSAAAKQQDSRIYASLPQLVRLQGQTTQIK
FT                   MLSLRYSRAHLSGRYQSHQRGRGLNFEELRHYQLGDDIRQMDWKVTQRTGKPHVRSYTE
FT                   EKDRQVILCVDQRSSMYFGSVSHMKSVVAAEIAALMGWLALANNDRVGLLISATQQLHW
FT                   CSAKRGTAHFLIGLDRLIQANHSLSAASRDSKRVSFAQWMQILSQRSLKAATLVIVSDF
FT                   ADADNQSLKQLKYLQQHNDVLCIFISDPMETHVPEDSVSSTWVVGDGQYQLALQKGQQT
FT                   AEVNKALQKQYLEKQTQLKNLMAMQRMPFIEIGTQGDHLLQLARTLSDIQ"
FT   sig_peptide     661340..661402
FT                   /locus_tag="Shewmr7_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.685 at
FT                   residue 21"
FT   gene            662332..662850
FT                   /locus_tag="Shewmr7_0566"
FT   CDS_pept        662332..662850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA0665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41569"
FT                   /db_xref="GOA:Q0HZ86"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ86"
FT                   /protein_id="ABI41569.1"
FT                   /translation="MTAILLLGATQSPPSSYMLRELRDVAQPDPVSWWPQTLGWQILLL
FT                   VLLLYIGYRLYLKGIFWWRNRYRQEAITALLSLSAEDPHWPTQMMKIIKIVMVYLEPKN
FT                   ASLYGAPLLEQMGRYHSKAHLANEESFQQWLKCLEDPNAARPDFSAVRQGLSQWLSGHQ
FT                   LPEARHGSA"
FT   gene            662837..663844
FT                   /locus_tag="Shewmr7_0567"
FT   CDS_pept        662837..663844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0567"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; KEGG:
FT                   vpa:VPA0688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41570"
FT                   /db_xref="GOA:Q0HZ85"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ85"
FT                   /protein_id="ABI41570.1"
FT                   /translation="MDQLEFAYPWAFILLPLPVLVYWFVPPYRSREDAIKVPFFTEILR
FT                   ALNETPKVAAGLLSPKHWQRGMLILSWLLIVTALAKPSILGEVQTREAFGRDVLMLVDL
FT                   SGSMDEADFTTADGSTLTRLNAAKNVLKTFIAKRSGDRFGLILFGDAAFIQTPFTADQQ
FT                   VWLSLLEEAQTGMAGQSTHLGDAIGLGIKVFEQNPQPSEQQVMIVLTDGNDTGSFVEPV
FT                   DAAKIAAARGIKIYTIAMGDPTHVGEQPMDMEVVQRVSQLTQARAFIAIDQAELDKAYQ
FT                   LIDKLEPQQYSSASFRPKITLHYYLIAIVLALHLLVFCWMTLRQMFSRAEVANE"
FT   gene            663837..665558
FT                   /locus_tag="Shewmr7_0568"
FT   CDS_pept        663837..665558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0568"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; KEGG:
FT                   vfi:VF1421 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41571"
FT                   /db_xref="GOA:Q0HZ84"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ84"
FT                   /protein_id="ABI41571.1"
FT                   /translation="MSDWHLELQMLAQFHFIRPLWLLTLIPVAIVWLLRWRRDDVQQRL
FT                   VFFPNHLRNALTLNQGGWRSQLPLKILMLLLLLALIICAGPTWEREASPFGEDDAALMV
FT                   LLDSSESMKQQDVAPDRLSRAKHKILDLIAARSGGKTGLMVFAGSAHVAMPVTSDAKVL
FT                   QPYLEAISPEVMPLSGKAAQTALSQLAEQLPANAGNSVLLLTDGVDQLTIDAFERYFTE
FT                   QFEHPPYQLLILAIGDPDVQSQVPVDVDSLANLADSTGGSLYRMTIDDSDIQALERKIE
FT                   RFSMLNNDSSMPWLDEGYWLLWPLALLSLLWFRRGWLVKWSLVLALTLPSIAPQQAYAE
FT                   ITVSKAATETQVTQVSFAERSWQWWLDLWLTPDQQGALWFNKGEFAKAAAAYHSVLNKG
FT                   IAYYYGGEYKLAHSAFMQVQTDLGAYYAASALARQREYIAARKLLRTLAKKQDIAPDLK
FT                   ADIEHNLMVIQGLIDEINQASASQANSMGDQETSIELPDDEPQTAEGADEQTSQDKMQS
FT                   QNLTAEQMLGDPKLAEVWLKRVEANPEHFLRAKFQLQNLQPKGAQSTDNAKGGLQP"
FT   gene            665555..666985
FT                   /locus_tag="Shewmr7_0569"
FT   CDS_pept        665555..666985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA0690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41572"
FT                   /db_xref="GOA:Q0HZ83"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ83"
FT                   /protein_id="ABI41572.1"
FT                   /translation="MSHAISALSCDKTLSGSRVRVSIKPVIGSARLMARRVIALMFITL
FT                   ILNGLLLVTHAHAQTDEALPTEPAPAVKVKAWLGDKPDANPDGTQKLWAPTEQILLQIE
FT                   VSTNRWFTSGTQIKGIEIPNVLVKQRNTFAVNYTEREDGQTWSRQRWEIALYPQTSGDF
FT                   SVPEATVITQVAGANGDKQAVTLTTPAMGFRVALPSAELASTKAWFAASDVKVQQEWSP
FT                   NEAEVLKVGDSLVRTINIEANDSLSVLLPNLMTAQASPDWKLYPSSPELVDKQSREGYV
FT                   SSRIDSQAYVLQHGGDVSWPEYRLWWWNTQSGQLEQIVLEGKTIKVKHTLSSWLKYHAW
FT                   TLFTLLLSAAILGLLMCWGKAYYQTHPIPVWLVFYRALRRGEWQTCRALLYRRLRRRKQ
FT                   LLSMTAVSTEPDWQAAALRLQTHSTRRADFIYLWKRIKRVRMGLALPKALVALETQPLL
FT                   TEKVAAEKALSEPKASES"
FT   gene            667020..668003
FT                   /locus_tag="Shewmr7_0570"
FT   CDS_pept        667020..668003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0570"
FT                   /product="putative nonspecific acid phosphatase precursor"
FT                   /note="KEGG: vpa:VP0621 putative nonspecific acid
FT                   phosphatase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41573"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ82"
FT                   /protein_id="ABI41573.1"
FT                   /translation="MRIIRLYRNWMLLLVSMLLVGQAYAAQSDPLASWNDGKAKAAITQ
FT                   FVQQVTDKNSQYFVPAAERIATFDNDGTLWSEQPMYFQVLFALDRLKTLAPSHPEWKTE
FT                   EPFASVLKGDVSKLHTEDLVKVIYATHSGMSTDEFDAIVKDWIATAKHPTTGKKYTEMV
FT                   FQPMLELLDYLRVNGFKTFIVSGGGTGFMRAWVEGVYHIPPEQVVGSTFETEFGLVDGK
FT                   PTLKRMPNFLVNDDKEMKVQEIYERIGRRPIAAFGNSDGDLAMLQWTAAGDGLRLPMYI
FT                   HHTDDKREWKYDRDSHIGQLNKGLDEATAKGWPMVDMKADWKRIYP"
FT   sig_peptide     667020..667097
FT                   /locus_tag="Shewmr7_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            668192..668596
FT                   /locus_tag="Shewmr7_0571"
FT   CDS_pept        668192..668596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0571"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   pae:PA4486 4-carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41574"
FT                   /db_xref="GOA:Q0HZ81"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ81"
FT                   /protein_id="ABI41574.1"
FT                   /translation="MNDEQYEKGLEVRRAVMGDSFVDKALSSATDFTRPLQELVTANCW
FT                   GEVWVREGLSRQTRSLVTIATLAALKASTELKGHVRGALRNGCTVEEIQEVLLHSTLYC
FT                   GMPSGIEAFRAAKEVIEEWQAEQAKVASGS"
FT   gene            complement(668761..669294)
FT                   /locus_tag="Shewmr7_0572"
FT   CDS_pept        complement(668761..669294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41575"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ80"
FT                   /protein_id="ABI41575.1"
FT                   /translation="MRPHTPLLALLFPVLLLGCQEQTQAQNPPAADKPATQSTAQTSTE
FT                   QTSAAQTDTPKNVAVELNPVTAGERDNPQLQAHANKGFIKPTISPQGEGVMLQGTVRYM
FT                   NLEGGFWGIIADNGQKILPKNLPQEYRKDGLRLSFTAQEITGMMTIQQWGTLSSLSEMT
FT                   VIGQVESQSTDPRI"
FT   sig_peptide     complement(669217..669294)
FT                   /locus_tag="Shewmr7_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.940 at
FT                   residue 26"
FT   gene            complement(669477..669728)
FT                   /locus_tag="Shewmr7_0573"
FT   CDS_pept        complement(669477..669728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41576"
FT                   /db_xref="InterPro:IPR021376"
FT                   /db_xref="UniProtKB/TrEMBL:Q0HZ79"
FT                   /protein_id="ABI41576.1"
FT                   /translation="MNPIIAILKEHNVTDAKINELFQALTDNPLMAMGIIGQLGIPPEK
FT                   LQQLMALVMQNPALIKEAVLELGLDFAKVEAAKAQLQK"
FT   gene            670119..672338
FT                   /locus_tag="Shewmr7_0574"
FT   CDS_pept        670119..672338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shewmr7_0574"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: son:SO0725 catalase/peroxidase HPI; TIGRFAM:
FT                   catalase/peroxidase HPI; PFAM: Haem peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shewmr7_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABI41577"
FT                   /db_xref="GOA:Q0HZ78"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0HZ78"
FT                   /protein_id="ABI41577.1"
FT                   /translation="MKKSTIPTLSALTLAMSLAFGGSVIAQEQVTDNQFWWPEQLNLSP
FT                   LRQNAVESNPYGSDYHYAEAFKSLDLDAVKKDIKALMTESQDWWPADYGHYGPFFIRMA
FT                   WHSAGVYRIFDGRGGAAGGQQRFEPLNSWPDNVNLDKARRLLWPIKQKYGSKISWGDLM
FT                   VLTGNVALESMGFKTFGFAGGRVDDWEAEQVNWGSEKAWLDSKRRNEKGELAKPMGATQ
FT                   MGLIYVNPEGPNGVPDPLASAKEIRDTFGRMAMNDEETVALIAGGHTFGKAHGAHDPSK
FT                   CVGADPAASGVEAQGLGWKNKCGKGHSEDTVTSGLEGAWSSNPTKWTMEYLTWLYTFDW
FT                   VQTKSPAGHIQWTPADDKAANLVPDAHLPDKRHAPMMFTSDIALKEDPIYREITTRFLK
FT                   NPQEFELAFAKAWFKLTHRDMGPKARYLGADVPAEMLIWQDPIPALDHPVIDNADIKAL
FT                   GNKILASGLTVPELVRTAWASASSFRGTDMRGGANGARIRLEPMMNWQANNPKELAKVL
FT                   AKLEKVQKDFNGSLKGGKKVSLADVIVLGGSVAVEKAAKEAGVTVSVPFTPGRMDATQA
FT                   QTDVSSFAVLEPTADGFRNYYSKDSSHSPAEMLIERANMLNLTVPEMTVLVGGLRALGA
FT                   NSAGVKHGVFTDKPGTLSNDFFVNLLDMSTKWSKSEKQEGIYEGQDRKSGKLKWTATPV
FT                   DLVFGSHSELRAVSEVYGAQDGQDRFVQDFIKAWNKVMNADRFDI"
FT   sig_peptide     670119..670199
F