(data stored in ACNUC7421 zone)

EMBL: CP000447

ID   CP000447; SV 1; circular; genomic DNA; STD; PRO; 4845257 BP.
XX
AC   CP000447; AAIV01000000-AAIV01000070;
XX
PR   Project:PRJNA13391;
XX
DT   25-SEP-2006 (Rel. 89, Created)
DT   09-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Shewanella frigidimarina NCIMB 400, complete genome.
XX
KW   .
XX
OS   Shewanella frigidimarina NCIMB 400
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-4845257
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Fredrickson J.K., Kolker E., McCuel L.A., DiChristina T., Nealson K.H.,
RA   Newman D., Tiedje J.M., Zhou J., Romine M.F., Culley D.E., Serres M.,
RA   Chertkov O., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Richardson P.;
RT   "Complete sequence of Shewanella frigidimarina NCIMB 400";
RL   Unpublished.
XX
RN   [2]
RP   1-4845257
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Fredrickson J.K., Kolker E., McCuel L.A., DiChristina T., Nealson K.H.,
RA   Newman D., Tiedje J.M., Zhou J., Romine M.F., Culley D.E., Serres M.,
RA   Chertkov O., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Richardson P.;
RT   ;
RL   Submitted (24-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 8672b07a7855bbab77fa93ca76e59050.
DR   BioSample; SAMN02598301.
DR   CABRI; NCIMB 400.
DR   EnsemblGenomes-Gn; EBG00001013115.
DR   EnsemblGenomes-Gn; EBG00001013116.
DR   EnsemblGenomes-Gn; EBG00001013117.
DR   EnsemblGenomes-Gn; EBG00001013118.
DR   EnsemblGenomes-Gn; EBG00001013119.
DR   EnsemblGenomes-Gn; EBG00001013120.
DR   EnsemblGenomes-Gn; EBG00001013121.
DR   EnsemblGenomes-Gn; EBG00001013122.
DR   EnsemblGenomes-Gn; EBG00001013123.
DR   EnsemblGenomes-Gn; EBG00001013124.
DR   EnsemblGenomes-Gn; EBG00001013125.
DR   EnsemblGenomes-Gn; EBG00001013126.
DR   EnsemblGenomes-Gn; EBG00001013127.
DR   EnsemblGenomes-Gn; EBG00001013128.
DR   EnsemblGenomes-Gn; EBG00001013129.
DR   EnsemblGenomes-Gn; EBG00001013130.
DR   EnsemblGenomes-Gn; EBG00001013131.
DR   EnsemblGenomes-Gn; EBG00001013132.
DR   EnsemblGenomes-Gn; EBG00001013133.
DR   EnsemblGenomes-Gn; EBG00001013134.
DR   EnsemblGenomes-Gn; EBG00001013135.
DR   EnsemblGenomes-Gn; EBG00001013136.
DR   EnsemblGenomes-Gn; EBG00001013137.
DR   EnsemblGenomes-Gn; EBG00001013138.
DR   EnsemblGenomes-Gn; EBG00001013139.
DR   EnsemblGenomes-Gn; EBG00001013140.
DR   EnsemblGenomes-Gn; EBG00001013141.
DR   EnsemblGenomes-Gn; EBG00001013142.
DR   EnsemblGenomes-Gn; EBG00001013143.
DR   EnsemblGenomes-Gn; EBG00001013144.
DR   EnsemblGenomes-Gn; EBG00001013145.
DR   EnsemblGenomes-Gn; EBG00001013146.
DR   EnsemblGenomes-Gn; EBG00001013147.
DR   EnsemblGenomes-Gn; EBG00001013148.
DR   EnsemblGenomes-Gn; EBG00001013149.
DR   EnsemblGenomes-Gn; EBG00001013150.
DR   EnsemblGenomes-Gn; EBG00001013151.
DR   EnsemblGenomes-Gn; EBG00001013152.
DR   EnsemblGenomes-Gn; EBG00001013153.
DR   EnsemblGenomes-Gn; EBG00001013154.
DR   EnsemblGenomes-Gn; EBG00001013155.
DR   EnsemblGenomes-Gn; EBG00001013156.
DR   EnsemblGenomes-Gn; EBG00001013157.
DR   EnsemblGenomes-Gn; EBG00001013158.
DR   EnsemblGenomes-Gn; EBG00001013159.
DR   EnsemblGenomes-Gn; EBG00001013160.
DR   EnsemblGenomes-Gn; EBG00001013161.
DR   EnsemblGenomes-Gn; EBG00001013162.
DR   EnsemblGenomes-Gn; EBG00001013163.
DR   EnsemblGenomes-Gn; EBG00001013164.
DR   EnsemblGenomes-Gn; EBG00001013165.
DR   EnsemblGenomes-Gn; EBG00001013166.
DR   EnsemblGenomes-Gn; EBG00001013167.
DR   EnsemblGenomes-Gn; EBG00001013168.
DR   EnsemblGenomes-Gn; EBG00001013169.
DR   EnsemblGenomes-Gn; EBG00001013170.
DR   EnsemblGenomes-Gn; EBG00001013171.
DR   EnsemblGenomes-Gn; EBG00001013172.
DR   EnsemblGenomes-Gn; EBG00001013173.
DR   EnsemblGenomes-Gn; EBG00001013174.
DR   EnsemblGenomes-Gn; EBG00001013175.
DR   EnsemblGenomes-Gn; EBG00001013176.
DR   EnsemblGenomes-Gn; EBG00001013177.
DR   EnsemblGenomes-Gn; EBG00001013178.
DR   EnsemblGenomes-Gn; EBG00001013179.
DR   EnsemblGenomes-Gn; EBG00001013180.
DR   EnsemblGenomes-Gn; EBG00001013181.
DR   EnsemblGenomes-Gn; EBG00001013182.
DR   EnsemblGenomes-Gn; EBG00001013183.
DR   EnsemblGenomes-Gn; EBG00001013184.
DR   EnsemblGenomes-Gn; EBG00001013185.
DR   EnsemblGenomes-Gn; EBG00001013186.
DR   EnsemblGenomes-Gn; EBG00001013187.
DR   EnsemblGenomes-Gn; EBG00001013188.
DR   EnsemblGenomes-Gn; EBG00001013189.
DR   EnsemblGenomes-Gn; EBG00001013190.
DR   EnsemblGenomes-Gn; EBG00001013191.
DR   EnsemblGenomes-Gn; EBG00001013192.
DR   EnsemblGenomes-Gn; EBG00001013193.
DR   EnsemblGenomes-Gn; EBG00001013194.
DR   EnsemblGenomes-Gn; EBG00001013195.
DR   EnsemblGenomes-Gn; EBG00001013196.
DR   EnsemblGenomes-Gn; EBG00001013197.
DR   EnsemblGenomes-Gn; EBG00001013198.
DR   EnsemblGenomes-Gn; EBG00001013199.
DR   EnsemblGenomes-Gn; EBG00001013200.
DR   EnsemblGenomes-Gn; EBG00001013201.
DR   EnsemblGenomes-Gn; EBG00001013202.
DR   EnsemblGenomes-Gn; EBG00001013203.
DR   EnsemblGenomes-Gn; EBG00001013204.
DR   EnsemblGenomes-Gn; EBG00001013205.
DR   EnsemblGenomes-Gn; EBG00001013206.
DR   EnsemblGenomes-Gn; EBG00001013207.
DR   EnsemblGenomes-Gn; EBG00001013208.
DR   EnsemblGenomes-Gn; EBG00001013209.
DR   EnsemblGenomes-Gn; EBG00001013210.
DR   EnsemblGenomes-Gn; EBG00001013211.
DR   EnsemblGenomes-Gn; EBG00001013212.
DR   EnsemblGenomes-Gn; EBG00001013213.
DR   EnsemblGenomes-Gn; EBG00001013214.
DR   EnsemblGenomes-Gn; EBG00001013215.
DR   EnsemblGenomes-Gn; EBG00001013216.
DR   EnsemblGenomes-Gn; EBG00001013217.
DR   EnsemblGenomes-Gn; EBG00001013218.
DR   EnsemblGenomes-Gn; EBG00001013219.
DR   EnsemblGenomes-Gn; EBG00001013220.
DR   EnsemblGenomes-Gn; EBG00001013221.
DR   EnsemblGenomes-Gn; EBG00001013222.
DR   EnsemblGenomes-Gn; EBG00001013223.
DR   EnsemblGenomes-Gn; EBG00001013224.
DR   EnsemblGenomes-Gn; EBG00001013225.
DR   EnsemblGenomes-Gn; EBG00001013226.
DR   EnsemblGenomes-Gn; EBG00001013227.
DR   EnsemblGenomes-Gn; EBG00001013228.
DR   EnsemblGenomes-Gn; EBG00001013229.
DR   EnsemblGenomes-Gn; EBG00001013230.
DR   EnsemblGenomes-Gn; EBG00001013231.
DR   EnsemblGenomes-Gn; EBG00001013232.
DR   EnsemblGenomes-Gn; EBG00001013233.
DR   EnsemblGenomes-Gn; EBG00001013234.
DR   EnsemblGenomes-Gn; EBG00001013235.
DR   EnsemblGenomes-Gn; EBG00001013236.
DR   EnsemblGenomes-Gn; EBG00001013237.
DR   EnsemblGenomes-Gn; EBG00001013238.
DR   EnsemblGenomes-Gn; EBG00001013239.
DR   EnsemblGenomes-Gn; EBG00001013240.
DR   EnsemblGenomes-Gn; EBG00001013241.
DR   EnsemblGenomes-Gn; EBG00001013242.
DR   EnsemblGenomes-Gn; EBG00001013243.
DR   EnsemblGenomes-Gn; EBG00001013244.
DR   EnsemblGenomes-Gn; EBG00001013245.
DR   EnsemblGenomes-Gn; EBG00001013246.
DR   EnsemblGenomes-Gn; EBG00001013247.
DR   EnsemblGenomes-Gn; EBG00001013248.
DR   EnsemblGenomes-Gn; EBG00001013249.
DR   EnsemblGenomes-Gn; EBG00001013250.
DR   EnsemblGenomes-Gn; EBG00001013251.
DR   EnsemblGenomes-Gn; EBG00001013252.
DR   EnsemblGenomes-Gn; EBG00001013253.
DR   EnsemblGenomes-Gn; EBG00001013254.
DR   EnsemblGenomes-Gn; EBG00001013255.
DR   EnsemblGenomes-Gn; EBG00001013256.
DR   EnsemblGenomes-Gn; EBG00001013257.
DR   EnsemblGenomes-Gn; EBG00001013258.
DR   EnsemblGenomes-Gn; EBG00001013259.
DR   EnsemblGenomes-Gn; EBG00001013260.
DR   EnsemblGenomes-Gn; Sfri_R0001.
DR   EnsemblGenomes-Gn; Sfri_R0002.
DR   EnsemblGenomes-Gn; Sfri_R0003.
DR   EnsemblGenomes-Gn; Sfri_R0004.
DR   EnsemblGenomes-Gn; Sfri_R0005.
DR   EnsemblGenomes-Gn; Sfri_R0006.
DR   EnsemblGenomes-Gn; Sfri_R0007.
DR   EnsemblGenomes-Gn; Sfri_R0008.
DR   EnsemblGenomes-Gn; Sfri_R0009.
DR   EnsemblGenomes-Gn; Sfri_R0010.
DR   EnsemblGenomes-Gn; Sfri_R0011.
DR   EnsemblGenomes-Gn; Sfri_R0012.
DR   EnsemblGenomes-Gn; Sfri_R0013.
DR   EnsemblGenomes-Gn; Sfri_R0014.
DR   EnsemblGenomes-Gn; Sfri_R0015.
DR   EnsemblGenomes-Gn; Sfri_R0016.
DR   EnsemblGenomes-Gn; Sfri_R0018.
DR   EnsemblGenomes-Gn; Sfri_R0019.
DR   EnsemblGenomes-Gn; Sfri_R0020.
DR   EnsemblGenomes-Gn; Sfri_R0021.
DR   EnsemblGenomes-Gn; Sfri_R0022.
DR   EnsemblGenomes-Gn; Sfri_R0023.
DR   EnsemblGenomes-Gn; Sfri_R0025.
DR   EnsemblGenomes-Gn; Sfri_R0026.
DR   EnsemblGenomes-Gn; Sfri_R0027.
DR   EnsemblGenomes-Gn; Sfri_R0028.
DR   EnsemblGenomes-Gn; Sfri_R0029.
DR   EnsemblGenomes-Gn; Sfri_R0030.
DR   EnsemblGenomes-Gn; Sfri_R0031.
DR   EnsemblGenomes-Gn; Sfri_R0032.
DR   EnsemblGenomes-Gn; Sfri_R0033.
DR   EnsemblGenomes-Gn; Sfri_R0034.
DR   EnsemblGenomes-Gn; Sfri_R0035.
DR   EnsemblGenomes-Gn; Sfri_R0036.
DR   EnsemblGenomes-Gn; Sfri_R0037.
DR   EnsemblGenomes-Gn; Sfri_R0038.
DR   EnsemblGenomes-Gn; Sfri_R0039.
DR   EnsemblGenomes-Gn; Sfri_R0040.
DR   EnsemblGenomes-Gn; Sfri_R0041.
DR   EnsemblGenomes-Gn; Sfri_R0042.
DR   EnsemblGenomes-Gn; Sfri_R0044.
DR   EnsemblGenomes-Gn; Sfri_R0045.
DR   EnsemblGenomes-Gn; Sfri_R0046.
DR   EnsemblGenomes-Gn; Sfri_R0047.
DR   EnsemblGenomes-Gn; Sfri_R0048.
DR   EnsemblGenomes-Gn; Sfri_R0049.
DR   EnsemblGenomes-Gn; Sfri_R0050.
DR   EnsemblGenomes-Gn; Sfri_R0051.
DR   EnsemblGenomes-Gn; Sfri_R0053.
DR   EnsemblGenomes-Gn; Sfri_R0054.
DR   EnsemblGenomes-Gn; Sfri_R0055.
DR   EnsemblGenomes-Gn; Sfri_R0056.
DR   EnsemblGenomes-Gn; Sfri_R0057.
DR   EnsemblGenomes-Gn; Sfri_R0058.
DR   EnsemblGenomes-Gn; Sfri_R0059.
DR   EnsemblGenomes-Gn; Sfri_R0061.
DR   EnsemblGenomes-Gn; Sfri_R0062.
DR   EnsemblGenomes-Gn; Sfri_R0063.
DR   EnsemblGenomes-Gn; Sfri_R0064.
DR   EnsemblGenomes-Gn; Sfri_R0065.
DR   EnsemblGenomes-Gn; Sfri_R0066.
DR   EnsemblGenomes-Gn; Sfri_R0067.
DR   EnsemblGenomes-Gn; Sfri_R0068.
DR   EnsemblGenomes-Gn; Sfri_R0069.
DR   EnsemblGenomes-Gn; Sfri_R0070.
DR   EnsemblGenomes-Gn; Sfri_R0071.
DR   EnsemblGenomes-Gn; Sfri_R0072.
DR   EnsemblGenomes-Gn; Sfri_R0073.
DR   EnsemblGenomes-Gn; Sfri_R0074.
DR   EnsemblGenomes-Gn; Sfri_R0075.
DR   EnsemblGenomes-Gn; Sfri_R0076.
DR   EnsemblGenomes-Gn; Sfri_R0077.
DR   EnsemblGenomes-Gn; Sfri_R0078.
DR   EnsemblGenomes-Gn; Sfri_R0079.
DR   EnsemblGenomes-Gn; Sfri_R0080.
DR   EnsemblGenomes-Gn; Sfri_R0082.
DR   EnsemblGenomes-Gn; Sfri_R0083.
DR   EnsemblGenomes-Gn; Sfri_R0084.
DR   EnsemblGenomes-Gn; Sfri_R0085.
DR   EnsemblGenomes-Gn; Sfri_R0086.
DR   EnsemblGenomes-Gn; Sfri_R0087.
DR   EnsemblGenomes-Gn; Sfri_R0089.
DR   EnsemblGenomes-Gn; Sfri_R0090.
DR   EnsemblGenomes-Gn; Sfri_R0091.
DR   EnsemblGenomes-Gn; Sfri_R0092.
DR   EnsemblGenomes-Gn; Sfri_R0093.
DR   EnsemblGenomes-Gn; Sfri_R0094.
DR   EnsemblGenomes-Gn; Sfri_R0095.
DR   EnsemblGenomes-Gn; Sfri_R0096.
DR   EnsemblGenomes-Gn; Sfri_R0097.
DR   EnsemblGenomes-Gn; Sfri_R0098.
DR   EnsemblGenomes-Gn; Sfri_R0099.
DR   EnsemblGenomes-Gn; Sfri_R0100.
DR   EnsemblGenomes-Gn; Sfri_R0101.
DR   EnsemblGenomes-Gn; Sfri_R0102.
DR   EnsemblGenomes-Gn; Sfri_R0103.
DR   EnsemblGenomes-Gn; Sfri_R0104.
DR   EnsemblGenomes-Gn; Sfri_R0105.
DR   EnsemblGenomes-Gn; Sfri_R0106.
DR   EnsemblGenomes-Gn; Sfri_R0107.
DR   EnsemblGenomes-Gn; Sfri_R0108.
DR   EnsemblGenomes-Gn; Sfri_R0109.
DR   EnsemblGenomes-Gn; Sfri_R0110.
DR   EnsemblGenomes-Gn; Sfri_R0111.
DR   EnsemblGenomes-Gn; Sfri_R0112.
DR   EnsemblGenomes-Gn; Sfri_R0113.
DR   EnsemblGenomes-Gn; Sfri_R0114.
DR   EnsemblGenomes-Gn; Sfri_R0115.
DR   EnsemblGenomes-Gn; Sfri_R0116.
DR   EnsemblGenomes-Gn; Sfri_R0117.
DR   EnsemblGenomes-Gn; Sfri_R0118.
DR   EnsemblGenomes-Gn; Sfri_R0119.
DR   EnsemblGenomes-Gn; Sfri_R0120.
DR   EnsemblGenomes-Gn; Sfri_R0121.
DR   EnsemblGenomes-Gn; Sfri_R0122.
DR   EnsemblGenomes-Gn; Sfri_R0123.
DR   EnsemblGenomes-Gn; Sfri_R0124.
DR   EnsemblGenomes-Gn; Sfri_R0125.
DR   EnsemblGenomes-Gn; Sfri_R0126.
DR   EnsemblGenomes-Gn; Sfri_R0127.
DR   EnsemblGenomes-Gn; Sfri_R0128.
DR   EnsemblGenomes-Gn; Sfri_R0130.
DR   EnsemblGenomes-Gn; Sfri_R0131.
DR   EnsemblGenomes-Gn; Sfri_R0132.
DR   EnsemblGenomes-Gn; Sfri_R0133.
DR   EnsemblGenomes-Tr; EBT00001535154.
DR   EnsemblGenomes-Tr; EBT00001535155.
DR   EnsemblGenomes-Tr; EBT00001535156.
DR   EnsemblGenomes-Tr; EBT00001535157.
DR   EnsemblGenomes-Tr; EBT00001535158.
DR   EnsemblGenomes-Tr; EBT00001535159.
DR   EnsemblGenomes-Tr; EBT00001535160.
DR   EnsemblGenomes-Tr; EBT00001535161.
DR   EnsemblGenomes-Tr; EBT00001535162.
DR   EnsemblGenomes-Tr; EBT00001535163.
DR   EnsemblGenomes-Tr; EBT00001535164.
DR   EnsemblGenomes-Tr; EBT00001535165.
DR   EnsemblGenomes-Tr; EBT00001535166.
DR   EnsemblGenomes-Tr; EBT00001535167.
DR   EnsemblGenomes-Tr; EBT00001535168.
DR   EnsemblGenomes-Tr; EBT00001535169.
DR   EnsemblGenomes-Tr; EBT00001535170.
DR   EnsemblGenomes-Tr; EBT00001535171.
DR   EnsemblGenomes-Tr; EBT00001535172.
DR   EnsemblGenomes-Tr; EBT00001535173.
DR   EnsemblGenomes-Tr; EBT00001535174.
DR   EnsemblGenomes-Tr; EBT00001535175.
DR   EnsemblGenomes-Tr; EBT00001535176.
DR   EnsemblGenomes-Tr; EBT00001535177.
DR   EnsemblGenomes-Tr; EBT00001535178.
DR   EnsemblGenomes-Tr; EBT00001535179.
DR   EnsemblGenomes-Tr; EBT00001535180.
DR   EnsemblGenomes-Tr; EBT00001535181.
DR   EnsemblGenomes-Tr; EBT00001535182.
DR   EnsemblGenomes-Tr; EBT00001535183.
DR   EnsemblGenomes-Tr; EBT00001535184.
DR   EnsemblGenomes-Tr; EBT00001535185.
DR   EnsemblGenomes-Tr; EBT00001535186.
DR   EnsemblGenomes-Tr; EBT00001535187.
DR   EnsemblGenomes-Tr; EBT00001535188.
DR   EnsemblGenomes-Tr; EBT00001535189.
DR   EnsemblGenomes-Tr; EBT00001535190.
DR   EnsemblGenomes-Tr; EBT00001535191.
DR   EnsemblGenomes-Tr; EBT00001535192.
DR   EnsemblGenomes-Tr; EBT00001535193.
DR   EnsemblGenomes-Tr; EBT00001535194.
DR   EnsemblGenomes-Tr; EBT00001535195.
DR   EnsemblGenomes-Tr; EBT00001535196.
DR   EnsemblGenomes-Tr; EBT00001535197.
DR   EnsemblGenomes-Tr; EBT00001535198.
DR   EnsemblGenomes-Tr; EBT00001535199.
DR   EnsemblGenomes-Tr; EBT00001535200.
DR   EnsemblGenomes-Tr; EBT00001535202.
DR   EnsemblGenomes-Tr; EBT00001535203.
DR   EnsemblGenomes-Tr; EBT00001535205.
DR   EnsemblGenomes-Tr; EBT00001535207.
DR   EnsemblGenomes-Tr; EBT00001535210.
DR   EnsemblGenomes-Tr; EBT00001535212.
DR   EnsemblGenomes-Tr; EBT00001535215.
DR   EnsemblGenomes-Tr; EBT00001535216.
DR   EnsemblGenomes-Tr; EBT00001535218.
DR   EnsemblGenomes-Tr; EBT00001535221.
DR   EnsemblGenomes-Tr; EBT00001535223.
DR   EnsemblGenomes-Tr; EBT00001535226.
DR   EnsemblGenomes-Tr; EBT00001535227.
DR   EnsemblGenomes-Tr; EBT00001535230.
DR   EnsemblGenomes-Tr; EBT00001535232.
DR   EnsemblGenomes-Tr; EBT00001535234.
DR   EnsemblGenomes-Tr; EBT00001535236.
DR   EnsemblGenomes-Tr; EBT00001535237.
DR   EnsemblGenomes-Tr; EBT00001535238.
DR   EnsemblGenomes-Tr; EBT00001535240.
DR   EnsemblGenomes-Tr; EBT00001535242.
DR   EnsemblGenomes-Tr; EBT00001535244.
DR   EnsemblGenomes-Tr; EBT00001535246.
DR   EnsemblGenomes-Tr; EBT00001535248.
DR   EnsemblGenomes-Tr; EBT00001535250.
DR   EnsemblGenomes-Tr; EBT00001535252.
DR   EnsemblGenomes-Tr; EBT00001535254.
DR   EnsemblGenomes-Tr; EBT00001535255.
DR   EnsemblGenomes-Tr; EBT00001535257.
DR   EnsemblGenomes-Tr; EBT00001535259.
DR   EnsemblGenomes-Tr; EBT00001535261.
DR   EnsemblGenomes-Tr; EBT00001535263.
DR   EnsemblGenomes-Tr; EBT00001535264.
DR   EnsemblGenomes-Tr; EBT00001535266.
DR   EnsemblGenomes-Tr; EBT00001535268.
DR   EnsemblGenomes-Tr; EBT00001535270.
DR   EnsemblGenomes-Tr; EBT00001535272.
DR   EnsemblGenomes-Tr; EBT00001535274.
DR   EnsemblGenomes-Tr; EBT00001535277.
DR   EnsemblGenomes-Tr; EBT00001535279.
DR   EnsemblGenomes-Tr; EBT00001535281.
DR   EnsemblGenomes-Tr; EBT00001535282.
DR   EnsemblGenomes-Tr; EBT00001535283.
DR   EnsemblGenomes-Tr; EBT00001535284.
DR   EnsemblGenomes-Tr; EBT00001535285.
DR   EnsemblGenomes-Tr; EBT00001535286.
DR   EnsemblGenomes-Tr; EBT00001535288.
DR   EnsemblGenomes-Tr; EBT00001535289.
DR   EnsemblGenomes-Tr; EBT00001535291.
DR   EnsemblGenomes-Tr; EBT00001535293.
DR   EnsemblGenomes-Tr; EBT00001535295.
DR   EnsemblGenomes-Tr; EBT00001535297.
DR   EnsemblGenomes-Tr; EBT00001535300.
DR   EnsemblGenomes-Tr; EBT00001535301.
DR   EnsemblGenomes-Tr; EBT00001535302.
DR   EnsemblGenomes-Tr; EBT00001535304.
DR   EnsemblGenomes-Tr; EBT00001535307.
DR   EnsemblGenomes-Tr; EBT00001535309.
DR   EnsemblGenomes-Tr; EBT00001535311.
DR   EnsemblGenomes-Tr; EBT00001535312.
DR   EnsemblGenomes-Tr; EBT00001535313.
DR   EnsemblGenomes-Tr; EBT00001535314.
DR   EnsemblGenomes-Tr; EBT00001535316.
DR   EnsemblGenomes-Tr; EBT00001535317.
DR   EnsemblGenomes-Tr; EBT00001535319.
DR   EnsemblGenomes-Tr; EBT00001535320.
DR   EnsemblGenomes-Tr; EBT00001535322.
DR   EnsemblGenomes-Tr; EBT00001535324.
DR   EnsemblGenomes-Tr; EBT00001535326.
DR   EnsemblGenomes-Tr; EBT00001535328.
DR   EnsemblGenomes-Tr; EBT00001535330.
DR   EnsemblGenomes-Tr; EBT00001535332.
DR   EnsemblGenomes-Tr; EBT00001535334.
DR   EnsemblGenomes-Tr; EBT00001535336.
DR   EnsemblGenomes-Tr; EBT00001535338.
DR   EnsemblGenomes-Tr; EBT00001535340.
DR   EnsemblGenomes-Tr; EBT00001535343.
DR   EnsemblGenomes-Tr; EBT00001535345.
DR   EnsemblGenomes-Tr; EBT00001535347.
DR   EnsemblGenomes-Tr; EBT00001535349.
DR   EnsemblGenomes-Tr; EBT00001535352.
DR   EnsemblGenomes-Tr; EBT00001535354.
DR   EnsemblGenomes-Tr; EBT00001535356.
DR   EnsemblGenomes-Tr; EBT00001535357.
DR   EnsemblGenomes-Tr; EBT00001535358.
DR   EnsemblGenomes-Tr; EBT00001535360.
DR   EnsemblGenomes-Tr; EBT00001535362.
DR   EnsemblGenomes-Tr; EBT00001535363.
DR   EnsemblGenomes-Tr; EBT00001535366.
DR   EnsemblGenomes-Tr; EBT00001535368.
DR   EnsemblGenomes-Tr; EBT00001535370.
DR   EnsemblGenomes-Tr; EBT00001535372.
DR   EnsemblGenomes-Tr; EBT00001535374.
DR   EnsemblGenomes-Tr; EBT00001535375.
DR   EnsemblGenomes-Tr; EBT00001535377.
DR   EnsemblGenomes-Tr; EBT00001535379.
DR   EnsemblGenomes-Tr; EBT00001535381.
DR   EnsemblGenomes-Tr; EBT00001535383.
DR   EnsemblGenomes-Tr; EBT00001535385.
DR   EnsemblGenomes-Tr; Sfri_R0001-1.
DR   EnsemblGenomes-Tr; Sfri_R0002-1.
DR   EnsemblGenomes-Tr; Sfri_R0003-1.
DR   EnsemblGenomes-Tr; Sfri_R0004-1.
DR   EnsemblGenomes-Tr; Sfri_R0005-1.
DR   EnsemblGenomes-Tr; Sfri_R0006-1.
DR   EnsemblGenomes-Tr; Sfri_R0007-1.
DR   EnsemblGenomes-Tr; Sfri_R0008-1.
DR   EnsemblGenomes-Tr; Sfri_R0009-1.
DR   EnsemblGenomes-Tr; Sfri_R0010-1.
DR   EnsemblGenomes-Tr; Sfri_R0011-1.
DR   EnsemblGenomes-Tr; Sfri_R0012-1.
DR   EnsemblGenomes-Tr; Sfri_R0013-1.
DR   EnsemblGenomes-Tr; Sfri_R0014-1.
DR   EnsemblGenomes-Tr; Sfri_R0015-1.
DR   EnsemblGenomes-Tr; Sfri_R0016-1.
DR   EnsemblGenomes-Tr; Sfri_R0018-1.
DR   EnsemblGenomes-Tr; Sfri_R0019-1.
DR   EnsemblGenomes-Tr; Sfri_R0020-1.
DR   EnsemblGenomes-Tr; Sfri_R0021-1.
DR   EnsemblGenomes-Tr; Sfri_R0022-1.
DR   EnsemblGenomes-Tr; Sfri_R0023-1.
DR   EnsemblGenomes-Tr; Sfri_R0025-1.
DR   EnsemblGenomes-Tr; Sfri_R0026-1.
DR   EnsemblGenomes-Tr; Sfri_R0027-1.
DR   EnsemblGenomes-Tr; Sfri_R0028-1.
DR   EnsemblGenomes-Tr; Sfri_R0029-1.
DR   EnsemblGenomes-Tr; Sfri_R0030-1.
DR   EnsemblGenomes-Tr; Sfri_R0031-1.
DR   EnsemblGenomes-Tr; Sfri_R0032-1.
DR   EnsemblGenomes-Tr; Sfri_R0033-1.
DR   EnsemblGenomes-Tr; Sfri_R0034-1.
DR   EnsemblGenomes-Tr; Sfri_R0035-1.
DR   EnsemblGenomes-Tr; Sfri_R0036-1.
DR   EnsemblGenomes-Tr; Sfri_R0037-1.
DR   EnsemblGenomes-Tr; Sfri_R0038-1.
DR   EnsemblGenomes-Tr; Sfri_R0039-1.
DR   EnsemblGenomes-Tr; Sfri_R0040-1.
DR   EnsemblGenomes-Tr; Sfri_R0041-1.
DR   EnsemblGenomes-Tr; Sfri_R0042-1.
DR   EnsemblGenomes-Tr; Sfri_R0044-1.
DR   EnsemblGenomes-Tr; Sfri_R0045-1.
DR   EnsemblGenomes-Tr; Sfri_R0046-1.
DR   EnsemblGenomes-Tr; Sfri_R0047-1.
DR   EnsemblGenomes-Tr; Sfri_R0048-1.
DR   EnsemblGenomes-Tr; Sfri_R0049-1.
DR   EnsemblGenomes-Tr; Sfri_R0050-1.
DR   EnsemblGenomes-Tr; Sfri_R0051-1.
DR   EnsemblGenomes-Tr; Sfri_R0053-1.
DR   EnsemblGenomes-Tr; Sfri_R0054-1.
DR   EnsemblGenomes-Tr; Sfri_R0055-1.
DR   EnsemblGenomes-Tr; Sfri_R0056-1.
DR   EnsemblGenomes-Tr; Sfri_R0057-1.
DR   EnsemblGenomes-Tr; Sfri_R0058-1.
DR   EnsemblGenomes-Tr; Sfri_R0059-1.
DR   EnsemblGenomes-Tr; Sfri_R0061-1.
DR   EnsemblGenomes-Tr; Sfri_R0062-1.
DR   EnsemblGenomes-Tr; Sfri_R0063-1.
DR   EnsemblGenomes-Tr; Sfri_R0064-1.
DR   EnsemblGenomes-Tr; Sfri_R0065-1.
DR   EnsemblGenomes-Tr; Sfri_R0066-1.
DR   EnsemblGenomes-Tr; Sfri_R0067-1.
DR   EnsemblGenomes-Tr; Sfri_R0068-1.
DR   EnsemblGenomes-Tr; Sfri_R0069-1.
DR   EnsemblGenomes-Tr; Sfri_R0070-1.
DR   EnsemblGenomes-Tr; Sfri_R0071-1.
DR   EnsemblGenomes-Tr; Sfri_R0072-1.
DR   EnsemblGenomes-Tr; Sfri_R0073-1.
DR   EnsemblGenomes-Tr; Sfri_R0074-1.
DR   EnsemblGenomes-Tr; Sfri_R0075-1.
DR   EnsemblGenomes-Tr; Sfri_R0076-1.
DR   EnsemblGenomes-Tr; Sfri_R0077-1.
DR   EnsemblGenomes-Tr; Sfri_R0078-1.
DR   EnsemblGenomes-Tr; Sfri_R0079-1.
DR   EnsemblGenomes-Tr; Sfri_R0080-1.
DR   EnsemblGenomes-Tr; Sfri_R0082-1.
DR   EnsemblGenomes-Tr; Sfri_R0083-1.
DR   EnsemblGenomes-Tr; Sfri_R0084-1.
DR   EnsemblGenomes-Tr; Sfri_R0085-1.
DR   EnsemblGenomes-Tr; Sfri_R0086-1.
DR   EnsemblGenomes-Tr; Sfri_R0087-1.
DR   EnsemblGenomes-Tr; Sfri_R0089-1.
DR   EnsemblGenomes-Tr; Sfri_R0090-1.
DR   EnsemblGenomes-Tr; Sfri_R0091-1.
DR   EnsemblGenomes-Tr; Sfri_R0092-1.
DR   EnsemblGenomes-Tr; Sfri_R0093-1.
DR   EnsemblGenomes-Tr; Sfri_R0094-1.
DR   EnsemblGenomes-Tr; Sfri_R0095-1.
DR   EnsemblGenomes-Tr; Sfri_R0096-1.
DR   EnsemblGenomes-Tr; Sfri_R0097-1.
DR   EnsemblGenomes-Tr; Sfri_R0098-1.
DR   EnsemblGenomes-Tr; Sfri_R0099-1.
DR   EnsemblGenomes-Tr; Sfri_R0100-1.
DR   EnsemblGenomes-Tr; Sfri_R0101-1.
DR   EnsemblGenomes-Tr; Sfri_R0102-1.
DR   EnsemblGenomes-Tr; Sfri_R0103-1.
DR   EnsemblGenomes-Tr; Sfri_R0104-1.
DR   EnsemblGenomes-Tr; Sfri_R0105-1.
DR   EnsemblGenomes-Tr; Sfri_R0106-1.
DR   EnsemblGenomes-Tr; Sfri_R0107-1.
DR   EnsemblGenomes-Tr; Sfri_R0108-1.
DR   EnsemblGenomes-Tr; Sfri_R0109-1.
DR   EnsemblGenomes-Tr; Sfri_R0110-1.
DR   EnsemblGenomes-Tr; Sfri_R0111-1.
DR   EnsemblGenomes-Tr; Sfri_R0112-1.
DR   EnsemblGenomes-Tr; Sfri_R0113-1.
DR   EnsemblGenomes-Tr; Sfri_R0114-1.
DR   EnsemblGenomes-Tr; Sfri_R0115-1.
DR   EnsemblGenomes-Tr; Sfri_R0116-1.
DR   EnsemblGenomes-Tr; Sfri_R0117-1.
DR   EnsemblGenomes-Tr; Sfri_R0118-1.
DR   EnsemblGenomes-Tr; Sfri_R0119-1.
DR   EnsemblGenomes-Tr; Sfri_R0120-1.
DR   EnsemblGenomes-Tr; Sfri_R0121-1.
DR   EnsemblGenomes-Tr; Sfri_R0122-1.
DR   EnsemblGenomes-Tr; Sfri_R0123-1.
DR   EnsemblGenomes-Tr; Sfri_R0124-1.
DR   EnsemblGenomes-Tr; Sfri_R0125-1.
DR   EnsemblGenomes-Tr; Sfri_R0126-1.
DR   EnsemblGenomes-Tr; Sfri_R0127-1.
DR   EnsemblGenomes-Tr; Sfri_R0128-1.
DR   EnsemblGenomes-Tr; Sfri_R0130-1.
DR   EnsemblGenomes-Tr; Sfri_R0131-1.
DR   EnsemblGenomes-Tr; Sfri_R0132-1.
DR   EnsemblGenomes-Tr; Sfri_R0133-1.
DR   EuropePMC; PMC2443923; 18458128.
DR   EuropePMC; PMC5553062; 28797329.
DR   EuropePMC; PMC6153785; 30038043.
DR   EuropePMC; PMC6339943; 30692976.
DR   EuropePMC; PMC6347640; 30701201.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000447.
DR   SILVA-SSU; CP000447.
DR   StrainInfo; 47442; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634606
CC   Source DNA and bacteria available from James K. Fredrickson
CC   (Jim.fredrickson@pnl.gov)
CC   Bacteria also available from NCIMB:NCIMB 400
CC   Contacts: James K. Fredrickson (Jim.fredrickson@pnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4845257
FT                   /organism="Shewanella frigidimarina NCIMB 400"
FT                   /strain="NCIMB 400"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:318167"
FT   gene            23..1408
FT                   /locus_tag="Sfri_0001"
FT   CDS_pept        23..1408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: son:SO0008 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal; Chromosomal replication initiator, DnaA; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69864"
FT                   /db_xref="GOA:Q08A51"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A51"
FT                   /protein_id="ABI69864.1"
FT                   /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGDTLVLYAPNR
FT                   FVLDWVRDKYINIINQFFTEQMGSNAPKLRFDIGSRPSARPVAPAPVAAKPVNRQTKAQ
FT                   VGTTSFNTQAEPIINPNHRSNINPTYQFDNFVEGKSNQLGKAAALQVSENPGGAYNPLF
FT                   LYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRS
FT                   VDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFG
FT                   WGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIAN
FT                   ANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVAR
FT                   PRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIRT
FT                   LSS"
FT   gene            1428..2528
FT                   /locus_tag="Sfri_0002"
FT   CDS_pept        1428..2528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: son:SO0009 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69865"
FT                   /db_xref="GOA:Q08A50"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A50"
FT                   /protein_id="ABI69865.1"
FT                   /translation="MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSESSLKLT
FT                   GTDLEVELVGQAAIHGDIDIGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRS
FT                   RFSLATLPAEDYPNVEEFQADIEFSLKQGVLKSIIDSTQFSMANQDVRYYLNGLLFETE
FT                   GNVLRAIATDGHRLALSHRTLDVSLPEKQVIVPRKGVVEMARLLDSDDQDITIAIGDNA
FT                   IRAITSSAVFTSKLVDGRFPDYRRVLPKGGNKVVIASRNQLKQALTRASILSNEKFRGV
FT                   RIQLETGLLKITANNPEQEEAEEIIDVEYDSDNLEIGFNVSYLLDVLNNLASDEVRITL
FT                   IDGNSSALIENHKEEDSMYVVMPMRL"
FT   gene            2617..3699
FT                   /locus_tag="Sfri_0003"
FT   CDS_pept        2617..3699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: son:SO0010 DNA replication
FT                   and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69866"
FT                   /db_xref="GOA:Q08A49"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A49"
FT                   /protein_id="ABI69866.1"
FT                   /translation="MSLSRINIGSFRNITSASLQPCDGLNLIYGQNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVINNDDDKLTLFAHLIDADRDCKIGLRRHRSGEIEVKIDGEKVKR
FT                   LSTLAETLPIQVITPESFSLLFEGPKARRQFIDWGAFHSDPHFYQAWVNTRKVLKQRNQ
FT                   LLRNQSSYNQIQFWDKELVRYAEQVTDIRNQYVDSLNVLLKGIIGVFLPRIDIKVSFTR
FT                   GWDSKTDFAQLLENQYSRDLAAGNTGSGPHKADLRLRVGNLPAQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQLDKNSIYLVDDLPSELDAQHRQLLLQLLTETGAQIFVTAIDPQAIVDS
FT                   LSSPPNRMFHVEQGLVTVIE"
FT   gene            3715..6132
FT                   /locus_tag="Sfri_0004"
FT   CDS_pept        3715..6132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: son:SO0011 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69867"
FT                   /db_xref="GOA:Q08A48"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A48"
FT                   /protein_id="ABI69867.1"
FT                   /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCSDITISIHSDGSVSVKDDGRGIPVSIHEEEGISAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSQKLQLTIRRAGKVYEQFYTHGVPDAPIKEIGDAVK
FT                   TGTELRFWPSSDTFTDVEFHFEILAKRVRELSFLNSGVGIRLVDERDGKDEFFKYEGGI
FT                   SAFVDYLNRNKTPINKDVFHFSHEREDGITVEVAMQWNDGYQENIFCFTNNIPQRDGGT
FT                   HLAGFRGALTRNLNNYMEREGFNKKGKTSATGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVEQTMGEQLNDYLLENPADAKLIVGKIVDAARAREAARKAREMTRRKGAL
FT                   DLGGLPGKLADCQEKDPGLSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKTRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QMPELIQRGYIYIAQPPLFKVKKGKQEQYLKDEPALTEYLTTQALDGTNIYPSPGAFGM
FT                   SGEPLERLVAQYREVERIIKRLEKRYPTNLLDRMLYHPEVTAAVLSDEAQMTEWCNGFI
FT                   ADLVERESSGIIFTANVMLDPERKVYTPSVTIRKHGIDTNYLFGYDFFTSSDYQRIAKL
FT                   GAALEGMIEEGGYVQRGERVKEVESFLEALDWTISEAKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPESRRMLRVTIEDAVAADQLFTCLMGDQVEPRREFIETNALNVANLDV"
FT   gene            6233..7285
FT                   /locus_tag="Sfri_0005"
FT   CDS_pept        6233..7285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0005"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: son:SO0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69868"
FT                   /db_xref="GOA:Q08A47"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A47"
FT                   /protein_id="ABI69868.1"
FT                   /translation="MVIGFFKKLFNVRDRNEQAKFTGITTAEKRQQTKPQTPVPAIEVT
FT                   EHQAVESQLDLSALFYSLLFATPSTTTTGIANNLERSVMQNIEQALSSPQSIAENVLKL
FT                   PSKILELDKKLGDDNIETQELILLIEQDPLLCVEVLKLCNSPAFKRADTDVSSIQQALV
FT                   QVGRQQLRQFITACLARELIDIKPIYFRRFGAEIWRHSMQVAFLASELASNEQRDSAFL
FT                   LGLLHDVGKIAIFKMLVDAFYQAEPGEQPNSILFKQVMTTKSLTLSALLARSWQLSQHF
FT                   ETPLTLLANTNIKPTDGMTLLIWKANIISECSMLLQVDKLPQPALAVLLAQVECSEEDF
FT                   IELHQKLIQF"
FT   gene            complement(7422..9506)
FT                   /locus_tag="Sfri_0006"
FT   CDS_pept        complement(7422..9506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0006"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: son:SO0014 glycyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69869"
FT                   /db_xref="GOA:Q08A46"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A46"
FT                   /protein_id="ABI69869.1"
FT                   /translation="MNFENLLIEVGTEELPPKALRTLAESFLTSFTDELTKADLPFESA
FT                   VWYAAPRRLAINVLGLALAQADKVVEKRGPAVSSAFDADGNPTKAAQGWARGNGITVEQ
FT                   AERLVTDKGEWLVHQAKVVGVETKSLIADMAQRALDKLPIPKPMRWGNNKTQFIRPVHT
FT                   VTMLLGSELVAGELLGITSNRIIRGHRFMGKASFELDHADNYLAALKEQGKVLADYELR
FT                   KSLIKADAEAAAAKLGGIADIQDGLLEEVASLVEWPIVLTASFEEKFLNVPSEALVYTM
FT                   KGDQKYFPVFDKAGKLLPNFIFVTNIESKDPQQIISGNEKVVRPRLADAEFFFNTDKKN
FT                   TLESRIASLETVVFQKQLGTLKARVERISELAGFIATQMNNNGVETNSVDASRAGLLSK
FT                   TDLMTNMVMEFTDTQGTMGMHYARLDGETEAVAIALEEQYKPKFSGDTVPTATVSCAVA
FT                   LAEKLDTLVGIFGIGQAPKGAADPFALRRAAIGILRVIVENKLPLDLVELIAKAQALHA
FT                   TNITNTNTSDDVLEFLLARFRAWYQDKGIQVDVILAVLARRPTKPADFDSRVKAVSHFR
FT                   GLEASTALAAANKRVSNILAKVEGELPATINSALLTEPAEKALADKLVQLQPQLAPLFA
FT                   DGNYQQALTLLADLRENVDQFFEDVMVMADDEALKNNRLALLTNLREQFLHVADISLLQ
FT                   "
FT   gene            complement(9516..10421)
FT                   /locus_tag="Sfri_0007"
FT   CDS_pept        complement(9516..10421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0007"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   son:SO0015 glycyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69870"
FT                   /db_xref="GOA:Q08A45"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A45"
FT                   /protein_id="ABI69870.1"
FT                   /translation="MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQT
FT                   FLRSLGPEPMSSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLE
FT                   ALGIDTKVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPVTGE
FT                   ITYGLERLAMYIQEVDSVYDLVWTDGPLGRVTYGDIFHQNEVEQSTYNFEHADVDFMFT
FT                   LFDQCEKMCMHLLSLEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMA
FT                   KGVAESYYQAREALGFPMCK"
FT   gene            10534..11097
FT                   /locus_tag="Sfri_0008"
FT   CDS_pept        10534..11097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0008"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: son:SO0016 DNA-3-methyladenine glycosidase I;
FT                   TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69871"
FT                   /db_xref="GOA:Q08A44"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A44"
FT                   /protein_id="ABI69871.1"
FT                   /translation="MQVNRCGWVSEDPLYQHYHDTVWGRPEFDAKQLFAKLCLDGQQAG
FT                   LSWITILKKQQNYQQLFANFEPSIIAQYDQAKVEALMLEPGIVRNRLKINSIIRNAKAY
FT                   LAFVEQGDDFSKFLWGFVGGEPRANNFSSSSQVPAQTAESEAMSKALKKLGFNFVGPTI
FT                   CYAFMQAVGMVNDHTTDCHCHGQY"
FT   gene            complement(11162..14344)
FT                   /locus_tag="Sfri_0009"
FT   CDS_pept        complement(11162..14344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0009"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; WD40 domain protein beta
FT                   Propeller; KEGG: son:SO0017 hypothetical amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69872"
FT                   /db_xref="GOA:Q08A43"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A43"
FT                   /protein_id="ABI69872.1"
FT                   /translation="MLTQKLTPLYTAIALTLGISGFAYAENDKVKWHVNAPENAPLSKI
FT                   DINVTEGTWMNVNVSPDGEHIVFDLLGDIYQIPIAGGEAKPLAQGIAWQMQPVYSPDGK
FT                   YIAFTSDEDGGDNIWIMNADGTNPHAITTETFRLLNSPAWSPDSQYLVARKHFTGTRSL
FT                   GAGEVWMFHVAGGEGVKLTERPNEQKDLGEPAYSPDGRYIYFSQDSTPGKTFHYSKDSV
FT                   KGIYKIKRYDTQTGDIEVLIEGTGGAIRPTPSPDGKTLAYIKRDGFQSTLYTLDLKSGE
FT                   ETKLYDKLDRDMQETWAIHGVYPTMSWTKDNKHIVFWAKGKINKLDVDSKQVTDIPFSV
FT                   STQRDIQPSVRFTQNLDKDEFDVKMLRMAQVSPDGEKVVFEALGKIWVRDIKDGKHKRL
FT                   TRLDDDINELFPQWSRDGKDIVFTTWNDQQQGTVSVVSARGGKAKVLTNEPGKYVEPTF
FT                   SPDGEYIVYRKARGGYMTPRTWSQEPGLYKVDIKGKQSTKLTASGHQPQFGNDSDRVYF
FT                   MDSGETPEFASIGMNGFEKRTHYTSDHATEFRLSPNGEHLAFAERFRVYVTPFAKHGET
FT                   IAIGPKASNLPITQLSARAGESISWNGKNNQLYWTLGPDLYQADVDTQYTKSETKVDPK
FT                   ITSIGFKDKADVPRGTVVFTGGKVITMENDQVIDNGVVIVKDNKIVSVGDANTIIPKNA
FT                   QVIDISGKTIMPGIFDAHAHGGQADDEIIPQQNWALYSGLSLGVTSIHDPSNDTTEIFA
FT                   ASEQQKAGNIVGPRIFSTGTILYGANLPGYTSHVDSLDDAKFHLERLKKVGAFSVKSYN
FT                   QPRRDQRQQIIAAARELEMMVVPEGGSLLQHNLSMIADGHTTVEHSLPAASIYNDIKQF
FT                   WSQTEVHYTPTLVVAYGGISGEHYWYDKTDVWAHPRLSMYVPHDILDARSMRRTTAPDE
FT                   HYNHFNVARVANELNNIGVKPNIGAHGQREGLAAHWEMWMFAQGGMSNMEVLKTATINP
FT                   AVTFGMDHQLGSIKVGKLADLIVIDGDPLADIRTTDKVTYTMVNGKLFNSETMNQLNGD
FT                   KHKRKPFFFEKI"
FT   sig_peptide     complement(14267..14344)
FT                   /locus_tag="Sfri_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(14637..15080)
FT                   /locus_tag="Sfri_0010"
FT   CDS_pept        complement(14637..15080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69873"
FT                   /db_xref="GOA:Q08A42"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A42"
FT                   /protein_id="ABI69873.1"
FT                   /translation="MTITLEAIAYKTAKRGIMKPAFCANVTLERGVENDIFGRPGKRQV
FT                   TVMSKQQWQTACQQIDVDLDWLTRRANLLISGYEFSAADVGKIISIGAELKLQITGETD
FT                   PCKKMEMAHTGLEQALTPDWRGGVTCRVIQAGLIQPDDSVNID"
FT   gene            complement(15084..15329)
FT                   /locus_tag="Sfri_0011"
FT   CDS_pept        complement(15084..15329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0011"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: son:SO0019 SirA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69874"
FT                   /db_xref="GOA:Q08A41"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A41"
FT                   /protein_id="ABI69874.1"
FT                   /translation="MNDIYTQAQHQLDALGLRCPEPVMMIRKTVRKMAEGETLLVIADD
FT                   PATTRDIPSFCEFMDHTLIASDISKTPYHYLLKKGL"
FT   gene            complement(15577..16740)
FT                   /locus_tag="Sfri_0012"
FT   CDS_pept        complement(15577..16740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0012"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: son:SO0020 fatty oxidation complex, beta
FT                   subunit; TIGRFAM: acetyl-CoA acetyltransferases; acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69875"
FT                   /db_xref="GOA:Q08A40"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A40"
FT                   /protein_id="ABI69875.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKALMVRNPQL
FT                   DPNDIEDVIWGCVQQTLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMDALHQAARA
FT                   IMTGQGDTFIIGGVEHMGHVPMNHGVDFHPGLANRVAKASGMMGLTAEMLGKMHGITRE
FT                   QQDAFAVRSHQRAHAATIEGRFAKEIWGIEGHDANGALIKVMTDEVIRPETTLESLAGL
FT                   RPAFDPVNGTVTAGTSSALSDGASAMLVMEESKARALGLTIRARIRSMAVAGCDAAIMG
FT                   YGPVPATKKALARAGLSVADLDLIELNEAFAAQSLPCVKDLGLQDVVDEKINLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEEKDATLGLATMCIGLGQGIATVFERV"
FT   gene            complement(16763..18913)
FT                   /locus_tag="Sfri_0013"
FT   CDS_pept        complement(16763..18913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0013"
FT                   /product="short chain enoyl-CoA hydratase /
FT                   3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="1.1.1.35"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   son:SO0021 enoyl-CoA hydratase / dodecenoyl-CoA
FT                   delta-isomerase / 3-hydroxyacyl-CoA dehydrogenase /
FT                   3-hydroxybutyryl-CoA epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69876"
FT                   /db_xref="GOA:Q08A39"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A39"
FT                   /protein_id="ABI69876.1"
FT                   /translation="MIYQSPTIQVELLEDNIAKLCFNAQGSVNKFDRETIASLDAALDS
FT                   IKQNTNIKALLLTSAKSTFIVGADITEFLTLFQQDDATLLAWVEQANAVFNKLEDLPFP
FT                   TASAINGFALGGGCETILATDLRVADTNARIGLPETKLGLIPGFGGTVRLPRVIGADNA
FT                   LEWITTAKDQRPEDALKVGAIDAVVAPENLEAAAIQMLHDALNGSLDWQARRTKKQSPL
FT                   QLPKLEAMMSFATAKGMVFSVAGKHYPAPMAAVNVVEQAAGLDRDGALKVEALAFIKLA
FT                   KTDVAQALIGIFLNDQFVKGKAKKAGKLAKDVNQAAVLGAGIMGGGIAYQSASKGTPIV
FT                   MKDIAQPALELGLNEAAKILTTQVARGRSTPEKMAKVLNNITPSLDYAAIKNSDIVVEA
FT                   VVEHPKVKATVLAEVEGYVSEDAIIASNTSTISINLLAKSLKKPERFCGMHFFNPVHKM
FT                   PLVEIIRGEHSSEETIATVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLAEG
FT                   ADFAAVDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGKNGKDAIDIMF
FT                   ENKRLGQKNTKGFYAYSVDRRGKPKKDIDPTSYELLSAEFGELKAFESDDIIARCMIPM
FT                   IIETVRCLEEGIIASPAEGDMGLVYGIGFPPFRGGVFRYLDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRALAANNGSYYQA"
FT   gene            19149..20468
FT                   /locus_tag="Sfri_0014"
FT   CDS_pept        19149..20468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0014"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="PFAM: peptidase M24; KEGG: son:SO0022 prolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69877"
FT                   /db_xref="GOA:Q08A38"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A38"
FT                   /protein_id="ABI69877.1"
FT                   /translation="MDQLAHLYHAHMAELNRRVGEICQRENLSGLVIHSGQPHRQFLDD
FT                   LNYPFKVNPQFKAWLPILDTPNCWVIANGQDKPTLVFYRPVDFWHKVNDVPQAFWTEHF
FT                   DIQLLTKPDRIADFLPKDLASWAYIGEHLDVADVLGFAARNPDAVMNYLHYHRADKTQY
FT                   ELECMRRANQIAVKGHLAAKNAFYDGASEFEIQQRYLLEIGQGENEVPYGNIVALNQNA
FT                   AILHYTALEHVKPAQRLSFLIDAGASYHGYAADITRTYSFEKNRFYELIVALDKVQLAI
FT                   IEQMKPGVKYVDLHIATHHYIGQLLIDFGLANGTAEQLVAQGVTSAFFPHGLGHMLGLQ
FT                   VHDMGGYSHDERGTHIAAPEAHPFLRCTRVLAANQVLTIEPGLYIIDTLLNQLSATAKQ
FT                   AINWTTVDEMRPFGGIRIEDNVIVHQDRVENMTREFGLVD"
FT   gene            20461..21075
FT                   /locus_tag="Sfri_0015"
FT   CDS_pept        20461..21075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0015"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   son:SO0023 conserved hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69878"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A37"
FT                   /protein_id="ABI69878.1"
FT                   /translation="MIESYLIPQANVLIEEEIKHSRFISLLFHCPHPNNMKLALTDVKQ
FT                   QYPGANHYCYAFVAGSPENTIDMGASDDGEPSGSAGKPMLACLQGAKIGELGVIVVRYF
FT                   GGTKLGVGGLVRAYTSGIKQGLTQIQTQVKHLRYPARLVCHYAQLTDVEYFVAQYDGVV
FT                   MDKEFTDKVEIHFELAKSHHQAFNQALATQTQGQLQVKFTV"
FT   gene            21149..22606
FT                   /locus_tag="Sfri_0016"
FT   CDS_pept        21149..22606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0016"
FT                   /product="potassium uptake protein, TrkH family protein"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: son:SO0024 potassium uptake
FT                   protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69879"
FT                   /db_xref="GOA:Q08A36"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A36"
FT                   /protein_id="ABI69879.1"
FT                   /translation="MQYKTIIRITGLLMGLFSITMLPSALVAILYKDGGGTAFIQAFFV
FT                   SIFLGFLLWYPNRHQKGDLRTREGFLIVVLFWTVLGSIGALPFIFSNNPDLSWTDSFFE
FT                   SFSALTTTGATVIVGLDDLPKSILFYRHLLQWMGGMGIIVLAVAILPLLGIGGMQLYKA
FT                   EVPGPVKDTKVTPRIAETAKALWYIYFLLTTACALAFYFAGMDAFDAICHSFSTIAIGG
FT                   FSTHDASIGYFQSPLINVICAFFLLIAAVNFSLHFAAFTRRGINVKVYLKDAEFKVLIA
FT                   VQLVLTAICFATLYQSGIYDSPEKTLDYAFFQVVSISTTAGFGTESFHSWPLFLPILLI
FT                   FSSFIGGCAGSTGGGMKVIRLILLVLQGSRELKRLVHPKAMYSIRIGSTALPDRIIDAV
FT                   WGFFSAYALVFVVCMVILMAMDMDAITAFSATAASLNNLGPGLGDVASNYSSISDGAKW
FT                   VLVMAMLFGRLEVFTLLVLFTPTFWKN"
FT   sig_peptide     21149..21232
FT                   /locus_tag="Sfri_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.771 at
FT                   residue 28"
FT   gene            22606..23136
FT                   /locus_tag="Sfri_0017"
FT   CDS_pept        22606..23136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0017"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: son:SO0025 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69880"
FT                   /db_xref="GOA:Q08A35"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A35"
FT                   /protein_id="ABI69880.1"
FT                   /translation="MLNTVILYSTVDGQTLAICQKIKQILVEQGEQVSVVNLAEVEADD
FT                   LASVDKVVIGASIRYGKHRPELFKFVEQHKVLLDTKHNSFFSVNVVARKPEKNTPETNP
FT                   YMQKFSNLSAWKPQLLGVFAGKIDYPRYRFFDKFMIRFIMWMTKGPTDTQGTFEFTDWG
FT                   KVDDYAKQIAAQK"
FT   gene            complement(23262..23567)
FT                   /locus_tag="Sfri_0018"
FT   CDS_pept        complement(23262..23567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0018"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: son:SO0026
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69881"
FT                   /db_xref="GOA:Q08A34"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A34"
FT                   /protein_id="ABI69881.1"
FT                   /translation="MKQDIDVATMLNNAETAAQWLKAIANPYRLMILCLLLEQELSVTE
FT                   LNETVPLSQSALSQHLAVLRTQDLVNTRKSSQVVYYTLKNEQVTEVISILHRRYCA"
FT   gene            23766..24311
FT                   /locus_tag="Sfri_0019"
FT   CDS_pept        23766..24311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0019"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: son:SO0027 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69882"
FT                   /db_xref="GOA:Q08A33"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A33"
FT                   /protein_id="ABI69882.1"
FT                   /translation="MANILVLYYSRGGHTAHISRAISEQIQSKGDHCDVVNLQDKAPIE
FT                   WAKYQAVALGACVLYGSYHKSVFEFVRENQQHLSQLPNSFFCVNVVARNPEKRIPENNK
FT                   YLQKFLTLSAWQPQDVKIIAGKVDYPSWPWYDSLMIRLIMKMTDGPTDPTAIIDYTDWN
FT                   DVKVYADHIAKLATVVPA"
FT   gene            complement(24403..25845)
FT                   /locus_tag="Sfri_0020"
FT   CDS_pept        complement(24403..25845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0020"
FT                   /product="potassium uptake protein, TrkH family protein"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: son:SO0028 potassium uptake
FT                   protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69883"
FT                   /db_xref="GOA:Q08A32"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A32"
FT                   /protein_id="ABI69883.1"
FT                   /translation="MFNVKQIIFILGIFLSILTGFMLVPMAFALFYGEETIGDFMLSGL
FT                   FTGFIAILCIQNGRNHHFSLNIRDMFMLTSITWFVVSLFAALPFTLYHGINYTDAFFET
FT                   MSGITTTGSTVLSGLDSMDHSILVWRSLLQWLGGIGFIVMAVAILPFLNVGGMRLFRTE
FT                   SSDWSDKTIPRTQHMAKHLFLIYVALTLLCTLSYHLAGMHWFEAINHAMTTLSTGGYST
FT                   SDSSMAAFSHEAHWVGIVFMLAGGLPLLMFVQTIQQRSLRLWNDQQVKGFLRFVLLVSF
FT                   SLAFWLWQHQQIDFMDALRLASFNVISVITTTGYGLTDYQSWGSVASVAFLFLMFIGSC
FT                   SGSTSGGIKIFRFQIAFSIMRQQIKQQFHPNGVFKDKYNGHRIQDDIVRSIMAFFMLMI
FT                   VVILLLSITLVLTGLDPMTSFTGAITAVANVGPGLGPIIGPAGNFAPLPDVAKWALAIG
FT                   MLLGRLEILTVAVLFHPKFWRF"
FT   sig_peptide     complement(25756..25845)
FT                   /locus_tag="Sfri_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.651 at
FT                   residue 30"
FT   gene            complement(25852..27261)
FT                   /locus_tag="Sfri_0021"
FT   CDS_pept        complement(25852..27261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0021"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: son:SO0029 potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69884"
FT                   /db_xref="GOA:Q08A31"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A31"
FT                   /protein_id="ABI69884.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITLVDSDRARLRLLQDKFDL
FT                   RVVVGHGAHPSVLKEAGAEDADMLIAVTNSDECNMAACQIAYSLFGTPTKIARIRSEAY
FT                   LELQDKLFINSEIKSGDAKPRGGFIIDELIAPEQLVTAYIQRLVEYPGALQVLEFAKGK
FT                   LSLVAVKAYYGGPLVGNALATLREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   VADSRHIRAVMSEMQKLDNSYRNIMIAGGGNIGFGLAQKLQRTHSVKLIEHRQERAELL
FT                   SEKLEKTTVFCGDASDQELLLEENIDQTDVFIAVTNDDEANIMSALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SSTSKVVGKQIGNIKLPPGTTIGAIVRNDEVLMGHDKTVIEQGDHVILFLVNKKFIGDV
FT                   EKLFQPSAFFF"
FT   gene            complement(27278..28561)
FT                   /locus_tag="Sfri_0022"
FT   CDS_pept        complement(27278..28561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0022"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: son:SO0030 Sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69885"
FT                   /db_xref="GOA:Q08A30"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A30"
FT                   /protein_id="ABI69885.1"
FT                   /translation="MNVRALAAKAIYEVLEKGISLSVALPDQQQHLQNGKDKALLAELC
FT                   YGVMRQLPQLDKCVSDCLAKPFKGKQRILHQLLIVGCYQLYFTRIPAHAAISETAEACR
FT                   QLRFDGLVKVVNGVLRNIQRQDSELNTDSDTLRFNTPAWFIKHLQQAYPDNWQDIIEQS
FT                   HQRPPMWLRNNQQSQTCDAYLAALAQHDISAQAGSSPNAILLESAKDVAALPDFMEGAA
FT                   SVQDGAAQWAATLLAPTADELVLDACAAPGGKSCHLLELAPTINLVAVDFDQKRLARVQ
FT                   QNLDRLHLKAQLIHGDAADIPSWWQGQQFDRILLDAPCSATGVIRRHPDIKWLRKNSDI
FT                   EELANLQKQILDHCWQWLKPGGTLLYATCSILPQENSQQVEQFLARTADASLVPIEQQA
FT                   HISDIGWQILPGQDNMDGFYYARLVKAI"
FT   gene            complement(28563..29519)
FT                   /locus_tag="Sfri_0023"
FT   CDS_pept        complement(28563..29519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0023"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: son:SO0031
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69886"
FT                   /db_xref="GOA:Q08A29"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A29"
FT                   /protein_id="ABI69886.1"
FT                   /translation="MKPLKIIFAGTPDFAARHLQALIDSEHDVIATYTQPDRPAGRGKK
FT                   LTASPVKALALEHAIPVFQPASLRNEEAQAELAALNADIMIVVAYGLILPKVVLDTPRL
FT                   GCINVHGSILPRWRGAAPIQRALWAGDTETGVTIMQMDIGLDTGDMLLKTHLPIEATDT
FT                   SASLYEKLAEQGPKALVQALIGLSDGSLKAQKQDETLANYAEKLSKEEARLDWNKSAKQ
FT                   LWQDIRAFNPWPVSYFEHQQSVIKVWQADYSAELCSQAPGTIIAATKQGIEIATAEGKL
FT                   MIKTMQLPNKKPLDVADILNARGDWFTAGVCLNQEAN"
FT   gene            complement(29528..30094)
FT                   /locus_tag="Sfri_0024"
FT   CDS_pept        complement(29528..30094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0024"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: son:SO0032 polypeptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69887"
FT                   /db_xref="GOA:Q08A28"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A28"
FT                   /protein_id="ABI69887.1"
FT                   /translation="MASIANWLKFDRLAKSLYMPLLNVLRFPDERLRTIAQPVTDFGPQ
FT                   LQTQIDNMLETMYLEKGIGLAATQVDFHQQLIVMDLQDEVERPTIFINPQIVASSGDLA
FT                   NEEGCLSVPGIYAKVDRAEFVTLKALDRHGKEFIVEADELFAICIQHEMDHLKGKLFVD
FT                   YLSPLKRQRIKTKLEKEARLDAREA"
FT   gene            30167..31273
FT                   /locus_tag="Sfri_0025"
FT   CDS_pept        30167..31273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0025"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG: son:SO0033
FT                   LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69888"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A27"
FT                   /protein_id="ABI69888.1"
FT                   /translation="MDCTMKRLLLLAFLCLNSYWVNADTLTLKAGHPDTYIVKKGDTLW
FT                   DISGYFLNDPWRWPKLWGSNPQIANPHLIYPGDRLTLVFIDGQPRLVVKQHIKKSPEGR
FT                   VISKDGPIPPVDLALIKPYLVQNRVVDPTWLAGLPIVMSGESPSIHHVVNDVVYVNAKL
FT                   EQGLKVAIYQTGREFFAPDSGELLGQELILTSSGRVIESGDISKVELLSSLRETKGGFH
FT                   VAPVEDEALMSAYFIPKAAELSVATSIIGTIGHIREAGKLDVVYIDRGANDGVETGHVF
FT                   SMFRDGESIIIDNDGNPVRPLDRSSYDKVLANFSEDTAYKMPDVFHGNLMVFKVFDKTS
FT                   LGLIMFNDHPVRVGDKLTKPNPLTIKGE"
FT   sig_peptide     30167..30238
FT                   /locus_tag="Sfri_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.847) with cleavage site probability 0.827 at
FT                   residue 24"
FT   gene            31357..32373
FT                   /locus_tag="Sfri_0026"
FT   CDS_pept        31357..32373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0026"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: son:SO0034 DNA processing protein
FT                   DprA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69889"
FT                   /db_xref="GOA:Q08A26"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A26"
FT                   /protein_id="ABI69889.1"
FT                   /translation="MDVEEIRQRLEFEPQALPLSASLLAKCHIDFNKVEQALTWLDSQP
FT                   NHYIVTLSDPLYPPLLAQISDPPQVLFIKGSIESLLLPSIAIVGSRNASRGGLDMAADL
FT                   AGHLANQGFSITSGMATGIDGAAHKATLAVDGTTMAVLGCGVECIYPKRHQHLYHDIIN
FT                   TGCVISEYWPSIGPFAGNFPRRNRIVSGLSLGTVVVEASRKSGSLISARLAMEQNREVF
FT                   AVPGSVLGGYSQGCHDLIKNGAKLVESAADIIEELGCLSDYHLEQLHLRHHIQDNDVSD
FT                   LPFPPLLASVGYETTAIDSVVEDSGKPIDLVLIQMLELELQGWVAAVPGGYVRLKRS"
FT   gene            32376..32849
FT                   /locus_tag="Sfri_0027"
FT   CDS_pept        32376..32849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0027"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   son:SO0035 Smg protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69890"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A25"
FT                   /protein_id="ABI69890.1"
FT                   /translation="MFDILMYLFENYVHSEIELLVDEDELTKELTRAGFHQVDIIKALS
FT                   WLEHLADLQESDKPYLCNHAQHSFRIYTKAEMAKLDVECRGFLLFLEQIQVLSVETREM
FT                   VIDRVMELDEPTLELEDLKWVVLMVLFNVPGNESAYEQMEDLIFEQPEGRLHS"
FT   gene            32909..33472
FT                   /locus_tag="Sfri_0028"
FT   CDS_pept        32909..33472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0028"
FT                   /product="DNA topoisomerase, type IA, zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase, type IA, zn finger domain
FT                   protein; KEGG: son:SO0036 topoisomerase DNA-binding C4 zinc
FT                   finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69891"
FT                   /db_xref="GOA:Q08A24"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A24"
FT                   /protein_id="ABI69891.1"
FT                   /translation="MSKIDQQLFTVHEHALEKEFELCPVCGAELSVKHSKHGSFVGCNN
FT                   YPTCDYARPLVQHESIETQIISGSECPKCGNELAVKSGRFGIFIGCTHYPECTHIEKHD
FT                   HANEAEQITCPLCKKGHLESRTSRYGKTFFACSAYPKCKFIVNYPPHNEACPECGFGIL
FT                   VERKGAAGSRVECPQKSCKYKRAL"
FT   gene            33508..34074
FT                   /locus_tag="Sfri_0029"
FT   CDS_pept        33508..34074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0029"
FT                   /product="translation factor SUA5"
FT                   /note="PFAM: SUA5/yciO/yrdC, N-terminal domain protein;
FT                   KEGG: son:SO0037 Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69892"
FT                   /db_xref="GOA:Q08A23"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A23"
FT                   /protein_id="ABI69892.1"
FT                   /translation="MLQLQPSAVATTIQQGGVIAYPTEAVFGLGCDPDNDSAIEKLLVV
FT                   KQRPWQKGLILVASSFEQLLPYLDITQLTEQQLQFAQSKWPGPFTFVMPIQSHVSKLLC
FT                   GEFDSIAVRVSAHPVVRELCDTLNKPLVSTSANLAGEQPVVDAQHIITDFSDKIDALIL
FT                   GKLGEQRQPSTIIDARSGQILRNGS"
FT   gene            34079..35011
FT                   /locus_tag="Sfri_0030"
FT   CDS_pept        34079..35011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0030"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   son:SO0038 coproporphyrinogen III oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69893"
FT                   /db_xref="GOA:Q08A22"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A22"
FT                   /protein_id="ABI69893.1"
FT                   /translation="MSNTSSHVPDAQQVKSFLLGLQQNICQRLELLDGKATFKADSWER
FT                   EEGGGGTSRVLTQGQVFEQAGVNFSHVMGAAMPASATAHRPELAGRSFEAMGVSLVIHP
FT                   NNPFIPTTHANVRFFIARKEGADPVWWFGGGFDLTPYYPFKEDVVSWHQTAKDICDPFG
FT                   EDVYPKYKKWCDEYFFLPHRNETRGVGGLFFDDLNEPGFERSFEFMQAVGNGFIEAYAP
FT                   IVERNKELEYGDDERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW
FT                   EYAFTPEEGTAEAELYDIYLKPQDWLAAV"
FT   gene            complement(35008..35442)
FT                   /locus_tag="Sfri_0031"
FT   CDS_pept        complement(35008..35442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0031"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: son:SO0039 hypothetical globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69894"
FT                   /db_xref="GOA:Q08A21"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A21"
FT                   /protein_id="ABI69894.1"
FT                   /translation="MNWLRKLFTKPQAVDDRDTAQSNAYDLIGGDKVIRAIAHDFYQQM
FT                   QTRPETQALLAIHRSPMQESEQKLYEYLSGWLGGPQLYQQKHGHPALRARHMPFAIDES
FT                   MRDQWLICMRAAIQNNIKKPEHQQVIIQAISTLADTMRNC"
FT   gene            35614..36996
FT                   /locus_tag="Sfri_0032"
FT   CDS_pept        35614..36996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0032"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: pha:PSHAa1729 enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69895"
FT                   /db_xref="GOA:Q08A20"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A20"
FT                   /protein_id="ABI69895.1"
FT                   /translation="MAKLMPSLVAVALSTAIAGCSPAEQQEPKITINANPYPSTYQILP
FT                   NSTTLLKNAIVLTGTGERIDDADVLIKDGKISAVGQQLSAEGAVVVDAKGKWITPGIID
FT                   VHSHLGVYPSPNAESHNDGNEMTSPVTAEVWAEHSVWPQDPGFNRAREGGITTLQILPG
FT                   SANLIGGRGVTLKNVPATTMQAMKFPAAPYGLKMACGENPKSLYGSRNELPMTRMGNMA
FT                   GYRTAFIQATEYKRAWDKYDAEYAAGKNPVAPKRDLMKDTLKGVLEGDILIHNHCYKAE
FT                   EMAMMIDLGKEFGYHAGTFHHAVEAYKIADLLAENGNCAAMWPDWWGFKLEAYDMVLEN
FT                   VAMVDAVKNSCAVVHSDSGVTIQRLNQETAKIMNNANDNGFDLKAEHVIGWITANAAKS
FT                   LGISDKTGSLEKGKNADVVVWNTNPFSVYAQAEQVFIDGAKVYDRQDPAYQAQSDFMLG
FT                   QQ"
FT   sig_peptide     35614..35691
FT                   /locus_tag="Sfri_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.792 at
FT                   residue 26"
FT   gene            37008..38264
FT                   /locus_tag="Sfri_0033"
FT   CDS_pept        37008..38264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0033"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: cps:CPS_3629
FT                   amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69896"
FT                   /db_xref="GOA:Q08A19"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A19"
FT                   /protein_id="ABI69896.1"
FT                   /translation="MTLFKKSALALSLSVGLALSCVVQAESIAIIHATVYTATEQGVLT
FT                   DATVVIEDGTIVAINPASPTADTVIDAKGAILTPGFIASMNDLGLVEIGAVASSRDAYE
FT                   KEADVIFDPSLAYNPKASTVPFTRKGGITRNVVSSGGGEGIFAGQTFTVDLSGDWDSIL
FT                   AANTGLVVALGAIEEGSRAAGMQQLIHKLEDAKKAQAKKSKAKKTADDDSDVPSREDDI
FT                   INAVLAGEKPLIIAVDRASDILHLIKLKQDLSIDLVLVNAADAVLVADKLAQANIPVVI
FT                   DSMRNLPESFDSLHNSLENAGKLAKAGVKVAIALPGDSHGIYALRFSAGNAVANGMNYE
FT                   DALASVTANVADIFHLDSGRIAVGKPADLVLWSGDPFEFSSKVQKMWIAGEEQSTDSRQ
FT                   DKLRDRYLQKTAMPEAYSR"
FT   sig_peptide     37008..37085
FT                   /locus_tag="Sfri_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            38321..39154
FT                   /locus_tag="Sfri_0034"
FT   CDS_pept        38321..39154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0034"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: son:SO0040 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69897"
FT                   /db_xref="GOA:Q08A18"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A18"
FT                   /protein_id="ABI69897.1"
FT                   /translation="MTDKYAVFGNPIAQSKSPFIHTEFAKQTQQDLSYEAILAPVDQFD
FT                   SSLVAFFADGGKGANVTAPFKEQAFSMCDELSEMAKLAGSVNTLFNLPYGKIGGDNTDG
FT                   VGLVNDLEMLFGSLKGKRVLLVGAGGAARGCILPILQHNVAQLIICNRTHEKAEQLQTL
FT                   FNEYGNFFAKPIEELISPFDLVINSTSAGLSGQLIALPSVIVDETTDCYDMTYSQQTTV
FT                   FNQWAQAQNARKTADGLGMLVGQAAKSFSLWRGITPDTGSVMRKLRESLAQEAID"
FT   gene            39154..39411
FT                   /locus_tag="Sfri_0035"
FT   CDS_pept        39154..39411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF2534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69898"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A17"
FT                   /protein_id="ABI69898.1"
FT                   /translation="MNQSVIFTDQVYPETNQVKFIAQQQGVNINCYASFSVISELCDKQ
FT                   VVSGSNVVCLFEQCRFDLEDQAEALIEQEAFNCSGDIILA"
FT   gene            complement(39408..40631)
FT                   /locus_tag="Sfri_0036"
FT   CDS_pept        complement(39408..40631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0036"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: son:SO3556 cyclic nucleotide
FT                   phosphodiesterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69899"
FT                   /db_xref="GOA:Q08A16"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A16"
FT                   /protein_id="ABI69899.1"
FT                   /translation="MQTKGSINNKHIAYVNVKSHLLLLAVPLLLFVLIFTFAIPENSIP
FT                   YLYLILICSVYALSYGITYYIHKQNILRLWQHLEHVIHINDTTFELVNLSSQYDSENAF
FT                   LDALLQKAVSAIDDAEMGSIILVDKKTKRLQFESVVGLDIKALRKINFTLEETFQFRKT
FT                   HGRCDKAVVINNMKNINAKSTLTNDDQHALLHASIKPICSTLSSPIRIDGELYGMMNLD
FT                   SSKMEAFGDYDINLVNILTSEAANAISLYQKSKKIEILADYDGLTELYNRKKFDATILQ
FT                   WQHHPELASYIIILDMDNLKPLNDQHGHQAGDDALKAFAQSLKSMWHPHFLVARYGGDE
FT                   FIALCRGPIDVLEQQVIQLQHDLALLSPAIHFSYGFAQYDQDWANAFKQADNNMYSQKR
FT                   LKKQLDQP"
FT   sig_peptide     complement(40515..40631)
FT                   /locus_tag="Sfri_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.708) with cleavage site probability 0.641 at
FT                   residue 39"
FT   gene            complement(40917..41462)
FT                   /locus_tag="Sfri_0037"
FT   CDS_pept        complement(40917..41462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0037"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: son:SO0042 carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69900"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A15"
FT                   /protein_id="ABI69900.1"
FT                   /translation="MSTNIRTYQGIHPNLADNVYVDESAVLVGDIKLDHDASVWPLVAA
FT                   RGDVNKIRIGKRSNVQDGSILHVSRKSSANPDGHPLIIGDDVTIGHKAMLHGCKIGHRV
FT                   LIGMGAILLDGAIVEDDVIVGAGSLVPPNKVLQSGYLYVGSPCKQVRPLTEAERAFLPQ
FT                   SADNYVCLKNEYLVDLQQ"
FT   gene            42023..43557
FT                   /locus_tag="Sfri_R0001"
FT   rRNA            42023..43557
FT                   /locus_tag="Sfri_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            43945..46860
FT                   /locus_tag="Sfri_R0002"
FT   rRNA            43945..46860
FT                   /locus_tag="Sfri_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            47003..47124
FT                   /locus_tag="Sfri_R0003"
FT   rRNA            47003..47124
FT                   /locus_tag="Sfri_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            47851..50334
FT                   /locus_tag="Sfri_0038"
FT   CDS_pept        47851..50334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0038"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: son:SO4734 sensory box protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; SMART: PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69901"
FT                   /db_xref="GOA:Q08A14"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A14"
FT                   /protein_id="ABI69901.1"
FT                   /translation="MPRLPKLSLSLLVPACIFILYLGLVCGEYFYEHAELNEQLALRQS
FT                   EQIQKDLFRMRHVVESSLLTQDLERIEQEVALVSTDQNMMVYVILDSGSEIQFANHIIW
FT                   RESNATNVLEGYSADLHRTVITNNKPFLKVNFDRLSIQAYYPLNANSRYSYSNSVELIY
FT                   LEYDIANVLSEAVDSLLKRFIEIWGIGALLLSLFCVMLHYLLIRPLTQLSQAAKNLDSP
FT                   DFNTDIVCTSTELVNLRDYLNQVNGRLSRSKKRLNDAEQRWLFAVEGARNGIWDWCIAT
FT                   GDVFVSDRWKDILGYQPYELDNDYSVWESRLHRDDKAQVLNTLQNYINNQHEYYESVHR
FT                   LRHKDGRYIWILDRGKIVEWDELGRPLRIIGTITDVSGDVKSQQITPDKQGHSGLTDLI
FT                   NRDVLADQLYDLQVLSRKTGQFSALLMINLDNFKLINDALGHQLGDRLLMQIAARLSGT
FT                   FSSAGLVARLGADEFVILAKNFGNEIDQPSKRALALASEVRQLIGRGYTISEQNLSISA
FT                   RIGLVVFDGIESLEPQVLLARADSAMEQAKDSRSNGCAIYQPELDQNQVQPFKLQNELK
FT                   LAIQNKQMSLVYQPVVDQAGQLNSIEVLMRWYHPQYGYINPRKFIASAELSDCIFELEL
FT                   WALDQVCELIQTLQQANATVPLMSLNVSSRHFHQDHFVNVVMNRINAAHVSATLFQFEL
FT                   SEDVFVVNANVARNKIAEFQRFGVNIAMDNFGGGSCAVHLLQGIRFSQVKLAAVYIEDI
FT                   EYNPETFNIVNAIVEFATKLNFPVVAKQVENKQQLNLLTHAKCTWFQGYIISRPLAHDD
FT                   IIQLIKTQLSLSVVP"
FT   gene            complement(50300..51274)
FT                   /locus_tag="Sfri_0039"
FT   CDS_pept        complement(50300..51274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0039"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: son:SO4733
FT                   lysophospholipase L2"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69902"
FT                   /db_xref="GOA:Q08A13"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A13"
FT                   /protein_id="ABI69902.1"
FT                   /translation="MHYMKFSSELKLDTSEQRHFWQQVHQSSFCTDDGINIAYAMIQHP
FT                   NSQRAIVISNGRVESYIKYQELMFDLYQQGFSVYALDHRGQGLSDRLTHNPHQGYVASF
FT                   TDYTEDLTQFINQIVSQQQHDELFIIAHSMGCTIASDYINQHPNTFTAAVFSAPMFGIR
FT                   LPFTKPIIRWLAQKLDNNRLEANKVHSTFVIGGTHYKPDSFKRNRLTHSQKRYKHYRNI
FT                   FEETTKAQLGSPTNHWLLEAMDAAEKCIDYAKHSQTPILILQAEKDTIVCNEAQNQALS
FT                   THCHKVIIEGAYHEVFIEKDTMRNIALSHTIDFMAQHSKIAVS"
FT   gene            complement(51337..53145)
FT                   /locus_tag="Sfri_0040"
FT   CDS_pept        complement(51337..53145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0040"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   son:SO4732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69903"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A12"
FT                   /protein_id="ABI69903.1"
FT                   /translation="MRLRILPALIMLSLLGCNSHSTTTQIAPQVTHQQTQIDNDLQAII
FT                   DQSWAVNLAFSPELAASLGDASVAAKLDDLSAETLAEKNQQTLQILHTLKQLDRKNLSK
FT                   SDVINAKILQDQLQNEVDMYRFHDHYLPITAESGFHAYIASIAKARFNSIEDYQHYLAK
FT                   LKQLPRYFAQQTYWLKQGLASGITPAKITLNGFEDSISAFIVPVESSGYFTPFTHYPDH
FT                   FSATEKNTLTQQGRTTVEQIVLPLYQQFYNFMTEEYIPNARIDIAASALPDGAAFYQNR
FT                   VEYYTTLPMTAEQVHQLGLQEVARIRSEMEQVIKDVGFKGSFADFLMFLRTDPKFYPKT
FT                   ADELLKEAAFIAKKADAMLPKYFGKLPRTPYGIAPVPAEIAPKYTTGRYSGSNRDDEPG
FT                   YYWVNTYALDKRPLYELEALTLHEAVPGHHLQISLNKELTDLPNFRRYSYISAFGEGWG
FT                   LYSEYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAKGWSRQQAIDFMASNTAL
FT                   SMHNVTTEIDRYISWPGQALSYKIGELTIKRLRAKAEKSLGKDFDIRKFHDAILENGSI
FT                   PMSVLEQMVDEFIARQKATIKQASTG"
FT   sig_peptide     complement(53080..53145)
FT                   /locus_tag="Sfri_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.701 at
FT                   residue 22"
FT   gene            53362..54360
FT                   /locus_tag="Sfri_0041"
FT   CDS_pept        53362..54360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0041"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: son:SO4731 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69904"
FT                   /db_xref="GOA:Q08A11"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A11"
FT                   /protein_id="ABI69904.1"
FT                   /translation="MIDKTIPLVDLHRHLDGNVNVKTIWELGHQHGIQLPANSLEELAP
FT                   FVQIQGKENNLVDFLKKLDWMVAVLADLDAVKRVAYENVIDAASQGLDYAELRFSPYYM
FT                   AMNHNLPIEGVVEAVIDGVRAGVKEHDISVNLIGIMSRSFGQEKCRLELEGILAHRDSI
FT                   VAMDLAGDELGFPGDLFTEHFKRVRDAGLQVTAHAGEAAGAESMWQAINILGATRIGHG
FT                   VNAIHDPKLMEYLAKHRIGIESCPTSNLHTSTVKDYDVHPLRKFMDAGVLIGLNTDDPG
FT                   VSAIDIAHEYRVVKSEMGFSDSQLATLQRNGVEMAFMSDSDRKALYAKKAK"
FT   gene            complement(54434..55774)
FT                   /locus_tag="Sfri_0042"
FT   CDS_pept        complement(54434..55774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0042"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="KEGG: son:SO4730 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69905"
FT                   /db_xref="GOA:Q08A10"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A10"
FT                   /protein_id="ABI69905.1"
FT                   /translation="MIEKYNYSGPRYTSYPTALEFDDAFTEQNLLTSIKNSKSDKLSLY
FT                   VHIPFCAKLCYYCGCNKIITRHSHKADQYIEYLATEIIKRAPLFKNYTVTQMHWGGGTP
FT                   TFLSPEQILKLTALIKQHFNFADVGEYSIEVDPREIELSMLDTLKEAGFNRVSIGVQDF
FT                   NKEVQIAVNREQDEQFIFDLIARAKELGFVSTNVDLIYGLPLQTPETFAKTIARIIELS
FT                   PDRLSVFNYAHLPSRFAAQRKIKEHDMPAPQQKLDMLRQTIESLTDAGYQFIGMDHFAK
FT                   PNDELAKLQNAGKLHRNFQGYTTQEECDLLGLGVSSISQIGDCYAQNQKDIRPYYESID
FT                   ANGHALWKGCSLNHDDEIRRAVIKQIICHFDLDMDKIEQKFAINFDEYFAEDLKLLQTF
FT                   INDKLVDITDRKLTVSQTGRLLIRNICMCFDVYYRQKARQQQFSRVI"
FT   gene            complement(56007..56756)
FT                   /locus_tag="Sfri_0043"
FT   CDS_pept        complement(56007..56756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0043"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   son:SO0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69906"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A09"
FT                   /protein_id="ABI69906.1"
FT                   /translation="MCILFIAVEAHPDYPLIVCANRDEFHHRATEPAYRWATTPIIIAG
FT                   QDKQAGGTWLGINEQGQFAGLTNIRAIEQQDGVRSRGELVVDALTKQHINSQWLTEHSI
FT                   NYNPFNLVFEQHNQLHCFNSKTLTTTLLKPGFHAVSNGALDDIWPKMAKGQQQLQSYIK
FT                   QMQSPCIDQLLNIMRDTSQPKDQDLPQTGISLEWERRLSSIFIEHEEYGTRSTSVVLKH
FT                   RSGKVQLTEVRYDGKARNLGSQRFNLG"
FT   gene            complement(56812..58440)
FT                   /locus_tag="Sfri_0044"
FT   CDS_pept        complement(56812..58440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69907"
FT                   /db_xref="GOA:Q08A08"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A08"
FT                   /protein_id="ABI69907.1"
FT                   /translation="MVYCVVFFDLFLDNMLYLIASCIALLFGPLFYRFFSSGSGLQKGL
FT                   DGFIFVSLGGLVLIHILPELLEHGGFITLLFVMLGVWGPTASEKLFHRYSEITHNITLT
FT                   LGIGGLLLHTITDGGAMVLAQQEGNSTLLALGVIMHRLPVGVAIWWLLKPQVGTRWASA
FT                   VLAAMMVLTSVGYFAGEHLLTQLSLENTVYLQAFVTGSILHVVLHQPHGHQQEDKQGQY
FT                   QYQAGIGSLLGLGLLALLLLMDTGGHEHAHKDHGSEQFVSWLLTISPILLGSYFIATAR
FT                   FASGLRPSHPSLGLRWLQRLAGPEALLITLLLLGPWFALYQILGLLAIGALMTLTKVDI
FT                   TDPHPTLSESPWRFGFSQLVDRSAPWIILSLVLANLIGHPSVPLENPALQVFILLLVFL
FT                   PMRFCNLGTVILALALAYSGWSQIAVAFTLLAAPVLSIGQLKLMNWKQGLMLGGILLVG
FT                   LMVADQLTLSSSLTLQLPESVNILGLVAIVLLFGASLLRLGPRKFLSRLMINLKSAPHS
FT                   HDHGHHSDTKAAHHHESAAPHKHHH"
FT   gene            58656..59312
FT                   /locus_tag="Sfri_0045"
FT   CDS_pept        58656..59312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0045"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   proteins"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: son:SO0129 conserved hypothetical protein
FT                   TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69908"
FT                   /db_xref="GOA:Q08A07"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A07"
FT                   /protein_id="ABI69908.1"
FT                   /translation="MLLRWVYNVAHILLIKRLLSMDIFSAAVMLFLIMDPLGNLPIFAS
FT                   ILRHIDPKKRRKVLIRELLFALVIMLSFLYAGEAILNFLNLRSESVSIAGGIILFLIAI
FT                   KMIFPSPGGVAGLAAGEEPFIVPMAIPLMAGPSILAALILLAHTDSSRMTDWTIALVSA
FT                   WGMSAVILMFYKLFTRILGEKGLIAVERLMGMVLVMISVQMLLDGISNYINSTVN"
FT   gene            59520..59837
FT                   /locus_tag="Sfri_0046"
FT   CDS_pept        59520..59837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69909"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A06"
FT                   /protein_id="ABI69909.1"
FT                   /translation="MKYIIVMLGLVFMTLQGCQNQSAASKVDEQAATVVVTKPLIKDCG
FT                   PSAMPPLRDRTKLTENLRKKGLITADMDQVQIDKIVADYITKRQKAFEKCHKPTPNTGK
FT                   S"
FT   sig_peptide     59520..59591
FT                   /locus_tag="Sfri_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.917) with cleavage site probability 0.758 at
FT                   residue 24"
FT   gene            59837..62674
FT                   /locus_tag="Sfri_0047"
FT   CDS_pept        59837..62674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0047"
FT                   /product="peptidase M6, immune inhibitor A"
FT                   /note="PFAM: PKD domain containing protein; peptidase M6,
FT                   immune inhibitor A; KEGG: son:SO0130 protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69910"
FT                   /db_xref="GOA:Q08A05"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A05"
FT                   /protein_id="ABI69910.1"
FT                   /translation="MSKLTKYQGLAVLSLLLACSGMAAVAAPQTGTPADAGLINEQQVL
FT                   YWLIKRGEVSVDASEAEKQAAVDAFVSRGRNTTFKPAAIEVKAEQLRIKRSAQKNTKNV
FT                   QYAAANNKVLADQDITKTVKVLAVLVDFPDLPHDANQLNVGDTDMYYSSYPTSHYQQLL
FT                   FSETGFTGPSNQTLQSAHQYFQAVSGNSFYFTGQVQDWVTADNNAAYYGGNDSDDNDKA
FT                   VPELVKEAVTKAVSGMSDTELESYDIEDPFDIDGDGNYDEADGIIDHVMLFHSSIGEEA
FT                   GGGVLGEDAIWSHRFYVDSNTNGYVIPGRALKIFGYTVQPIDAAAGVCTHEFGHDLGLP
FT                   DEYDTTNSGDGSPVGSWSLMSGGSWTGSIAGAQPSGFSPYAKSFLQQKYKGKWVNEQHI
FT                   SLADLTSSGTAVQLNHAVNTDAVNQLSIALPAEAVAFKAPLTGQYQYYSGQGNMINNAM
FT                   SFDVTLPLDTPLALSFQAHWDIEDDYDYVQVLVDSVAIEGSYTNSTNSIYPTVKHSISG
FT                   KSSDISTAYGSDSWVDFNFDLSAYAGRDVQISVVYKTDEAVGDYGMAIDDIQLTNQGTV
FT                   FYIDGAESSGVATLSGFSRIEDSLAGKARRYIVQLRSHQGVDAGLVYDKYESGVLLWLE
FT                   NFNQTDNNVSDHPGEGLIGVVDADQNLIGSQSTDVQIRDAAFSLFAQSTYSGDNHLAAE
FT                   PLFDDNRDYSAPLKPQAGLILPELGLTMQVTEQATDSSTATVEFALSDSSVLPPVTLVA
FT                   DINAQATGADVSFNVVVSGGADYTYTWSFGVNNATSTDTAPSYTYSTSGDYNVSVIVTD
FT                   GAGNTVTATEVVRVVILPIAAFTLLPTNLTVALTNTSSQGFGNLTYQWDFGDSSTSTAQ
FT                   SPSHTYTAAGTYTITLKTTDSQGNESTANQAITVSTPIVAVTTPTTTDSGSSGGSLGWL
FT                   SVLMLGLLGYHRKRV"
FT   sig_peptide     59837..59917
FT                   /locus_tag="Sfri_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.983 at
FT                   residue 27"
FT   gene            complement(62765..63379)
FT                   /locus_tag="Sfri_0048"
FT   CDS_pept        complement(62765..63379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0048"
FT                   /product="chorismate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /note="PFAM: Chorismate lyase; KEGG: son:SO0131 putative
FT                   chorismate--pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69911"
FT                   /db_xref="GOA:Q08A04"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A04"
FT                   /protein_id="ABI69911.1"
FT                   /translation="MNVTSISFPYGESIHWFSPQKIDSLPHSQLKEWLLATGSLTQRLK
FT                   THCKHFEVKVLGEHLLEPLADEFPAQTNPVWIREVLLCLDGTPWVFARTLIPQTILGSQ
FT                   TPNYQNADDKQIREQQNDFTRLGTRPLGELLFSSPDITPGNIEVAQFETCGRLAALATS
FT                   LNQQVNSSLWGRRRYFNLHGSQLIVSEIFLPAAVEYINQSI"
FT   gene            63506..63907
FT                   /locus_tag="Sfri_0049"
FT   CDS_pept        63506..63907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0049"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: son:SO0132 flagellar protein FliL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69912"
FT                   /db_xref="GOA:Q08A03"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A03"
FT                   /protein_id="ABI69912.1"
FT                   /translation="MKKLVSTLVMLCCFAFNVHAADEPAVEDYAYYGFEPDIVTNYISN
FT                   RKKLGFVKISVELMVKDPNDLMSLEHHDPLLRSAIVEILGNQSEEKVKSLSGREEIRRE
FT                   CYETVNRLMEQEVGRSIVVNLLFTKYLYD"
FT   sig_peptide     63506..63568
FT                   /locus_tag="Sfri_0049"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            63907..64989
FT                   /locus_tag="Sfri_0050"
FT   CDS_pept        63907..64989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0050"
FT                   /product="protein of unknown function DUF890"
FT                   /note="PFAM: protein of unknown function DUF890; KEGG:
FT                   ppr:PBPRB0892 hypothetical SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69913"
FT                   /db_xref="GOA:Q08A02"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR016909"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08A02"
FT                   /protein_id="ABI69913.1"
FT                   /translation="MTRSTTPPMRAKHSSAKRSPSRSAAKVNPVSVKPNKPLLSKALHP
FT                   RNAHLQGYDFATLIIAMPALAAFVRPNPYGNPSIDFADPKAVKSLNAALLLSEYHINGW
FT                   DIPEGYLCPPVPGRVDYLHYIADLLAVKGKVVKGASIRGLDIGTGANGIYPLLGIQTYG
FT                   WQFVASDIDPVSIDNVAKIAQQNEKITAHLQLRLQPQPEHIFKNIIAADERFDVTLCNP
FT                   PFHSSLAEASEGSLRKVKNLAKNQQQKHGQQSRKLAVSQAKPTLNFGGQKAELWCQGGE
FT                   QQFLANMIKQSRDYANQVLWFTSLVSKSDNLKPCYQLLKQLNAVEVKTIEMTQGNKATR
FT                   ILAWSFLTPAIHQQWATLRP"
FT   gene            complement(64986..65840)
FT                   /locus_tag="Sfri_0051"
FT   CDS_pept        complement(64986..65840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0051"
FT                   /product="formate dehydrogenase, subunit FdhD"
FT                   /note="PFAM: formate dehydrogenase, subunit FdhD; KEGG:
FT                   son:SO4503 formate dehydrogenase accessory protein FdhD,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69914"
FT                   /db_xref="GOA:Q08A01"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A01"
FT                   /protein_id="ABI69914.1"
FT                   /translation="MTQSVSATSLQRNAIKFVKTNTQVPLTIAVKAINEQGQVVDKFVA
FT                   CERPLTVYLNWRPIVTLMTLGAKPESLTIGYLKNQGFISELSLLESVIVDWEVSSAAVI
FT                   TQEVSEDIEQKLSEKTVTSGCGQGTVYGGFLQGLDEIDLPTPSLKQSTIYALLGNINAY
FT                   NETYKNAGAVHGCGICQDEQILAFVEDVGRHNAVDTLAGDMWLDQQSGHDKIFYTTGRL
FT                   TSEMVIKVAKMGIPVLLSRSGVTQMGLDLAMQMGITLIARAKGRHFLVYHGSETIEFDA
FT                   TKD"
FT   gene            66187..66654
FT                   /locus_tag="Sfri_0052"
FT   CDS_pept        66187..66654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69915"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:Q08A00"
FT                   /protein_id="ABI69915.1"
FT                   /translation="MQHTDTIWPMYVSLKKVQTQVGRWTSVRWELDQMVPATEPQPDNS
FT                   VLVPLELYKDQRGSYRINLDMDNATLFIVCDELIDGTWVPAMISADQHVSAGCLESDTP
FT                   VLNIPMPSAVACWIEAFITRHGEVEISAHRRKHVNRRKNEGPSANRSGNMQ"
FT   gene            66651..67307
FT                   /locus_tag="Sfri_0053"
FT   CDS_pept        66651..67307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69916"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z9"
FT                   /protein_id="ABI69916.1"
FT                   /translation="MSDKAEGLLNRWEIRRQRVAEEAQQEELLQQAQEKPDDYNILTAE
FT                   SPQAVSEIDADEVAEPEALPDPNTIEVGGSFARFMAKSVDPTTKAAALRALWKQPQYGH
FT                   IDGLLEYALDYTNQPLLSADVSAELASKVFRYVIEKEKPEPELDADLAPTDIADQAELA
FT                   SNELAEQTDSIAEEDSIDLADNDATTTAALSQPEQPLYQNDDLLKQAVASDEAKA"
FT   gene            67463..69142
FT                   /locus_tag="Sfri_0054"
FT   CDS_pept        67463..69142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0054"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: son:SO4506 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69917"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z8"
FT                   /protein_id="ABI69917.1"
FT                   /translation="MSIRKNQPQLKQARQQVMANTQILQNLIPPTVSYTTQGHVLIIGP
FT                   EDLARLAADKLSTMASRVILANEAITNQDETHLEAVMNAATDVESYYNKLASVKGFLGQ
FT                   FQVKVEGESGISELSVVAIRQAHFDIVLDLSHSPCINLEMLPPGYFYVGQDSDLLADAI
FT                   ASIPELIGEFDKPRYVRVNSDICAHDKHGLNGCNRCLNFCPADAISSVAHKIEIDPYLC
FT                   HGAGSCTNACPTGALSYDLPTPASLHTYLEKLISRYRQEAQTAPVILFHDNEAGAEWIN
FT                   EQLSGDVLPVAMEEITVASIDHWLAALANGAREILILHTPATAPTLLQMLKGESTLANR
FT                   ILDQMGQPQRIRLITPSELTQLDDALAVSLAWPVIMPITLSAIEPNTNVKRSIMFQAID
FT                   HLNSQAAGVDDVLTMANIPYGMVSINSEKCTLCLSCVATCPTQALKDGGDAPALKFVEQ
FT                   DCVQCGLCEAACPENVISLLPQINFNQSARQQVQVLKHEPPFECIRCGSEFATQSMVKK
FT                   IIEMVGEHSAFSANIERLKMCGDCRVKDMFEDILDDPEKQLQ"
FT   gene            69153..69818
FT                   /locus_tag="Sfri_0055"
FT   CDS_pept        69153..69818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0055"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: son:SO4507 TorA specific chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69918"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z7"
FT                   /protein_id="ABI69918.1"
FT                   /translation="MTETGRQVSENDQLRADIYQLLAALFRRQPNTELLQFLAGLEVEA
FT                   EDGNTMSQAWNALKLAAENSDTNTLEDEYFAIFLGVGSGEIMPYGSWFMTGSLMDKPLA
FT                   ALRSDLMLLGFEREENVKEPEDHVAALCEVMGCLILEAPGYRQLAFYQRHIGSWIIRFC
FT                   DNLAKTPSANFYLNVAQLAKAFFTAEANEFEQLSLDIPVNCPGSADLDPLEEEVVQIN"
FT   gene            69869..70066
FT                   /locus_tag="Sfri_0056"
FT   CDS_pept        69869..70066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0056"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   KEGG: son:SO4508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69919"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z6"
FT                   /protein_id="ABI69919.1"
FT                   /translation="MKKQASDMGRRQMLKALALGSAAGAVASVSAPALAQVTKPSTEEP
FT                   TGNNYRETEHIRNYYASLSK"
FT   sig_peptide     69869..69976
FT                   /locus_tag="Sfri_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            70083..72932
FT                   /locus_tag="Sfri_0057"
FT   CDS_pept        70083..72932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0057"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: son:SO4509 formate dehydrogenase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69920"
FT                   /db_xref="GOA:Q089Z5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z5"
FT                   /protein_id="ABI69920.1"
FT                   /translation="MRLTRKTDTATKAEKSGLGLNRRQFLKSASLATGGIAAASMLGAG
FT                   MMRKAEAKDVPHNAPTEIKRTICSHCSVGCGVYAEVQNGVWTGQEPAFDHPFNQGGHCA
FT                   KGAALREHGHGEKRLKYPMKLEGGKWKRLSWDQAINEVGDKMESIRQESGPDSVYFMGS
FT                   AKFSNEQAYMYRKLAAMWGTNNVDHSARICHSTTVAGVANTWGYGAQTNSFNDIRNSKC
FT                   MMFIGSNPCEAHPVAMQHILIGKERGAKIIVVDPRFTRTAAKSDEYVHIRPGTDIPFIY
FT                   GLLWHIFENGWQDDSFISQRVYGMERIREEVKKYTPEEVEHIAGVPKAQMYRVAKMMAE
FT                   TKPGTIVWCMGGTQHHIGNANTRAYCILQLALGNMGIEGGGTNIFRGHDNVQGATDFGL
FT                   LFDNLPGYYGLTSGAWDHWANVWDLEPKWITERFDQGEYLGQSPQTSAGIPCSRWHDGV
FT                   LEDKTKIAQKDNIRLGFFWGQSVNTETRGREVREALNKMDTIVVVDPFPTMAGVMHERQ
FT                   DGVYLLPAATQFETYGSVSASNRSLQWRTQVIEPLFESLPDHTIMYKLAKKWGVADQFC
FT                   KHIKVNGDEPLVEDITREFNTGMWTIGYTGQSPERLKMHQENWGTFDVNSLEAPGGPAK
FT                   GETYGLPWPCWGTPEQKHPGSQILYRTGREVKDGGGNFRARYGVEHNGNNILAEGSFSK
FT                   GSEIQDGYPEFTADMLKQLGWWDDLTAEEKVKAEGKNWKTDISGGIQRVAIKHGCMPYG
FT                   NAKARCIVWNFPDDIPLHREPLYTPRRDLVAKYPTYEDRMVARLPTLYKTIQDKDFATD
FT                   YPLAVTTGRLVEYEGGGEETRSNPWLAELQQEMFIEINPADAADRGLRDGDDVFVHSPE
FT                   GAKITVKAMVTPRVIAGECFMPYHFAGVFEGKSLAKNYPEGTVPYVIGESANTVMTYGY
FT                   DVVTQMQETKSSLCQISKA"
FT   sig_peptide     70083..70241
FT                   /locus_tag="Sfri_0057"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.987 at
FT                   residue 53"
FT   gene            72958..73554
FT                   /locus_tag="Sfri_0058"
FT   CDS_pept        72958..73554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0058"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: son:SO4510 formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69921"
FT                   /db_xref="GOA:Q089Z4"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z4"
FT                   /protein_id="ABI69921.1"
FT                   /translation="MAVMKFLCDTKRCIECNGCVTACKNENDSALEWGIQRRRVVTLND
FT                   GEPGEASISVACMHCTDAPCMAVCPADCFYRTEDGIVLHNKDTCIGCGYCFYACPFGAP
FT                   QFPKKTAFGSRGKMDKCTFCAGGPEEDHSEAERLKYGSNRIAEGKLPMCAELCSTKALL
FT                   AGDAGIVSDIYRQRMAARGNPNVIWGYNPKTGEMI"
FT   gene            73603..74619
FT                   /locus_tag="Sfri_0059"
FT   CDS_pept        73603..74619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0059"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   son:SO4511 formate dehydrogenase, C subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69922"
FT                   /db_xref="GOA:Q089Z3"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z3"
FT                   /protein_id="ABI69922.1"
FT                   /translation="MLTLTLNKSLRRMFALLVLCMGLGLVTSPVYAADEQSSQQQAKSK
FT                   TSDADLWRAVKAGEPGYSTDKGLDADVLINVAGNEGKVLRNTYLKPALGLAVVGVFAAF
FT                   LVFYLVNGPSKLSKGFSGKMVLRWSKSDLWLHWIMAISCLTMMLTGIVIMLGRHFLAPY
FT                   VGDGIWAGIIAFSKFAHDWSSPIFMVSWLLCVIKWMPLQTFKMYDLKWFLVVGGYINFG
FT                   PFKGKHPDSGFANAGEKMWFWTLAIFGLSISITGIMLVFPTLDLPRELSMLALLVHGLS
FT                   ATILIAFTIVHIWMATVLSEGGMECMVSGYCDENWASQHHNVWYDEIKADGSLKYKE"
FT   sig_peptide     73603..73701
FT                   /locus_tag="Sfri_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            74879..75268
FT                   /locus_tag="Sfri_0060"
FT   CDS_pept        74879..75268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0060"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: ilo:IL1764 lipoprotein A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69923"
FT                   /db_xref="GOA:Q089Z2"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z2"
FT                   /protein_id="ABI69923.1"
FT                   /translation="MVAISRNIQLLLFAFILAGCSTIQSGAGGDRIGFTESGQASYYSD
FT                   RHQNNKTASGDIYQHNQKTAAHKTLPFGSNVKVTNTNNGKSVIVKINDRGPFVKGRIID
FT                   LSKSAFSSIGNISTGVINVNIEVVR"
FT   sig_peptide     74879..74959
FT                   /locus_tag="Sfri_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.351 at
FT                   residue 27"
FT   gene            75399..76208
FT                   /locus_tag="Sfri_0061"
FT   CDS_pept        75399..76208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69924"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z1"
FT                   /protein_id="ABI69924.1"
FT                   /translation="MSFYKRPVSSKPLFKINFVSREINPIKQLFGSVAKDMIEIEYSIG
FT                   ELETSMLVVEEHRFYLITKEWIKAVELNVGDQILACSDAIAKIESINKVEGSAHCRDLK
FT                   ISHNHNYFVTTARPAFHDTLCERAPIEKLERIAYELANRPSNFPDGKPTGHHGGPWVAA
FT                   RYLHCDLSKEVIGWGRANDNMCAEDAAVSDLRQKVADAIGVIELHRGNVDISHAYLRKY
FT                   TKKGRFVNKMSPCVYCRDNYGSALNDTTEGVSNLPKDGRDYLPPVDK"
FT   gene            76457..77254
FT                   /locus_tag="Sfri_0062"
FT   CDS_pept        76457..77254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_2860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69925"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Z0"
FT                   /protein_id="ABI69925.1"
FT                   /translation="MNISESHTKELLVAKSLLENPGLAVKITNLIGTPIEKGLALLPDN
FT                   WNKNIAKVTEKSLIKASEAAIFTMKDIPGEESSNLWHKLGVAASGGVGGFFGLAAIAVE
FT                   LPISTSIMLRSIADIARSEGELITTLETKMACLEVFALGGESDLDDGSESGYFAVRAAL
FT                   AKSVSEAAEFMVKKGITDEAAPMLVKLITKIAEKFGVQVTQKAAAQAVPAIGAAGGAII
FT                   NTLFIDHFQDMARGHFIVRKLERIYGYETIKSAYHSLPRKGSK"
FT   gene            77363..78286
FT                   /locus_tag="Sfri_0063"
FT   CDS_pept        77363..78286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_3567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69926"
FT                   /db_xref="GOA:Q089Y9"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y9"
FT                   /protein_id="ABI69926.1"
FT                   /translation="MTQPGSDQAENTKSTISSDIKSGDKVSKREVRESEPTQPEISLTG
FT                   SEREAVVEHGSLSSLTVYSIILREGQEELERPLMSLWWSGIAAGIGISSSVLAEGIIRS
FT                   NIGSDHPYLSIIESLGYTFGFVLVILARLQLFTENTITVVLPLLANTTQRRLFCTARLW
FT                   GIVLVANFVGTFLTAAIVVHGNILTEDILTAILQISRHVAELTPSETLMRGIPAGFFIA
FT                   ALVWMLPSAKGSEVLVIIMFTWLIAAGEFTHVIAGSNEIFSLVLNGEMNFFTALSHHIG
FT                   PMLMGNIIGGTGLFAMLAYGQVRQEM"
FT   gene            78381..79373
FT                   /locus_tag="Sfri_0064"
FT   CDS_pept        78381..79373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0064"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ilo:IL1807
FT                   alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69927"
FT                   /db_xref="GOA:Q089Y8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y8"
FT                   /protein_id="ABI69927.1"
FT                   /translation="MKKFCLVLVTLFAVVSQAFAANPVKYNKELDGFDYPFDVKTFNVN
FT                   SQNKDLKMRYMDIGDKNADKVIVLLHGKNFSGYYWERVAKDLLKNNYRVIIPDQIGFGK
FT                   SSKPDFYQYSFGQLALNTKLLLDSLHIKKFDLVGHSMGGMLATTLAANYSNAVNKLILI
FT                   NPIGLEDYSKYVEFKDVNFFYKNELAKTLDKARDYQKANYYDGKWSSEYEQLLVPVKGM
FT                   LAGDDWQVIAWNNALTYGPIFSENIVDRFSQITNKTVLIIGTRDKTGPGKGWLKEGVTR
FT                   TLGDYKNLGVDTQKLIKGSVLIELDGLGHMPQFENYDVFIKAFHQAIEQ"
FT   sig_peptide     78381..78443
FT                   /locus_tag="Sfri_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            79500..80216
FT                   /locus_tag="Sfri_0065"
FT   CDS_pept        79500..80216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0065"
FT                   /product="ZIP zinc transporter family protein"
FT                   /note="KEGG: cps:CPS_2539 ZIP zinc transporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69928"
FT                   /db_xref="GOA:Q089Y7"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y7"
FT                   /protein_id="ABI69928.1"
FT                   /translation="MSLLLTVIASTLLAGLAMPLGAMIARFEKVGNEWIEQEFRHSVMA
FT                   FGGGALLSAVALVLVPEGIAHLNPLAACIWFMVGGLSFMALDIYLNKIDTPATQLAAML
FT                   SDFIPESIALGAAFATGSNNAFLLAALIALQNVPEGFNAYRELNASSAYKPQKIIIMFC
FT                   LMAVLGPIAAMCGYLWLSESPEIIAAVMLFASGGILYSIFQDLAPQVKLEKRWAPPMGA
FT                   VFGFCLGMLGLMLTTS"
FT   sig_peptide     79500..79568
FT                   /locus_tag="Sfri_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.957 at
FT                   residue 23"
FT   gene            80276..80662
FT                   /locus_tag="Sfri_0066"
FT   CDS_pept        80276..80662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_C_3952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69929"
FT                   /db_xref="GOA:Q089Y6"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y6"
FT                   /protein_id="ABI69929.1"
FT                   /translation="MDYSHLSYLHLVTVVPAFFIGSYLLVVRKGTAKHKALGKIYMVLM
FT                   LFTAIVSLFMPAQLGASFLNHFGYIHLLSLLTLYAVPAGYFYIKKGNVRGHKRSMIILY
FT                   CGGLIVAGTFAFMPGRLLHDWIFS"
FT   gene            80778..81221
FT                   /locus_tag="Sfri_0067"
FT   CDS_pept        80778..81221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0067"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="KEGG: vfi:VF1386 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69930"
FT                   /db_xref="GOA:Q089Y5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y5"
FT                   /protein_id="ABI69930.1"
FT                   /translation="MKYQFGSGTVSDVLDVLALTPEFENVICADSIGNRLAGRNYLILV
FT                   ARYEAKPVGFKVGYELPDGQFYSWLGGVIPEHRQMKVASQLRLLQESWAIENGFNSIKV
FT                   KSMNQFPAMLQMLIASGYQICGYENNGSIAESKIEFIKFLQPQ"
FT   gene            81492..82361
FT                   /locus_tag="Sfri_0068"
FT   CDS_pept        81492..82361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0068"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pha:PSHAb0256 transporter involved in
FT                   threonine and homoserine efflux"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69931"
FT                   /db_xref="GOA:Q089Y4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y4"
FT                   /protein_id="ABI69931.1"
FT                   /translation="MQINRVLLTAVGSVLLAMVTIQSGASLAKQLFPLVGPEGTTALRL
FT                   GFAAAVLWMVFRPWRALPQGRDWQSIIIYGLCLGGMNILFYLAIERIPLGIAVALEFTG
FT                   PLAVALFGSKRKSDLFWVACAIAGILLLMPSLSSTQGLDLVGALMALGAGACWAGYILF
FT                   GTRTGKQASGGITVALGMTVAAVVLVPVGAVSQGLALLSWEVLPLGLLVGVLSSALPYS
FT                   LEMIALRNMPTQAFSVLMSLEPAIAALAGFVILSEQLTMLQWSAIGLVIIASIGSSFTP
FT                   KKAIEMGV"
FT   sig_peptide     81492..81578
FT                   /locus_tag="Sfri_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.959 at
FT                   residue 29"
FT   gene            complement(82458..83498)
FT                   /locus_tag="Sfri_0069"
FT   CDS_pept        complement(82458..83498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69932"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y3"
FT                   /protein_id="ABI69932.1"
FT                   /translation="MSILKKTLISMCLMSASGMVAATPITANVTADNDFIVVHSPGNGS
FT                   SPTVVYRGANGSNWKKIESLKFDIDNSAQSLETCSVSVIAWGDGKVSQGMAAIFKGDST
FT                   IYTGSGHFKAHQSSTPSSGWAQTGGPNASQINTLIADSLANGQSPYLLPGSVAGGTSPW
FT                   GTMNFPLASNVNVNNFRWAWSTSNLAQKTYSVFTAACGDIVEAAPVAVHMPGEHFQCYG
FT                   VRKADKLREETIMIEDQFGKTRAVLGKPVLLCNPSSKIHNEKLYKIRDEERHLVCYDFV
FT                   KQNKVKSRNLEINNQFAPDELMNDQRELFCVPSSKKHLGPIKPNKPGKPIPREMQRAEM
FT                   KPLKQR"
FT   sig_peptide     complement(83430..83498)
FT                   /locus_tag="Sfri_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.794 at
FT                   residue 23"
FT   gene            83717..84376
FT                   /locus_tag="Sfri_0070"
FT   CDS_pept        83717..84376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69933"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y2"
FT                   /protein_id="ABI69933.1"
FT                   /translation="MKYILPLVTLLSCVGSASAHQLSFNELTPVSTAIKTEITFELSEM
FT                   DMIKQYHYRAQYFDIEKWMTNKQLTLHNDHAAATNGAPQSMNTRQMQQPEVEIDDLGGF
FT                   HGVIDPFMKLQDNNVNSPDLNSVTNRINIAGLVAVSMCNAYASINIKDQNNNLMPKFIA
FT                   PNSFLVGIDPATAQQSDYSLSEGIKFSCVYKNVLKPVVRDSVRDMKLQQPLLKKGG"
FT   sig_peptide     83717..83776
FT                   /locus_tag="Sfri_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.948 at
FT                   residue 20"
FT   gene            complement(84393..86246)
FT                   /locus_tag="Sfri_0071"
FT   CDS_pept        complement(84393..86246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0071"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: vfi:VF2138
FT                   two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69934"
FT                   /db_xref="GOA:Q089Y1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y1"
FT                   /protein_id="ABI69934.1"
FT                   /translation="MKGFTAVFLCVLLSLCSMHIPATTAKLTAQEETKQQTSSALEQCK
FT                   ARIKQVSPQASLSFCSQQFKILDIDKYPIVAAKLQLTLYDIYQELGEKVAAEQMLDEVK
FT                   SSAAFTQNVDVQYLWLRKKAAEKLYRKSYQEAKTLFEQAFSIAKTQESEIWLAKSYNDL
FT                   ALTEQYLNQYDKALSYYQKSLAIKEALGNDFYTAITLNNLGLIYKKLEKFKESQRYFEL
FT                   SLEHYLRYTSHNIDIHVIGYMSHLYGNLAEIYNINNQFNKKNFYSNKVIEAYNDNLVGD
FT                   DRLSALINVATIHINANEFTPALDVANTLSEYLTRDDHSFHDVIFYLKAQIATHQKDAT
FT                   QAIKFIESAMDYSDTKQDSLQKMNIYHYASELYYDNGRPYESLVYLKKYQQLHEILLEK
FT                   KYSENIKVIQSDIENERVQRALAEEQIVGQQKSQKIDKLLNLILGITSVGLLVGFIVSF
FT                   YIYRKRKAQQHLMTIIESHKQQLFLLSNDDTAEQDDAQQQESTPLSPSELTASFAELLV
FT                   NTMIDCISIWEKSTKTNKVELADRSQIWTISIDSGRLRTRSLDKYLQVKKLPANPRWRN
FT                   VVKTCHFILSECHLSNDDRTLLTSHLDQIMQVIKSESLGTS"
FT   sig_peptide     complement(86157..86246)
FT                   /locus_tag="Sfri_0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.490 at
FT                   residue 30"
FT   gene            86474..86806
FT                   /locus_tag="Sfri_0072"
FT   CDS_pept        86474..86806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0072"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   sec:SC050 quaternary ammonium compound resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69935"
FT                   /db_xref="GOA:Q089Y0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q089Y0"
FT                   /protein_id="ABI69935.1"
FT                   /translation="MKSWIFLSVAILTEVVATSALKASDGFSKLTPSIVVIVGYVLSFY
FT                   FLSLALKGIPVGIAYATWAGLGIVLITAIAWVMYGQKLDLGALVGMTFILVGVVVMNLF
FT                   SNVTPH"
FT   gene            complement(87004..88191)
FT                   /locus_tag="Sfri_0073"
FT   CDS_pept        complement(87004..88191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0073"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   cac:CAC3392 NADH-dependent butanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69936"
FT                   /db_xref="GOA:Q089X9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X9"
FT                   /protein_id="ABI69936.1"
FT                   /translation="MLNQKATIMLNFDYRNPTHVVFGKDRIAELDQLVPENARVLITYG
FT                   GGSVQRFGTLDKVKAALGNRTVFEFGGIEANPKYDTLIKAVEVARKENIDFLLAVGGGS
FT                   VMDGTKFIALATQFDGDTASLLHHGFTPVPVANDKVIPLGVIATLPATGSEMNAFAVVS
FT                   YQGGKFPVNHPCAYPTFAMLDPELTFSLPKIQVANGVVDAFVHVLEQYATYPVDARVQD
FT                   RMAEGIMRTLIEIGPITVEEPTNYDARANLMWSATSALNGMIGTGVPLDWSTHMIGHEL
FT                   TALFHIDHAQTLAVVLPSLWRVLKEQKHAKLVQYAARVWDITEGDEASRVDQAIDKTEA
FT                   FFKQVGLPVRLRDHGVTQEQLGLVVDALEAHGMTALSESGKVDLATSRKILDMAW"
FT   gene            88420..89289
FT                   /locus_tag="Sfri_0074"
FT   CDS_pept        88420..89289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0074"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: dps:DP1867 similar to transcription
FT                   regulator (AraC-type)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69937"
FT                   /db_xref="GOA:Q089X8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X8"
FT                   /protein_id="ABI69937.1"
FT                   /translation="MNEIATLMAQLAPKEGVNDTHLSGVHVFRSSQYGARGPMCYSQGV
FT                   LIVGQGKKRVYLDNQTFEYDRQHSLVMTVPLPVECETFASIEEPVLVLMVDIDLVQLNY
FT                   IIRLMDEHHQIPKDLNESRQSGFFVADNTEDMDCCVIRLLQALQSPLEAKVMGEALVLE
FT                   LLYRLLDSPDAAPLYALSLSHTRLSRVEKALNYIHKHYGESVEVDTLASLVNMSPSAFH
FT                   RSFKEVTASSPIQYLKKIRLNKAKALLQLQNLKVKEVSTQVGYESTAQFSREFKRYFDQ
FT                   SPGECARL"
FT   gene            89357..89686
FT                   /locus_tag="Sfri_0075"
FT   CDS_pept        89357..89686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA1414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69938"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR008314"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X7"
FT                   /protein_id="ABI69938.1"
FT                   /translation="MTAPTKITFFEFLTPLVASGLKTITIRDASENHYRPGSQVEVFTL
FT                   ENHIKVCDIIILAVEPLAFDDINEFHATQESLPLVELKQLIQTVYPNQQALFMISFKLV
FT                   DASYS"
FT   gene            90025..91362
FT                   /locus_tag="Sfri_0076"
FT   CDS_pept        90025..91362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0076"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; HemN domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   son:SO4520 coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69939"
FT                   /db_xref="GOA:Q089X6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X6"
FT                   /protein_id="ABI69939.1"
FT                   /translation="MSSIIQSASQELIKPYQSNITVPNWMISSMERVMQYYVDKNLRLD
FT                   TISTDRMPKPVEGKKYMLYAHIPFCHTLCSFCTFHRFLFREDKAREYFVALRKEMQMAK
FT                   DLGYEFESMYIGGGTTTVLEDELARTIEHAKNLFPGIKEVSCESDPQHLASPEFKQLKG
FT                   LVDRMSIGVQSFDDGILKMTDRLDKFGSGQQTFDRIMAAKELFPIINVDLIFGFRGQTD
FT                   EIIQSDLEMASKLDPRQITTYPLMITHQTRKSVKGQLAAPHGDMVNQYRQILNHLTGQY
FT                   TQLSAWAFGKTNDEGFDEYVIDYDEYLGVGSGSFSFLNDTLYVNTFSLKKYQQRIAEGR
FT                   MAVEQQKKYQLKEVMQYRFLLGMFSGRLSRKYFRDTFNVNLDTALFKEMTSMKAMGALK
FT                   NDPVNPDELIVTDNGKMLGLLMMKEFYSGMDNVRAQLRQPLGATDM"
FT   gene            91451..92296
FT                   /locus_tag="Sfri_0077"
FT   CDS_pept        91451..92296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0077"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: son:SO4458
FT                   carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69940"
FT                   /db_xref="GOA:Q089X5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X5"
FT                   /protein_id="ABI69940.1"
FT                   /translation="MANILLLANINCDRILMLDKPLQTGGRFHYQDGGLRLGGGGANTG
FT                   LGLVWAQHNVSLVSEVGSDDIGDWILAKASTLGLDCRLVHRFVGNTCEMLLVMTPDGER
FT                   TIIRPQRPIFELPAPPDWQHWDAFYINSSAKGAGAWAADAMVSNPNCKVISQLAKDERN
FT                   RPCHVLIASITDMQGRCNQDPWRFAQAIAGNALEYFIVTDGDKGAMVYSAAGEQHVPAV
FT                   IADVVDTTGAGDAYAAGVIHGLCEQMPITDAMHEGALWASFAVATKSSIPGEALKQYLA
FT                   "
FT   gene            92590..93282
FT                   /locus_tag="Sfri_0078"
FT   CDS_pept        92590..93282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0078"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: 3-alpha; MOSC domain containing protein; KEGG:
FT                   son:SO4456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69941"
FT                   /db_xref="GOA:Q089X4"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X4"
FT                   /protein_id="ABI69941.1"
FT                   /translation="MSKRLVKSISGLYLGDQVQMHNGVASCINQKHAAKQLTVQFDHVI
FT                   GNREADPKHHGGLDRVLHHFPREHYGQYRRWDLMSTFCDAPSMGENISTVGLNEAQVNI
FT                   GDIVQIGDVTLQVTQPRSPCFKLNLQFGHPKFALAMQESRMCGWFYRVLSEGDIRPSDS
FT                   IFLLERKSDISVAKAMQIYFLAEFDAEQYQTLLGCEGLAQSWVNSLQRRLDLQSIEDWA
FT                   MRLYGNAS"
FT   gene            93339..93698
FT                   /locus_tag="Sfri_0079"
FT   CDS_pept        93339..93698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69942"
FT                   /db_xref="GOA:Q089X3"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X3"
FT                   /protein_id="ABI69942.1"
FT                   /translation="MTEPIDDVSKQAKDTGLLIHAASFTGYVFPLGSVLGPLIVWLMKR
FT                   DEFEFANQCGKNCLNFKLSLMIYAMVSAILILIGVGVILLAALALLDIICTIIAIVKAN
FT                   DGIAYQYPLTIRFIK"
FT   gene            complement(93795..95705)
FT                   /locus_tag="Sfri_0080"
FT   CDS_pept        complement(93795..95705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0080"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: son:SO4454
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69943"
FT                   /db_xref="GOA:Q089X2"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X2"
FT                   /protein_id="ABI69943.1"
FT                   /translation="MNTLTIKQKILLTVTVAVLLSTILVGLLSQRSAKQVVEQRMLNSE
FT                   MPSLLMQIRNEVDLEIRSLINASEQLANSRMLLEWLQNGRPADQENLVIAELNDMKNQY
FT                   DLVQASYADKETAAYYTQDGFLRILNPEQDGWFFDYRDSKKERLLTVYTEANGEVKLFI
FT                   SYQQPNGRGMVSLAKSLDDMVNLLASFKIEDSGFVYLVDTKGEVKLHQDTNKIGKSKLS
FT                   NLYPNANTNQLLNKSNFNLVKADVNGQHMLIASSYIESMDWYLVAQVPEAEVFALLQKS
FT                   AYQILLWTILIAAVFIAISITVAGSVSRPIAHIAELFRNIGEGEGDLRQRLPVNGDDEI
FT                   AQLARGFNSFISKIQDTVAEVAKTSEQLGLSALDVSNQSNQTLADSQLQKDRTIMVVTA
FT                   INEMGATVNEIASNAAQAAVTARDADTESVDGQKVVTRARSTINQLSKDVEQVGEVIES
FT                   LATHTKSIGSILDVIRAISEQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLASRTAA
FT                   STNEVQTMIDKLQSETSRAVNAMEQSRSRSHEGVTAVDEASQSLSGISERIALISDMNI
FT                   QVAAATEEQSTVVEDINRNVTEINDITQRTADTAHAAANASKSLNQLASRLDILVARFK
FT                   V"
FT   sig_peptide     complement(95604..95705)
FT                   /locus_tag="Sfri_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.727 at
FT                   residue 34"
FT   gene            complement(95924..97573)
FT                   /locus_tag="Sfri_0081"
FT   CDS_pept        complement(95924..97573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0081"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   son:SO4453 electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69944"
FT                   /db_xref="GOA:Q089X1"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X1"
FT                   /protein_id="ABI69944.1"
FT                   /translation="MERESMEFDVVIVGAGPAGLATACRLMQISKDADKEITVCVVEKG
FT                   SEVGAHILSGAVFEPDVLDELFNDWRDSDIPLTTKVTHDEIYLLNSETQSRLMPNSLVP
FT                   KTMHNDGNYIISVGNLARWLANRAEAMGVEIFPGFAASELLFNEDNSVKGILIGDMGVG
FT                   ENGQHKDSYMPGMELHAKYTVFSEGCRGHLGKQLIQKYHLDNGKTPQHYGLGFKEIWKI
FT                   PAEQHQQGKVVHTGGWPLVNGSSGGGFLYHMEDNQVAVGLIIDLNYKNPHLSPFDEFQR
FT                   YKTHPVIAATLTGGERLSYGARAIAKGGLNSLPKMSFPGGLIIGCNAGTLNFAKIKGTH
FT                   TAIKSGIIAAKTLGEGLIAGLEGGKDLDCFQDRFEKSWLHEELYSSRNFGPAMHKFGTL
FT                   LGGAFNYIDQNWFGGKFPVTFRDTTPDYATMGLASDYNKIDYPKPDGKLSFDKLSSVYL
FT                   SNTFHEEDQLCHLHLKDQSIPISVNLVKFDEPAQRYCPAGVYEVVEEAGDKKFVINGQN
FT                   CIHCKTCDIKDPSQNITWVTPEGGGGPNYPNM"
FT   gene            97897..98910
FT                   /locus_tag="Sfri_0082"
FT   CDS_pept        97897..98910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0082"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: son:SO4452 molybdenum cofactor biosynthesis
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69945"
FT                   /db_xref="GOA:Q089X0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q089X0"
FT                   /protein_id="ABI69945.1"
FT                   /translation="MHSPPTLGKVNMSQLQDSFGRRFHYLRMSVTDVCNFKCTYCLPDG
FT                   YRPDGKPTFLTLNEIENLVAGFGEVGTQKVRITGGEPTLRKDFTDIVRIVADNPNINTV
FT                   AMTTNGYRLQQHAKEWYDAGLRRINVSVDSLDPKMFYQITGENKFDQVMRGIEAALEAG
FT                   FERVKVNAVLLKGLNDKDLPRFLQWIKNTPIDLRFIELMETGLGHDYFNAHHLAGVDIK
FT                   KQLEREGWLYDLPSVDDGPAQNFSHADYQGRIGLIMPYAKNFCASCNRLRVSAKGKLHL
FT                   CLFTENGVDLRDLIQNPSQRDELISRLHGQLAQKKETHFLHQGITGVTQHLASIGG"
FT   gene            98997..99473
FT                   /locus_tag="Sfri_0083"
FT   CDS_pept        98997..99473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0083"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: son:SO4451 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69946"
FT                   /db_xref="GOA:Q089W9"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089W9"
FT                   /protein_id="ABI69946.1"
FT                   /translation="MSNCFTHINADGNAHMVDVTEKAVTEREARAEAFIDMAPDTLAMI
FT                   MNGSHHKGDVFATARIAGIQAAKKTSDLIPLCHPLMLTKVEVELEAQPEHNRVRITSLC
FT                   KLSGKTGVEMEALTAASVAALTIYDMCKAVQKDMIISQVRLLEKRGGKSGHFKA"
FT   gene            99538..99786
FT                   /locus_tag="Sfri_0084"
FT   CDS_pept        99538..99786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0084"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: son:SO4450 molybdenum
FT                   cofactor biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69947"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W8"
FT                   /protein_id="ABI69947.1"
FT                   /translation="MIQVLFFAQIRELLGTAKVEHSGDNIDTAEALRAALAATDDKWAK
FT                   VLASDKLLVAINQTMSQWDSPVNDGDEVAFFPPVTGG"
FT   gene            99788..100258
FT                   /locus_tag="Sfri_0085"
FT   CDS_pept        99788..100258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0085"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   son:SO4449 molybdenum cofactor biosynthesis protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69948"
FT                   /db_xref="GOA:Q089W7"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W7"
FT                   /protein_id="ABI69948.1"
FT                   /translation="MEHHSNQIVVRVHTEDFSVADEYALLACDKQDGAVVNFVGKVRDF
FT                   NDGSAVTDLTLEHYPGMTESVLLQISQQACERWPLNKVTIIHRVGRLSLGEQIVFIGVT
FT                   SAHRKAAFAACEFLIDFLKTKAPFWKLEAGDTGAKWVEARDSDQQAAKMWQK"
FT   gene            100290..101141
FT                   /locus_tag="Sfri_0086"
FT   CDS_pept        100290..101141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0086"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: son:SO4448
FT                   molybdenum ABC transporter, periplasmic molybdenum-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69949"
FT                   /db_xref="GOA:Q089W6"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W6"
FT                   /protein_id="ABI69949.1"
FT                   /translation="MSFINANITQLADSFRPRFRAGAIALFFAIVSSVGFSSASVASDA
FT                   PAIAAAANIKFAVDEIAIRFQQQTGLALRISYGSSGNFVTQIQHGAPFEMMLSADEDYI
FT                   ERLHQAGFTQNDGVVYAIGRLALAAPKKSPLILDPELVGLAQLIADGKVSRFAIANPDH
FT                   APYGERAREVLKTKGLWDALQPKLILGENASQAAQFTISGSTQGGIVPLSLVLTPEFTK
FT                   RGNYVVIPDSLYQPLNQRMALMPNASETAERFYQYMQSTDAQEVLTQFGFNLPKPAVKK
FT                   AD"
FT   sig_peptide     100290..100418
FT                   /locus_tag="Sfri_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 43"
FT   gene            101141..101821
FT                   /locus_tag="Sfri_0087"
FT   CDS_pept        101141..101821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0087"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: son:SO4447 molybdenum ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69950"
FT                   /db_xref="GOA:Q089W5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W5"
FT                   /protein_id="ABI69950.1"
FT                   /translation="MDWQALWLSVKLSCFTVVLLIPLAIIVGRALAYRQFKGKSWLEAL
FT                   IMVPLVLPPTVIGYYLLVGLGNQSMIGQWVEQLTGQQLVFHFSGLVIASIIVNIPFAVQ
FT                   PIQRAFETIPIDIRDAAACCGMSRLRIFFRIELPMIWPGVLTAVVLCFSHVLGEFGVVL
FT                   MLGGNIAGETKTISIAIYDSVQAFDFESAGMMSLVLLLFAVSALALTTSMSKRLGGHRG
FT                   ATQR"
FT   gene            101802..102923
FT                   /locus_tag="Sfri_0088"
FT   CDS_pept        101802..102923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0088"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: son:SO4446 molybdenum ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69951"
FT                   /db_xref="GOA:Q089W4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W4"
FT                   /protein_id="ABI69951.1"
FT                   /translation="MVPHNADLICDISQTLPIPLEAHFSCRAGEVLAVVGPSGGGKTTL
FT                   LRMIAGLSLPQRGHIHCGDRLWFDAKQSISLTPQQRHIGYMPQHFGLFPHLSALDNVIS
FT                   GLDHVPKELRKQRALDWLERVNLHGLPDRLPAQLSGGQRQRVALARALAREPAILLLDE
FT                   PFSAVDRETRERLYIELARLKQQLSIPVVMVTHDIHEALLLADKMILISQGQMLQQGKP
FT                   FEVLSHPNNEAVARQMGLRNIFDGQVVSQDIERNMTQFTLGDELIVSDSAPALTVGQSI
FT                   RWVIPNQGIRFNAISSGRLCKSLNKLEVLIESVLVMGESSRVIASVVGIGSIINADVPT
FT                   HLVHKLALAPGVQTTIALKSDQIHILSAQSELG"
FT   gene            103294..103815
FT                   /locus_tag="Sfri_0089"
FT   CDS_pept        103294..103815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69952"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W3"
FT                   /protein_id="ABI69952.1"
FT                   /translation="MVRLLLAICFLPCAVMATPSMHSLLINGDFLKPITVMEQLEQQDK
FT                   GTICDFDVDVEEGLLVYKISMINVETHRINKYEYRALDGTLLTEKSSAYASDDIGQVNA
FT                   AKKLQAKHMKFSELVTLAIKNQQGYLTQAELDHDLSISYLELKLLNQDSRNTIAFDIET
FT                   LRPLPLLKWD"
FT   sig_peptide     103294..103347
FT                   /locus_tag="Sfri_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.947 at
FT                   residue 18"
FT   gene            103823..104506
FT                   /locus_tag="Sfri_0090"
FT   CDS_pept        103823..104506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0090"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4428 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69953"
FT                   /db_xref="GOA:Q089W2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W2"
FT                   /protein_id="ABI69953.1"
FT                   /translation="MTMRILLVEDDATTLKYVADGFTAQKYQVDSATDGQEGLTLAKHN
FT                   QYDLLILDRMLPKLDGLTLLSALRTSGNKTPVLILSALSHVDERVKGLRAGGDDYMTKP
FT                   FAFAELLVRAEKLAQRNVVEPAATEIEVGSLKMELLTRKVTLDDSELMLQPKEFQLLKY
FT                   LMEHPNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELIETVRGAGYR
FT                   LCKRH"
FT   gene            104574..105815
FT                   /locus_tag="Sfri_0091"
FT   CDS_pept        104574..105815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0091"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO4427 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69954"
FT                   /db_xref="GOA:Q089W1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W1"
FT                   /protein_id="ABI69954.1"
FT                   /translation="MLVLSLYRQLVIEQQNQVDKHLAAEMQRYQQLALTVNRRSFAAQI
FT                   RAADPKTALIAWRNSVDMVGALTFLPENMPQLPETKDFPIFTGGPDKLHILTGGLVITR
FT                   YGPVLIATRTDQLAALIEKFINAAFWAVAFTLGLTLALGYIFSKAILRRLVEYNRLSEQ
FT                   IEAGHYETRLPVSESQDEFDMLARQFNLVLDTLEQNLRAVRGVTDNIAHDLRTPLSHLR
FT                   IGIEQLSQKPTAELADATAELLEELDHCLGTFDAMLSLTRIEEGQQMLDLQPVSLQQIC
FT                   QDLFEMAEVIAESHDQVLSISLEDDVHVNGDKYLLFQALFNLVDNAIKYSPNGATINII
FT                   QHGKHIQISDNGPGIIDEDKERVFDRLVRLDPSRHYKGTGLGLSMVKAILSRHKATISL
FT                   HDNNPGLLVSIHFK"
FT   gene            105856..106533
FT                   /locus_tag="Sfri_0092"
FT   CDS_pept        105856..106533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0092"
FT                   /product="pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /note="TIGRFAM: pseudouridine synthase Rlu family protein,
FT                   TIGR01621; PFAM: pseudouridine synthase; KEGG:
FT                   pha:PSHAa1657 23S rRNA pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69955"
FT                   /db_xref="GOA:Q089W0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q089W0"
FT                   /protein_id="ABI69955.1"
FT                   /translation="MYQVLSDQPDFIVISKSVNVHFHSQDGSAGVIAQAEADLGCKLYP
FT                   VHRLDTPTSGLLIVAKSPQAANVFTKMFTEHKVQKYYLAIACGKPKKKQGWIIGDMAKS
FT                   RRSMYKLLRTTENPAVTQFFSQSIASGMRMYLLKPLSGKTHQLRVALASIGVPILGDKL
FT                   YGDELSDRCYLHAYSVHFTYLEQDYSFKQLPQFGKQFLLPECQQLMMNQWQSPNDLPWP
FT                   NKD"
FT   gene            complement(106610..107890)
FT                   /locus_tag="Sfri_0093"
FT   CDS_pept        complement(106610..107890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0093"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: son:SO4425 GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69956"
FT                   /db_xref="GOA:Q089V9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q089V9"
FT                   /protein_id="ABI69956.1"
FT                   /translation="MLISHYGIVFFTILMSHMEHNQSIIFVQFFSLIAVSCAIAWTLLA
FT                   CLLRIAPKASWCFAATNICTLIGIMLYTQRTEAINYLYWFVADMTILVGFTLVRWGSQH
FT                   LFKQPLSYRFDLILLATTALLMLLVPPSLTYAVYLVIVMSITAATFITLSGIDNFRAVK
FT                   KHLPLHYAALINVPFFTIGLLFIIRAVVLLLFPDELANISAADKLNSSLVMWSYIILLL
FT                   LTNLVLFGNALTRLVYKVARLANKDQLTGLWNRHSLLNKLEEVDALWLRNGLAYSLMVL
FT                   DLDHFKRINDTYGHLAGDMVLKNTADILQKSLRKIDFVCRYGGEEFLIILPLTNKKEAQ
FT                   IVAEKVQQKINENTVLWQKTHINTTLSIGYATCKTHLSIEQLLQLADDAMYLAKSKGRN
FT                   TICSMDAMEDSMDSMEESNAAIITEQS"
FT   gene            107995..108162
FT                   /locus_tag="Sfri_0094"
FT   CDS_pept        107995..108162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0094"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057; KEGG:
FT                   vpa:VPA0409 plasma membrane protein involved in salt
FT                   tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69957"
FT                   /db_xref="GOA:Q089V8"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q089V8"
FT                   /protein_id="ABI69957.1"
FT                   /translation="MDSNKLLLVIIAILLPPVAVLLKKGMGKDLLINILLCIFFFVPGL
FT                   VHALWVVLQE"
FT   gene            108277..108483
FT                   /locus_tag="Sfri_0095"
FT   CDS_pept        108277..108483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69958"
FT                   /db_xref="InterPro:IPR021677"
FT                   /db_xref="UniProtKB/TrEMBL:Q089V7"
FT                   /protein_id="ABI69958.1"
FT                   /translation="MNRKKKINQTLKAKAKKANAKLHAANKSPYIAKADREQLAQAQLV
FT                   IAPSASVADSVLSDSDAAHSPAL"
FT   gene            complement(108516..109286)
FT                   /locus_tag="Sfri_0096"
FT   CDS_pept        complement(108516..109286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0096"
FT                   /product="[molybdopterin synthase] sulfurylase"
FT                   /note="TIGRFAM: molybdopterin synthase sulfurylase MoeB;
FT                   PFAM: UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB
FT                   domain protein; KEGG: son:SO0137 molybdopterin biosynthesis
FT                   MoeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69959"
FT                   /db_xref="GOA:Q089V6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q089V6"
FT                   /protein_id="ABI69959.1"
FT                   /translation="MDSLDQEILTDNEMLRYSRQISIKAIDIDGQEKLKLAKVLIIGAG
FT                   GLGCAASQYLAVAGVGEITLVDFDTVELSNLQRQVLHYDANIGQAKVESAKQSLMLLNP
FT                   LININTINALLDDDEINVLVSQHSLILDCTDNMLVREQLNKSCFEHQVPLVSAAAIRME
FT                   GTVTVFDYQQDSPCYQCFSALFGEQQLTCVEAGILAPVVGMIGCIQATEAIKVITAIGE
FT                   PLTGKLLMIDAMTMEFRQMRLPKQPHCKVCGVNP"
FT   gene            complement(109294..110547)
FT                   /locus_tag="Sfri_0097"
FT   CDS_pept        complement(109294..110547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0097"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: son:SO0138
FT                   molybdopterin biosynthesis MoeA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69960"
FT                   /db_xref="GOA:Q089V5"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q089V5"
FT                   /protein_id="ABI69960.1"
FT                   /translation="MSSNQDPCAQPALLHPDQAIEQLLAQVEATQDTELVTLTQAIDRV
FT                   LAEDLASSIDLPPFDNSAMDGYAFRFTDLAASQDKTTLTLVGSSFAGHPFKGHVLPNSC
FT                   IRIMTGAPVPVGFDTVQMQEKVQANENKITIEHPHRLGANVRLCGEELLAGTKVLHKGI
FT                   TIRAAEMGVLATIGINQVRVTRKLKVAFFSTGDELRPVGSELAPGQIYDSNRYSIQGLL
FT                   SKSHVEWIDLGVIADNKEAIRGAFKEAASKADMVLTSGGVSVGEADFTKQILSEEGQIT
FT                   FWKLAIKPGKPFAFGKIDNAIFCGLPGNPVSSMVTFYKLVLPILNKMQGLKPIKPLFCQ
FT                   AKLLTDIRKHPGRVEYQRGILSRNEAGELEVAITGGQGSGMLTSMSLANCFVILDQFQG
FT                   DTPTGTQVTVEPFNNVLC"
FT   gene            110654..110977
FT                   /locus_tag="Sfri_0098"
FT   CDS_pept        110654..110977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0098"
FT                   /product="Excinuclease ABC, C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein;
FT                   KEGG: son:SO0145 hypothetical URI domain endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69961"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q089V4"
FT                   /protein_id="ABI69961.1"
FT                   /translation="MITLKVLYFMSKNNAKTGWYLYIIRCANSHLYTGITTDIARRFAE
FT                   HQASGPKAAKYLKGKGPLTLVYQESLADRSEASKREITVKKYTRQQKLLLIEQHALIHP
FT                   TER"
FT   gene            111080..111973
FT                   /locus_tag="Sfri_0099"
FT   CDS_pept        111080..111973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_00813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69962"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q089V3"
FT                   /protein_id="ABI69962.1"
FT                   /translation="MVKLLMSVALIICCFAFPLGAQQVRIQSVQSSENITYQYYYDLLQ
FT                   LILTQTADDYGSADIVVINTPLSQSRGFSMLKADLLDVFWAGTTVERERKFHAIKIPLV
FT                   GGLLGARVPVIVRDRFAEFEAINTPRQLQQLVACQGAQWPDSDILEYNGYRVERVITFQ
FT                   LIYSMLKQQRCDYFPRGLNEAYAEVNTKGNESLMVYDKLILHYPLPMYFFVSNDHPRLA
FT                   QRITQGLEALITTGQLHVFIEQHETTRDMFPLSKYNNSRIFDLANPLLPPQTPFQNQDL
FT                   WIDLPHPTKNAAALVE"
FT   sig_peptide     111080..111145
FT                   /locus_tag="Sfri_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.975 at
FT                   residue 22"
FT   gene            complement(112015..113874)
FT                   /locus_tag="Sfri_0100"
FT   CDS_pept        complement(112015..113874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0100"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="PFAM: peptidase M14, carboxypeptidase A; KEGG:
FT                   son:SO0152 hypothetical carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69963"
FT                   /db_xref="GOA:Q089V2"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:Q089V2"
FT                   /protein_id="ABI69963.1"
FT                   /translation="MRRFLLASLMVSPLLICSTFTYANNAVPTATQVPTEQITHLENDS
FT                   ILPPIHPWSGASETLLLSADQPWATPFEQQGYVSSPNYHDTMEWLDKLVDSSDVLQKVS
FT                   IGKSPQGRDIWMIVASQDGVSTAQALSDNGKATVLVQAGIHSGEIDGKDAGMMLLRDIS
FT                   HRNKRDLLENVNLLFIPIFSVDAHERSSKFNRVNQRGPVNMGWRTTANNLNLNRDYAKA
FT                   DALEMQHLIQAINIWQPDLYIDIHVTDGIDYQYDVTFGYNVAQGYSPSIFTWLESIYRP
FT                   AVEHALTEQGHIPGQLVFANDNTDMTKGLSLWNPSPRFSNGYGDARHLPTILIENHSLK
FT                   PYKQRVLGTYITLEQTLKTVAKNSTKLKSAINEDKYRNPSELTISWQNETLAEGKDFKG
FT                   IDYRVEQSPISGDKVVRWTGEPKLYENLPIVANTKADITVTRPVAYYIPPQWTNVIERL
FT                   SLHGIRMTRLNKPASITAQQYQFSDPLFSSADYEGHQTVTATTAIHKINAYLPAGSMRI
FT                   PTDQPLGDLAMLLLEPQAEDSLFYWGMFNTIFTRTEYIEDYAVEPLAAKMLLDNPALQA
FT                   EFDQALKDPDFAKDSQARLRWFYQRSPYYDNEYMKYPVLRASK"
FT   sig_peptide     complement(113803..113874)
FT                   /locus_tag="Sfri_0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.859 at
FT                   residue 24"
FT   gene            complement(114063..115604)
FT                   /locus_tag="Sfri_0101"
FT   CDS_pept        complement(114063..115604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0101"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   son:SO0162 phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69964"
FT                   /db_xref="GOA:Q089V1"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089V1"
FT                   /protein_id="ABI69964.1"
FT                   /translation="MADVSNRVHLNPTTAQLVEIALLRGEGQLTANGALVAKTGERTGR
FT                   SPNDRFIVKEANTEADIEWGKVNRPFDAGKFDALWGRVEAYLADKELFTSELEVGADDE
FT                   HYIPVRVTTEFAWHQLFARNLFIAPETFNRGNKDTWQIINAPGFVCEPQRDGTNSEAAV
FT                   ILNFAERKVLLAGLKYAGEMKKSMFSVQNFLLPAKGVLPMHCSANVGHDGDTTLFFGLS
FT                   GTGKTTLSADPKRFLIGDDEHGWAPGGVFNIEGGCYAKCIDLSQKNEPVIWDAIRFGTV
FT                   LENVVLDEQRVPDYKDTSLTENSRAAYPLEHIAQRKEDNRGAEPHAVVFLTCDVSGVLP
FT                   PVSVLSKEQAAYHFLSGYTAKVGSTEMGSTSAIQSTFSTCFGAPFFPRPAGVYAELLMK
FT                   RIESFGSQVYLVNTGWTGGPHGVGKRFDIPTTRAIVDAIVSGELKDVETVYIDKLNLNV
FT                   PVSVSGVDTALLNPVNTWADKAEYDKYAQQLAQEFSDNFAKYKVSEAIKNAGPNV"
FT   gene            complement(115874..116734)
FT                   /locus_tag="Sfri_0102"
FT   CDS_pept        complement(115874..116734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0102"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: son:SO0163 chaperonin
FT                   HslO"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69965"
FT                   /db_xref="GOA:Q089V0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089V0"
FT                   /protein_id="ABI69965.1"
FT                   /translation="MNNDILHRYIFDNADVRGEIVQLESSYQEVLSAHIYPVALQALIG
FT                   ELLAATSLLTATIKFSGDISVQLQGDGPVSLAVINGNNKQVLRGVARWNGDIAADASLQ
FT                   QMFGKGYMVITLTPDEGERYQGIVSLDHVNLAACLEEYFNQSEQLPTQIQLFANGKQAA
FT                   GMLLQVLPAKSGNNDDFEHLSALTSTIKAEELFTLDAEQVLHRLYHQEEVRLFDPVDVT
FT                   FKCSCSRDRSAAAIKTLPQTEVEEILAEEGKIEMDCEYCTAKYSFDAIDIAALYSGSHS
FT                   SQSQQ"
FT   gene            complement(116760..117158)
FT                   /locus_tag="Sfri_0103"
FT   CDS_pept        complement(116760..117158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0103"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   son:SO0164 heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69966"
FT                   /db_xref="GOA:Q089U9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U9"
FT                   /protein_id="ABI69966.1"
FT                   /translation="MTQNQPEKSFIRLDKWLWAARFYKTRAIAKDMINGGKVHYNGQRT
FT                   KSSKNAEAGAKIRLRQGNDDKEIIVLQLSGHRQSANVAQTLYEETPESISKRIINAEAR
FT                   RLNILNNPAPDHKPDKKQRRQIMRFKDY"
FT   gene            117423..118337
FT                   /locus_tag="Sfri_0104"
FT   CDS_pept        117423..118337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0104"
FT                   /product="general secretion pathway protein C"
FT                   /note="TIGRFAM: general secretion pathway protein C; KEGG:
FT                   son:SO0165 general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69967"
FT                   /db_xref="GOA:Q089U8"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U8"
FT                   /protein_id="ABI69967.1"
FT                   /translation="MDLLDKLITNAAKIPHKLLSMIVFWLGLVIVLLLAAQITWKLMPV
FT                   SSQSAVWQPSPISAGTAKRIELAGVRNLLLFGRLDNNSNKPKAEVVEQITDAPKTNLSI
FT                   QLTGVVASTEEAQGLAVIESSGQQETYSLGDKIKGTSASLKEVYADRIIISNSGRYETL
FT                   MLDGLKYTTQSEANSQLQQAKVGQQVTRVDRRDNQRFSEDLSNSRDELLADPSKITDFL
FT                   AISPVRNGDELAGYRLNPGKDVALFKQAGFQANDLAKSINGFDLTDMGQALEVMAQLPE
FT                   LTEMAVMVEREGQLVEIMFSLPE"
FT   sig_peptide     117423..117530
FT                   /locus_tag="Sfri_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.775) with cleavage site probability 0.587 at
FT                   residue 36"
FT   gene            118362..120494
FT                   /locus_tag="Sfri_0105"
FT   CDS_pept        118362..120494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0105"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: son:SO0166 general secretion pathway protein
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69968"
FT                   /db_xref="GOA:Q089U7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U7"
FT                   /protein_id="ABI69968.1"
FT                   /translation="MNNKGIRHNIIAGMLMGAAMIAAPSAWSEQYAANFKGTDIQEFIN
FT                   IVGKNLNKTIIVDPTVRGKINVRSYDLLNDDQYYQFFLNVLQVYGYAVVEMENHVIKVI
FT                   KDKDAKMASIRVADDKSPGVGDEMVTRIVPLYNSEAKQLAPLLRQLNDNAGGGNVVNYD
FT                   QSNVLMISGRAAVVNKLVEIVRRVDKQGDTDVQVVALDYASAGEIVRIVDTLYRSSANQ
FT                   SQLPGQAPKVVADERMNAVIVSGDEKSRQRVIELIKRLDAEQASTGNTKVRYLRYAKAE
FT                   DLVEVLTGFAQNLQDNKEGASTQQGNSSKRRSDINIMAHSDTNSLVISAEPDQLRTIES
FT                   VINQLDIRRAQVLVEAIIVEIAEGDNVGFGVQWGSEAGGLTQFNNIGPTIGEVGAGVWS
FT                   ARETDGTTVTVGNSDGGSTTTTNPTSDGDYTLIAQALGKVNGMAWGVTTGNFAALIQAV
FT                   SSDTNSNVLATPSITTLDNQEASFIVGDEVPIITGSTSSSNNDNPFQTVERKEVGVKLK
FT                   VVPQINEGSSVKLTIEQEVSGVNGNTGVDISFSTRRLTTTVMADSGQIVVLGGLINEEV
FT                   QESIQKVPILGDIPFIGHLFKSSSSKKTKKNLMIFIKPTIIRDGMTMEGIAGRKYNYFR
FT                   ALQLEQQARGINLMPNTQVPVLEEWDQEAYLPDEVNDMLDRYKSGKGLSTDIRDSDPAL
FT                   RTIDESMQKDKAQNND"
FT   sig_peptide     118362..118448
FT                   /locus_tag="Sfri_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 29"
FT   gene            120502..122046
FT                   /locus_tag="Sfri_0106"
FT   CDS_pept        120502..122046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0106"
FT                   /product="type II secretion system protein E (GspE)"
FT                   /note="KEGG: son:SO0167 general secretion pathway protein
FT                   E; TIGRFAM: general secretory pathway protein E; PFAM: type
FT                   II secretion system protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69969"
FT                   /db_xref="GOA:Q089U6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U6"
FT                   /protein_id="ABI69969.1"
FT                   /translation="MTEPLAQVSSEVAMEVVEGDEVFHSTSKERLPFAFSHRFQLVLAK
FT                   ENDQLCLFYTDNTPLSAMLEVRRYAGVELPLIKLEVAKFEAKLTLAYQANSSEAQQLME
FT                   DIGNEMDLFTLAEELPQTEDLLEGDDDAPIIKLINALLSEAIKEEASDIHVETYEKQLV
FT                   VRFRIDGVLKEVLKPNRKLSSLLVSRIKVMARLDIAEKRLPQDGRISLRIAGRAVDVRV
FT                   STMPSSHGERVVMRLLDKNTGNLDLQQLGMTPGIREKFDELIRKPHGIILVTGPTGSGK
FT                   STTLYAGLTEINSKDTNILTVEDPIEYELEGVGQTQVNTKVDMTFARGLRAILRQDPDV
FT                   VMIGEIRDLETAQIAVQASLTGHLVISTLHTNTASGAITRLQDMGVEPFLVSSSLLGVL
FT                   AQRLIRTLCPQCKEAHEPDERERELLGITANDTRIIYRAKGCKACGQNGYRGRTGIHEL
FT                   LIVDDNVRELIHGGRGELAIEKYVRKSIPSIRHDGMSKVLAGVTTLEEVLRVTREE"
FT   gene            122050..123282
FT                   /locus_tag="Sfri_0107"
FT   CDS_pept        122050..123282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0107"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   type II secretion system protein; KEGG: son:SO0168 general
FT                   secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69970"
FT                   /db_xref="GOA:Q089U5"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U5"
FT                   /protein_id="ABI69970.1"
FT                   /translation="MAAFEYKALDSKGKQQKGVIEADTARHARSQLREQRLMPLELQPV
FT                   SEKEARSQRGGFNLANLFKKRISVAELALITRQIATLVAAGLPIEEALKAVGQQSEKDR
FT                   LGSMIMAVRSRVVEGYSLADSMAEFPHVFDDLYRAMVASGEKSGHLEVVLNRLADYTER
FT                   RQQLKSKLTQAMIYPIVLTVVAIGVIAVLLAAVVPKVVGQFEHMGQELPGTTQFLILAS
FT                   DFVQHWGVVVVLLIFAAMVMFQRLLTNPIMRMKYDTALLQMPVIGKVSKGLNTARFART
FT                   LSILSASSVPLLDGMRIASEVLQNVKVRAAVDEATARVREGTSLGTALTNTKLFPAMML
FT                   YMIASGEKSGQLENMLERAADNQDREFESNVNIALGVFEPMLVVSMASVVLFIVMAILQ
FT                   PILELNNLISG"
FT   gene            123379..123813
FT                   /locus_tag="Sfri_0108"
FT   CDS_pept        123379..123813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0108"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   methylation site containing protein; Bacterial type II
FT                   secretion system protein G; KEGG: son:SO0169 general
FT                   secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69971"
FT                   /db_xref="GOA:Q089U4"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U4"
FT                   /protein_id="ABI69971.1"
FT                   /translation="MQHNNKQRGFTLLEVMVVIVILGILASMVVPNLMGNKDKADQQKA
FT                   VSDIVALENALDMYKLDNSIYPTTEQGLDALVQKPTSSPEPRNFREGGYVKRLPQDPWR
FT                   SDYLLLSPGENGKIDIFSAGPDGQPGSEDDIGSWNLQDFQ"
FT   gene            123815..124387
FT                   /locus_tag="Sfri_0109"
FT   CDS_pept        123815..124387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0109"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H;
FT                   Prepilin-type cleavage/methylation-like; KEGG: son:SO0170
FT                   general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69972"
FT                   /db_xref="GOA:Q089U3"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U3"
FT                   /protein_id="ABI69972.1"
FT                   /translation="MIHHRQAGFTLLEVLIVALLMGLVASAVTMSISVAGPEQMLKKQA
FT                   QRFMTATEMVLDESVLSGQFIGIVIDEDQYQFVFYKEGKWMPVDQDRLLSAKKMDTGIT
FT                   LDIVIDGMPLVQEDEQNESWFDEPFIDEESEEDKKKHPEPQILLFPSGEMTPFELGFNT
FT                   INDDRQPVNVLVVGDALGRLTLGRVDE"
FT   sig_peptide     123815..123922
FT                   /locus_tag="Sfri_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.927 at
FT                   residue 36"
FT   gene            124380..124817
FT                   /locus_tag="Sfri_0110"
FT   CDS_pept        124380..124817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0110"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J; methylation site
FT                   containing protein; KEGG: son:SO0171 general secretion
FT                   pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69973"
FT                   /db_xref="GOA:Q089U2"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U2"
FT                   /protein_id="ABI69973.1"
FT                   /translation="MNKLTSYRRPQYWKVNSSDIKSLRGKNRGMTLLEVIVALAVFSIA
FT                   AVSVTKSLGEQMANMPILEERTLAQWVASNQMVDVRLPGTFPDIGQKTGQSELAGREWY
FT                   WRQEVIKTTDDKFRMIRISVSDDDKFKRVVAQVSSYVHNKA"
FT   gene            124798..125508
FT                   /locus_tag="Sfri_0111"
FT   CDS_pept        124798..125508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0111"
FT                   /product="general secretion pathway protein J"
FT                   /note="TIGRFAM: general secretion pathway protein J; PFAM:
FT                   methylation site containing protein; KEGG: son:SO0172
FT                   general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69974"
FT                   /db_xref="GOA:Q089U1"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U1"
FT                   /protein_id="ABI69974.1"
FT                   /translation="MSITKPRHFSGFTLLEMLIAIAIFAMLGIAANSVLSTVMKNDEVT
FT                   KEFATRLKSLQQGFGALERDLGQMVARSPRLFEGDRGSRFFQAGDNILDSETEALVFYR
FT                   LGWLNPDGMLPRGSLQSVAYVVQNGRLERWYYPYPEPVSGAEPLKSVVIDHVLSIEYSF
FT                   YMDDKWQKQVDGTVMPKGIAMEIELEGLGKIQRRFLLPKGAPATKSDNDSGNNRNGSNS
FT                   KDENDIAANDGKSS"
FT   sig_peptide     124798..124908
FT                   /locus_tag="Sfri_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.917) with cleavage site probability 0.387 at
FT                   residue 37"
FT   gene            125508..126494
FT                   /locus_tag="Sfri_0112"
FT   CDS_pept        125508..126494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0112"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   son:SO0173 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69975"
FT                   /db_xref="GOA:Q089U0"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q089U0"
FT                   /protein_id="ABI69975.1"
FT                   /translation="MGGQKQRGVALIVVMLIVAMVVIIATNISSRNQLSMRRTLNLAQY
FT                   DQAYWYALSAEELAMKVLKQDFEDSEGTVHLQQYWALANVAFPAEYGEIVGEIQDMRAC
FT                   FNVNAVGQASEKTKNGQPEMTVAAIQFQSLLISLGVDEFGAEQLTSTLKDYIDEDTLSG
FT                   PYGAEDAEYESRNVPYRAANTLMQHRSELRAVLGFSQDVYLNLLPYVCAIPGEDSQLLN
FT                   VNTIKVEQAALLAAMLENKISVSEAENIINNRPADGYEKIEEFWEGSSLSGIKSEANVK
FT                   SSFVVDSQYFLLKAGAKVDTAIFRMESVLKRNGKDLDVLTRQYGGQQ"
FT   gene            126546..127751
FT                   /locus_tag="Sfri_0113"
FT   CDS_pept        126546..127751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0113"
FT                   /product="general secretion pathway protein L"
FT                   /note="TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway L; KEGG: son:SO0174 general
FT                   secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69976"
FT                   /db_xref="GOA:Q089T9"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T9"
FT                   /protein_id="ABI69976.1"
FT                   /translation="MSERLFIRLGKSSEHPCSWLVWSEQEQEIIASGELSDAASLSTLA
FT                   ERAGNRPVDVLVPAANMTLTQIMLPEKGQRQALKALPYMLEESLATNVDNMHFVVGPRE
FT                   GEQLNVAAVAHEQMQIWLEWLHHAGLKVKRIVPDCLALPLEQCRWAAMSVGSEYLIRTS
FT                   EGSGVSMPKAWSAFALPKLLIAAKPNDNESISVASYSDDIVFEGVDINNKPLDLPMMVL
FT                   AKGILNAPINLLSGIYKPKHEYSKQLLTWKNAAIVVMIAIVLALANKGIAIHQLNNQTT
FT                   ELQAQSEMIFKQAVPGVNRIVNMRSQMGSELRSMQGQGGGAVFFEMLDGLKPAFSKVPE
FT                   LKPNTLRYEANRNELRMQVTAKTYGQIDTFKELVSKDYLLEGGAMNSSEESVTSTLTLR
FT                   NK"
FT   gene            127753..128229
FT                   /locus_tag="Sfri_0114"
FT   CDS_pept        127753..128229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0114"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   son:SO0175 general secretion pathway protein M"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69977"
FT                   /db_xref="GOA:Q089T8"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T8"
FT                   /protein_id="ABI69977.1"
FT                   /translation="MENMRSWWQGLAIREQQLVGFCAAVLAIGIMYWGIWTPISNAQDT
FT                   AERDNSAAQQTLNYVKQTANKIAGLKQAGAQAKVRGSLSSVVNQTAGQYKLEITRMQPQ
FT                   GDKIQLWMDDVPFDALLGYLHDLVEQKGLTLDSVDLTESDVAGFVKVRRIQLSQ"
FT   gene            128239..129000
FT                   /locus_tag="Sfri_0115"
FT   CDS_pept        128239..129000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0115"
FT                   /product="type II secretion system protein N"
FT                   /note="PFAM: type II secretion system protein N; KEGG:
FT                   son:SO0176 general secretion pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69978"
FT                   /db_xref="GOA:Q089T7"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T7"
FT                   /protein_id="ABI69978.1"
FT                   /translation="MSLFSKIVIGVIIYLAFLLVYLPANWLVSIAPLPNNVVITGAEGT
FT                   LWQGKAALITIEQRQIEHVSWQLSPWGLLLGKADIDFNIGNRATAVSGKGSVSWSLSGL
FT                   SAKNIRLDLPDSFLLAGARLPFKTQIDGDVSLMVAVLEQGKPWCEQLNGKLFLNNTNVK
FT                   NQYGAYPLGNIALGLSCLDGQLQIATDETQNVLGLTGTAILGESNLVKVSAKIKPTDAQ
FT                   PKDLRDSLSFLGRQDSQGYYPINYQGVVPGL"
FT   gene            complement(129169..129834)
FT                   /locus_tag="Sfri_0116"
FT   CDS_pept        complement(129169..129834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0116"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: son:SO0177 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3 protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69979"
FT                   /db_xref="GOA:Q089T6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T6"
FT                   /protein_id="ABI69979.1"
FT                   /translation="MFPWYKIDTVLLDMDGTLLDLHFDNHFWLHLVPQQLSMQRKISLD
FT                   EANTLVKQAYYDVVGTLDWYCLDYWQRYLQLDILALHHASADRIKLRQDSMPFLQALAG
FT                   ASKQRILFTNAHPQSLALKLTHTNLGHGLDKMLSSHESGYPKEHPQFWQYALTKFNLDP
FT                   SRCLFIDDSEVILAASKKAGIGYQLGIKNPDSQKPHIEFANFPAITDYQPLSLALNSV"
FT   gene            129912..130499
FT                   /locus_tag="Sfri_0117"
FT   CDS_pept        129912..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0117"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: son:SO0190 MutT/nudix
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69980"
FT                   /db_xref="GOA:Q089T5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T5"
FT                   /protein_id="ABI69980.1"
FT                   /translation="MTQRHKKPEILHTEIVAKSRLFQIEQVHLKFSNGVERQYERMKGG
FT                   SRGAVMIVPIHQGNLLLASEYAAGTDNYELGFPKGLIDPGETAVEAANRELQEEIGFGS
FT                   YQLTHLKELSLAPGYFSSKMHIFVAEKLYPSRLEGDEPEPIDVIPWPLSDWQLLLENVD
FT                   FSESRSVSALFLTQQYLNTPTDNLTNEVNGVK"
FT   gene            130616..131425
FT                   /locus_tag="Sfri_0118"
FT   CDS_pept        130616..131425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0118"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: son:SO0191 cysQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69981"
FT                   /db_xref="GOA:Q089T4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T4"
FT                   /protein_id="ABI69981.1"
FT                   /translation="MKPEDVIEQVIDIATEAGQKIRDIYLKGNFKREIKSDNTPVTSAD
FT                   LAAHDIICRQLAELTPDIPILSEEAADIPLSVREKWKRYWLVDPLDGTGEFIAGSGDFS
FT                   VIIALVEHNRPIIGVVYVPMTKVCYYAIAGLGAYKRDGKNEIRITSKQLTGDEPENLRL
FT                   AVSRRQDPQSVLKLLNKPNHCELVVMGGAALKSCLVAEGRADCYVRLGPTGEWDTGAAQ
FT                   IIIEEAGGALIDINLQPMTYNERETLENPNFIVVGSANLPWDILLTN"
FT   gene            complement(131666..132766)
FT                   /locus_tag="Sfri_0119"
FT   CDS_pept        complement(131666..132766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0119"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="SMART: Rhodanese domain protein; KEGG: son:SO0195
FT                   YbbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69982"
FT                   /db_xref="GOA:Q089T3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089T3"
FT                   /protein_id="ABI69982.1"
FT                   /translation="MSEVIPSSEYGRLLLENRPLIDVRAPIEFTKGAFGHSINLPLMQD
FT                   GEREKVGTCYKKRGQEAAIALGHELVKGKVKQQRIDAWLAQLSQHPDSYLYCFRGGLRS
FT                   KLSQQWIKESGMDIPYIEGGYKAIRSFLINTIEQAPSQSKVLILSGITGSGKTEVIHQR
FT                   DESVDLEGLANHKGSSFGKNIDPQPSQINFENNLAVALLKHQQQQHNHLLLEDESMLIG
FT                   RSALPKHFYSAMQQADIIVLDEPLDARLPRLLNDYVEQKLTDYVSGLGEQAGFDAFKAY
FT                   LAQSLLGIRKRLGGKQHQELQDLVDNALNVQQSQNDTSKHLDWINLLLDIYYDPMYLYQ
FT                   LEKKQDRVIFQGDRQAIHQWLDKHKS"
FT   gene            complement(132766..133821)
FT                   /locus_tag="Sfri_0120"
FT   CDS_pept        complement(132766..133821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0120"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="TIGRFAM: selenide, water dikinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein; KEGG: son:SO0196 selenide, water dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69983"
FT                   /db_xref="GOA:Q089T2"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T2"
FT                   /protein_id="ABI69983.1"
FT                   /translation="MPHTDIKLTEYSHGAGCGCKISPKVLSTILASQLPVFTDPNLLVG
FT                   NQTRDDAAVYKLNEQTGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGTPIMAIA
FT                   ILGWPVNLLPPEVAQQVVDGGRQACADAGIMLAGGHSIDAPEPIFGLAVTGQIPLERVK
FT                   QNNTAKANDRLYLTKPIGIGILTTAQKQKKLRDEDSQIAPNAMCQLNTIGIDIAKIVGV
FT                   NALTDVTGFGLAGHLIEVCQGAQLKANIVLSQVPLLPKVSDYLAQGCIPGGTHRNFDSY
FT                   SEHLPPLTDDQKAIICDPQTSGGLLVAVSAEAEQELKTLLEANGIDAICIGMLNTYEPH
FT                   ADGHDVLVELS"
FT   gene            134018..134632
FT                   /locus_tag="Sfri_0121"
FT   CDS_pept        134018..134632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0121"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="KEGG: son:SO0193 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69984"
FT                   /db_xref="GOA:Q089T1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T1"
FT                   /protein_id="ABI69984.1"
FT                   /translation="MARRKEHTHEQIRHMAISAVVEHLQCHGVDNLSLRKVATTIGYVP
FT                   STLINIFGSYQYLLLAVSEQTLLQLAAQLQLIKPTTPTKTIEQMAIVYSQFALANRRCF
FT                   RLVFELTMTDDQPLPAAHLGLIKSLFSDVEFQLSQYFPSACEQEVEMMSRVLWGGIHGL
FT                   TCLSLDGKLFETQSCLQDMLTSHVSSYIDGMSIKRNSNAAN"
FT   gene            134619..136475
FT                   /locus_tag="Sfri_0122"
FT   CDS_pept        134619..136475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0122"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; major
FT                   facilitator superfamily MFS_1; KEGG: son:SO0194
FT                   acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69985"
FT                   /db_xref="GOA:Q089T0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q089T0"
FT                   /protein_id="ABI69985.1"
FT                   /translation="MLLTKRFFPYFATLCLGALNDNFYKNVLLLLVTYSQLNALPIDVN
FT                   LFVNLAAGVFILPFFLFSAHAGIVADNMNKAKLIRRLKLLELIIMSTAAIAIISQSYMV
FT                   MLLLLFLTGSQSAYFGPVKYSLLPQALSEAELVKGNALVEMGTFLSILVGTLSAGLVVS
FT                   NENGLTWAAIIVCVLAICGYLASRAIPSLPAQGDLNPSKFSLFSGTWRCINKARQTKTI
FT                   WMAILAISWFWFLGATYLTQFPNFAKLHLHADATVVSLLLALFSVGIAVGSYVCERFSF
FT                   GHVELGLLPFGVLGLSVFSFDMIAAIPLELVEPGFVYSFESFIANAQHYRVMIDLFLVG
FT                   LSGGIFIVPLYAFIQTRAEKQECAQAIAANNIINAFFMVGSAVLSIVLLGVFQWSIPEL
FT                   FMLVGVLNLVVLLYVYSQVPEFTQRFISYLLSHVMYRVNVRGREHIPAQGAGIIVSNHV
FT                   SYVDALVIMGASTRPIRFVMDKSISEIPLLKYLFRHAGVIPICSPKKCESTYLNAFEQI
FT                   HQALANDELVCIFPEGKLTPDGEIGEFRPGIDKILQRDPVTVIPLALTGLWGSYFSHKG
FT                   GHALTTFPKRFWSKVSVSIAPSVDGATTNCKALQQQVTQQFN"
FT   gene            complement(136557..137666)
FT                   /locus_tag="Sfri_0123"
FT   CDS_pept        complement(136557..137666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0123"
FT                   /product="Delta-9 acyl-phospholipid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /note="PFAM: fatty acid desaturase; KEGG: son:SO0197 fatty
FT                   acid desaturase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69986"
FT                   /db_xref="GOA:Q089S9"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q089S9"
FT                   /protein_id="ABI69986.1"
FT                   /translation="MKKPPIIWLNTLLFAITFIGAVVLIPWRGFTHGFDGIEWIAFVVF
FT                   AYASGLSITAGYHRLWSHKAYKAHASVRFLYALGGALALQNSALHWCSDHRIHHKHVDN
FT                   NDKDPYSAQMGFWYSHIGWMLREYQASRYSDYNNVRDLQNDRIVMWQHKHYLALVILMN
FT                   IGLPAFIGWLNGDILSMVLMAGLLRLVVVHHCTFFINSLAHIWGKQPYTDKNSARDNAF
FT                   LALLTYGEGYHNFHHIFENDYRNGIKWWDYDPTKWLIKLMNWFGLASDLRKVPQERIES
FT                   ARLQMQLLQAQNQVAHLPNCDEIIEKFQAEYELMKQHLVDYYQAKKSLLEAKRKQLTDH
FT                   NLKQQVQLLRNQFLEQQRNWKSLTGAYAQ"
FT   sig_peptide     complement(137565..137666)
FT                   /locus_tag="Sfri_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.674) with cleavage site probability 0.444 at
FT                   residue 34"
FT   gene            137823..138440
FT                   /locus_tag="Sfri_0124"
FT   CDS_pept        137823..138440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0124"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO0198
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69987"
FT                   /db_xref="GOA:Q089S8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q089S8"
FT                   /protein_id="ABI69987.1"
FT                   /translation="MGVRAQQKEKTRRALVDAAFNQLSAERSFSSLSLREVAREAGIAP
FT                   TSFYRHFKDMNELGLTMVDEGGLTLRQMMRKGRQRAEAGGSVIRISVDTFMEVLESNPN
FT                   VFRILLHERSGTSAAFRAAVEREIEHFISELAHYTEAQANRTPVLARAQAEALVILVFN
FT                   AGASALDSKRSERKSLADQLVLQLRMVATGAEALQHKIDNRA"
FT   gene            complement(138520..139617)
FT                   /locus_tag="Sfri_0125"
FT   CDS_pept        complement(138520..139617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0125"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="KEGG: son:SO0206 tRNA (uracil-5-)-methyltransferase;
FT                   TIGRFAM: tRNA (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69988"
FT                   /db_xref="GOA:Q089S7"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089S7"
FT                   /protein_id="ABI69988.1"
FT                   /translation="MNLAAMDPKNYDAQLQQKRIKLEKAFADFNPPALEVFASEPMHYR
FT                   MRAEFRMWHQGDDLYYYMFDKALNAKVRCDQYLPAGLIINQMMAALIAELTPNPALRYR
FT                   LFQVDFLSTLSGEILVSLLYHRQLDEEWREQATQLKAKLSAQFNVNIIGRARKQKIDLD
FT                   KDFVVETLTVNEQVLHYKQIENSFTQPNAKVSVKMLEWAIDATKDSQGDLLELYCGNGN
FT                   FTIALARNFNRVLATELAKPSVDAAQYNIDINHVDNVQIIRMSAEDFSDAMAKKRQFRR
FT                   LEGIDLDSYDCNTIFVDPPRAGIDPETLKLIQGYERILYISCNPETLNDNLLTLGQTHK
FT                   ITRFALFDQFPYTDHMESGVLLVRK"
FT   gene            139747..140526
FT                   /locus_tag="Sfri_0126"
FT   CDS_pept        139747..140526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0126"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: son:SO0207 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69989"
FT                   /db_xref="GOA:Q089S6"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089S6"
FT                   /protein_id="ABI69989.1"
FT                   /translation="MSGPILVFDSGIGGLSVMNEIRKQLPLHDYCYLFDNARLPYGNLS
FT                   EQELITGCVALITHHARRLNASIVVVACNTASTLVLPLLRQQLTIPIVGVVPAIKPAAM
FT                   LSKKKHIGLLATPGTVKRDYTQALINQFAGNCKVELFGTSDLVLLAEQYVAQQQIDMDK
FT                   LNEILAPIAASNIDVLVLGCTHFPMIATEISHYLGEGVTLLDSGEAVAKRVRFLLSKES
FT                   NSNKQLQACYTKDIGQGLKAALVDYGFSDFSLVTITD"
FT   gene            complement(140574..141017)
FT                   /locus_tag="Sfri_0127"
FT   CDS_pept        complement(140574..141017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0127"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   son:SO0208 RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69990"
FT                   /db_xref="GOA:Q089S5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q089S5"
FT                   /protein_id="ABI69990.1"
FT                   /translation="MQKSFVIVLIAALLGAFVFSQFGSTSSSVAFIAGVVVATLIFTFM
FT                   PSSGSSSSDEPYVGPTMTLYVGNLPYRVHEGEVKALFGEYGPVNSVRLVRDRKTGRRKG
FT                   FGFVEMSEAGAQKAMSKLNDYSFQERTLKVREAKSQESDSENS"
FT   sig_peptide     complement(140925..141017)
FT                   /locus_tag="Sfri_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.631 at
FT                   residue 31"
FT   gene            141671..143205
FT                   /locus_tag="Sfri_R0004"
FT   rRNA            141671..143205
FT                   /locus_tag="Sfri_R0004"
FT                   /product="16S ribosomal RNA"
FT   gene            143295..143371
FT                   /locus_tag="Sfri_R0005"
FT                   /note="tRNA-Ile2"
FT   tRNA            143295..143371
FT                   /locus_tag="Sfri_R0005"
FT                   /product="tRNA-Ile"
FT   gene            143517..143592
FT                   /locus_tag="Sfri_R0006"
FT                   /note="tRNA-Ala2"
FT   tRNA            143517..143592
FT                   /locus_tag="Sfri_R0006"
FT                   /product="tRNA-Ala"
FT   gene            143928..146843
FT                   /locus_tag="Sfri_R0007"
FT   rRNA            143928..146843
FT                   /locus_tag="Sfri_R0007"
FT                   /product="23S ribosomal RNA"
FT   gene            146986..147107
FT                   /locus_tag="Sfri_R0008"
FT   rRNA            146986..147107
FT                   /locus_tag="Sfri_R0008"
FT                   /product="5S ribosomal RNA"
FT   gene            147215..147340
FT                   /locus_tag="Sfri_0128"
FT   CDS_pept        147215..147340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SOA0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69991"
FT                   /db_xref="GOA:Q089S4"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q089S4"
FT                   /protein_id="ABI69991.1"
FT                   /translation="MKPSVSINIKRTQRDYTLGFKLAVVSQVEKGELTYNTIYIN"
FT   gene            complement(147337..147870)
FT                   /locus_tag="Sfri_0129"
FT   CDS_pept        complement(147337..147870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0129"
FT                   /product="ISSod10, transposase OrfB"
FT                   /note="KEGG: son:SO2875 ISSod10, transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69992"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q07WJ7"
FT                   /protein_id="ABI69992.1"
FT                   /translation="MALDRIDVWFQDEARFGQQNTTTRIWATKGTRPRAVRQQQFESAY
FT                   LYGAVCPATGTTEAMIAPHANSEYMWEHLTLISEATESGRHALVIMDGAGWHQQDLTED
FT                   FDNLSILKLPPYSPELNPIEQVWQWLRQNELANRCFSGYDDIVEQCSIAWNRFIAEPER
FT                   VIQLCSRRWTKLTN"
FT   gene            complement(147884..148363)
FT                   /locus_tag="Sfri_0130"
FT   CDS_pept        complement(147884..148363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0130"
FT                   /product="ISSod10, transposase OrfA"
FT                   /note="KEGG: son:SO4533 ISSod10, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69993"
FT                   /db_xref="GOA:Q07WJ4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:Q07WJ4"
FT                   /protein_id="ABI69993.1"
FT                   /translation="MNNLNLAALVKSEKRARKRMRYLALLHFTEGHSRTAIANMLKVSR
FT                   TSVNTWVTHYLTHGISGLDDKHNPGRPAQLSAKQLVNLKEFVQRQSLSESGGRLMARDV
FT                   SLFIQSEFGVTFKQANIYRLLHQLGLSWITTRSRHPKQSQDIQDAFKKLPAVNDP"
FT   gene            148584..149600
FT                   /locus_tag="Sfri_0131"
FT   CDS_pept        148584..149600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0131"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: son:SO0213 UDP-N-acetylmuramate dehydrogenase;
FT                   TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine reductase;
FT                   PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69994"
FT                   /db_xref="GOA:Q089S1"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:Q089S1"
FT                   /protein_id="ABI69994.1"
FT                   /translation="MPISLTSLNTFGLNQHCDSLVEVTNKDELIKTSLMLYQQQQSMLI
FT                   LGGGSNVVFTDDFQGTVVKVSTKGITINEVDDYYYLTIQAGENWHQLVEYCLTKHIYGL
FT                   ENMALIPGTVGAAPIQNIGAYGVEFNRFCHKIEFLQLDTGDLVHYDNQQCEFGYRESIF
FT                   KQQLKNLAVITEVTLKLPKKWEPVVNYGPLQHFDAMDVTAQQVFDCVCHVRQSKLPDPK
FT                   VLGNVGSFFKNPVVSVVDYHSLKNRYEDLVGYRQVDDHYKLAAGWLIEHAGLKGINIGG
FT                   AAVHQDQALVLVNLGQATGDQVCQLAKHIIQTVFDKFAVTLQPEPRIMGSVGEIEVK"
FT   gene            149597..150559
FT                   /locus_tag="Sfri_0132"
FT   CDS_pept        149597..150559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0132"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: son:SO0214 birA bifunctional protein; TIGRFAM:
FT                   biotin--acetyl-CoA-carboxylase ligase; PFAM: biotin protein
FT                   ligase domain protein; biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69995"
FT                   /db_xref="GOA:Q089S0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q089S0"
FT                   /protein_id="ABI69995.1"
FT                   /translation="MNEHWSRKRQILACLHHERFVSGEVIAQSLSLTRAAINQHIDALK
FT                   DYGIEIYSVKGRGYKLANPVSLVNESHLVNGIDGRCFYFDETTSTNAFMLGHASELKSG
FT                   DICIAEYQSAGRGRRGRQWLSPYAHHIYASMFWRLNNDISHASGLSLVVGCSIVKSLAD
FT                   FGVEGLGLKWPNDIYLDHKKLAGILVEVSNSSAQKTELVIGFGINMSMSVEQGELIDQP
FT                   WNDLSGLVNMPDKTELLIKLHKTLKADLQLFEQKGLEAFLDRWNKFDLFIGREVSLLMA
FT                   PNSVNGICRGIDEQGALLLENEQGVTRYLGGEISLRAVM"
FT   gene            complement(150596..151546)
FT                   /locus_tag="Sfri_0133"
FT   CDS_pept        complement(150596..151546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0133"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: son:SO0215
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69996"
FT                   /db_xref="GOA:Q089R9"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089R9"
FT                   /protein_id="ABI69996.1"
FT                   /translation="MNPINSIQDALYFAFQRKHWAELRKSVPLTLSQAELENLRGMNEK
FT                   LSLDEVTDIYLPLSRLLNLFVGSKQQRGLVLDKFLEQKASPGPYIISIAGSVAVGKSTT
FT                   ARILQTLLQRWPEHPKVDLVTTDGFLYPLADLKRKGLLQRKGFPESYDMKMLVEFISAV
FT                   KAGQKEILAPLYSHVTYDRCHDEHQAIRQPDILILEGLNVLQTGLDTPIDTRRPFVSDF
FT                   VDFSIYVDADESLLKEWYKQRFLQFRKGAFSDPNSFFHHYSCLTDDEANTIAANIWDTI
FT                   NGPNLSLNIQPTRERANLILQKGPNHLMDRVLLRK"
FT   gene            151770..151845
FT                   /locus_tag="Sfri_R0009"
FT                   /note="tRNA-Thr2"
FT   tRNA            151770..151845
FT                   /locus_tag="Sfri_R0009"
FT                   /product="tRNA-Thr"
FT   gene            151853..151937
FT                   /locus_tag="Sfri_R0010"
FT                   /note="tRNA-Tyr4"
FT   tRNA            151853..151937
FT                   /locus_tag="Sfri_R0010"
FT                   /product="tRNA-Tyr"
FT   gene            151973..152046
FT                   /locus_tag="Sfri_R0011"
FT                   /note="tRNA-Gly5"
FT   tRNA            151973..152046
FT                   /locus_tag="Sfri_R0011"
FT                   /product="tRNA-Gly"
FT   gene            152056..152131
FT                   /locus_tag="Sfri_R0012"
FT                   /note="tRNA-Ile3"
FT   tRNA            152056..152131
FT                   /locus_tag="Sfri_R0012"
FT                   /product="tRNA-Ile"
FT   gene            152246..153430
FT                   /locus_tag="Sfri_0134"
FT   CDS_pept        152246..153430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0134"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   son:SO0229 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69997"
FT                   /db_xref="GOA:Q089R8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089R8"
FT                   /protein_id="ABI69997.1"
FT                   /translation="MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAISAVLSKTYGGEVK
FT                   NFAQIDNAPEERERGITINTSHIEYDTPIRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGQPEWEAKILELAEALDTYIPEPARDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVRVSDEVEIVGVRPTTKTTCTGVEMFRKLLDEGRAGENCGVLLRG
FT                   TKRDDVERGQVLAKPGSINPHTTFESEVYVLSKEEGGRHTPFFKGYRPQFFFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIYPIAMDDGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            153699..154070
FT                   /locus_tag="Sfri_0135"
FT   CDS_pept        153699..154070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0135"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: son:SO0218
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69998"
FT                   /db_xref="GOA:Q089R7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q089R7"
FT                   /protein_id="ABI69998.1"
FT                   /translation="MTTNTENQSNSLDIVKWGIAALLIATAVIGNQFYADANVVARVAG
FT                   VIIAFAIAGIIALQTSKGKQAQSFAREAHIEVRKVVWPTRQEALNTTFIVLAATAVMAL
FT                   ILWGLDAILLRVVNLITGV"
FT   gene            154081..154632
FT                   /locus_tag="Sfri_0136"
FT   CDS_pept        154081..154632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0136"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: son:SO0219 transcription antitermination
FT                   protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM:
FT                   transcription antitermination protein NusG; KOW domain
FT                   protein; SMART: NGN domain protein; KOW (Kyrpides,
FT                   Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABI69999"
FT                   /db_xref="GOA:Q089R6"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q089R6"
FT                   /protein_id="ABI69999.1"
FT                   /translation="MTEVTEAKKRWYVIQAFSGYEGRVLKTLLEHIKMHNMEEYFGEIL
FT                   VPTEEVVEMRAGQRRKSERKFFPGYVLVQMEMNDDSWHLVKSIPRVMGFIGGTSDRPAP
FT                   ISDKEADAILQRLQDTVESPTHRIMYEPGEVVRVCDGPFADFNGTIEEVDYEKNRIKVS
FT                   VMIFGRSTPVELDFNQVEKS"
FT   gene            154762..155190
FT                   /locus_tag="Sfri_0137"
FT   CDS_pept        154762..155190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0137"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: son:SO0220 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70000"
FT                   /db_xref="GOA:Q089R5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089R5"
FT                   /protein_id="ABI70000.1"
FT                   /translation="MAKKIEAYIKLQVAAGAANPSPPVGPALGQKGVNIMEFCKAFNAR
FT                   TEKFEKGMPIPVVITVYNDRSFTFETKTPPASFLLLKAVGLKSGSGRPNTQKVGTIKRS
FT                   AVQEIAETKAADMTGADIEAMTRSIEGTARSMGLVVED"
FT   gene            155195..155896
FT                   /locus_tag="Sfri_0138"
FT   CDS_pept        155195..155896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0138"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: son:SO0221 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70001"
FT                   /db_xref="GOA:Q089R4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089R4"
FT                   /protein_id="ABI70001.1"
FT                   /translation="MAKLTKRARVIREKVDATKLYDINEAVVLLQELATAKFVESVDVA
FT                   VNLGIDPRKSDQNVRGATVLPHGTGRDVRVAVFTQGANAEAAIAAGAELVGMEDLAEKV
FT                   KAGEMNFDVVIASPDAMRVVGMLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVTFTTEQLKENLESLVSALKKAKPAVAKGIYVKKISISTTMGAGV
FT                   AIDQGSLEEAK"
FT   gene            156173..156673
FT                   /locus_tag="Sfri_0139"
FT   CDS_pept        156173..156673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0139"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: son:SO0222 50S
FT                   ribosomal subunit protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70002"
FT                   /db_xref="GOA:Q089R3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089R3"
FT                   /protein_id="ABI70002.1"
FT                   /translation="MALRLEDKQAIVAEVNEAAKGALSAVVADSRGVTVGAMTGLRKAA
FT                   RENGVFVRVVRNTLARRAVQGTAFECLAETFTGPTLIAFSNEHPGAAARLLKDFAKGQA
FT                   KFEVKGAAFEGMFIPAADIDRLAKLPTYEEALAQLMMTMKEASAGKFVRTLAALRDQKQ
FT                   DAA"
FT   gene            156728..157093
FT                   /locus_tag="Sfri_0140"
FT   CDS_pept        156728..157093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0140"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="PFAM: ribosomal protein L7/L12; KEGG: son:SO0223 50S
FT                   ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70003"
FT                   /db_xref="GOA:Q089R2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089R2"
FT                   /protein_id="ABI70003.1"
FT                   /translation="MSITKDQMLEAFAAMSVMEVVELIEAMEEKFGVSAAAAVVSGGGD
FT                   AVAAEEQTEFDVVLTSFGENKVAVIKALRSATGLGLKEAKTMAESSPIAVKEAVSKEEA
FT                   ATLKADLEAAGASVEVK"
FT   gene            157329..161360
FT                   /locus_tag="Sfri_0141"
FT   CDS_pept        157329..161360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0141"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: son:SO0224 DNA-directed RNA polymerase subunit
FT                   beta; TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase Rpb2,
FT                   domain 7; RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70004"
FT                   /db_xref="GOA:Q089R1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089R1"
FT                   /protein_id="ABI70004.1"
FT                   /translation="MVYSYSEKKRIRKDFGKRPKVLDIPYLLSIQLDSFKKFTDHDPTG
FT                   ERGLEAAFRSVFPIKSFSGYSELQYVSYKLGEPVFDVKECQIRGVTYSAPLRVKLRMVL
FT                   FDREAAAGTVKDIKEQEVYMGDIPMMTNNGTFVINGTERVIVSQLHRSPGVFFDHDRGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDALFVRIDRRRKLPATIILRALEYSTQDILD
FT                   LFFERIEFKIKKDSLVMALVPDRLRGETAGYDIKDAEGALLVEAGRRITARHIKQLEKT
FT                   NTTELEVPVDYIVGKYAAQDYIDEDTGEVLVTANSEITLEDLAKLSLAGIKNIDTLFIN
FT                   DLDHGAYIADTLRIDSTTNRLEALVEIYRMMRPGEPPTKDAAEGLFQNLFFSEERYDLS
FT                   KVGRMKFNRRLEIAEDEGNGVLSKEDIVSVMKKIIEIRNGYDEVDDIDHLGNRRIRSVG
FT                   EMAENQFRVGLVRVERAVRERLSLGDLNELMPQDLINAKPISAAVKEFFGSSQLSQFMD
FT                   QNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLINSL
FT                   ASFARTNSYGFLETPYRKVVDGVITDDVEYLSAIEEGRYVIAQANIEVDADGRMAEEQI
FT                   ACRHKGESTFMRAADVQYMDVSPQQIISVAASLIPFLEHDDANRALMGANMQRQAVPTL
FT                   RADKPLVGTGIERTLAVDSGVVVAAKRGGVVDYVDASRIVVKVNEDELHAGEAGIDIYN
FT                   LTKYTRSNQNTCINQRPCCSVGEPVVRGDVLADGPSTDLGDLALGQNMRIAFMPWNGYN
FT                   FEDSILISERVAQEDRFTTIHIQELSCIARDTKLGSEEITADIPNVGESALSKLDESGI
FT                   VYIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVKGTII
FT                   DVQVFTRDGVEKDKRALEIEDMHVRQARKDLGEEFKILEEGVLGRARNLLLSVGYSEAK
FT                   LAEIPRKDVLIQVIDDETKQTELEQLAEQHEELKADFDKTFEIKRRKITQGDDLAPGVL
FT                   KIVKVYLAVKRTIQPGDKMAGRHGNKGVISKICPVEDMPYDEEGNPVDIVLNPLGVPSR
FT                   MNIGQVLEVHMGAAAKGIGNKITAMLEEQREIAELRGYIKQVYELGDDVLQRVDIDSFT
FT                   DDEVVRLATNLKGGIPIATPAFDGAKEKEIKQMLALAGLPESGQLTLCDGRTGNEFERK
FT                   VTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGA
FT                   AYTLQEMLTVKSDDVNGRTQMYKNIVDGNHQMQPGMPESFNVLLKEIRSLGINIELDQE
FT                   "
FT   gene            161443..165669
FT                   /locus_tag="Sfri_0142"
FT   CDS_pept        161443..165669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0142"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: son:SO0225 DNA-directed RNA polymerase, beta'
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase, alpha subunit; RNA
FT                   polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70005"
FT                   /db_xref="GOA:Q089R0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089R0"
FT                   /protein_id="ABI70005.1"
FT                   /translation="MKDLLKFLKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETIN
FT                   YRTFKPEREGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IDLASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVIEPGMTTLERGQMLTEE
FT                   TYLDALEEYGDEFEAKMGAEAVLELLRAINLAEQIEQMREELPSINSETRRKKVTKRLK
FT                   LMEAFFTSGNKPEWMILKVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLEARGLATTIKAAKK
FT                   MVEREQAEVWDVLDEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPVITPSQDVVLGLYYTSREC
FT                   INGRGEGMAFADVSEVEKAYATGVAELHARVKVRITETNIADDGERTKSTRIIDTTVGR
FT                   ALLSLILPEGLSYDLVNQNMGKKQISKLLNTCYRQLGLKDTVIFADQLMYTGFRFATIS
FT                   GASVGIDDMVIPDEKYTLVADAEAEVLEIQEQFQSGLVTAGERYNKVIDIWASANEKVS
FT                   KAMMENLSTETVINRDGVPEQQASFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGVEHGLTMKPLIEGGDVVEPLRERVLGRVVALDVMKPGTNEVLAPRNTLLDEAWCNT
FT                   LEEHSIDEVIVRSVITCDTDFGVCAACYGRDLARGHIINHGEAIGVVAAQSIGEPGTQL
FT                   TMRTFHIGGAASRASAENNVQVKNAGSLKLHNAKHVSNIDGKLVIVSRSSELAIIDELG
FT                   REKERYKVPYGTVLEKLEDSEVAAGEIIANWDPHTHPIISEVAGSVKFVDMIDGVTMTR
FT                   QTDELTGLSSVVVLDVGARTSAGKELRPAIRLVDADGNDLMIPGTEVPAQYFLPGNAIV
FT                   SKDDNAKINVGDPLARIPQESSKTRDITGGLPRVADLFEARKPKEPAILAEISGTISFG
FT                   KETKGKRRLVITPADGSEHYEEMIPKWRNLNVFEGEKVERGEVIADGPEAAHDILRLRG
FT                   IHNVANYIVNEVQDVYRLQGVKINDKHIEVIIRQMLRKCLITSTGDTEFLEGEQAEVSR
FT                   VKIANRELIAQGKTPATFERELLGITKASLATESFISAASFQETTRVLTEAAVGGKSDP
FT                   LRGLKENVIVGRLIPAGTGYAYHKTRNEERAKILSSRGKVETTTVTASEAEKNLADLLN
FT                   LAGSQD"
FT   gene            165847..166221
FT                   /locus_tag="Sfri_0143"
FT   CDS_pept        165847..166221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0143"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: son:SO0226 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70006"
FT                   /db_xref="GOA:Q089Q9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q9"
FT                   /protein_id="ABI70006.1"
FT                   /translation="MATVNQLVRKPRTPKVEKTNVPALNACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVTSRRQGRSKYGAKRPKS"
FT   gene            166304..166774
FT                   /locus_tag="Sfri_0144"
FT   CDS_pept        166304..166774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0144"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: son:SO0227 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70007"
FT                   /db_xref="GOA:Q089Q8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q8"
FT                   /protein_id="ABI70007.1"
FT                   /translation="MPRRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYK
FT                   ALDVVAEKKSENHLSILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWL
FT                   VEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW"
FT   gene            166853..168949
FT                   /locus_tag="Sfri_0145"
FT   CDS_pept        166853..168949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0145"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: son:SO0228 elongation factor EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70008"
FT                   /db_xref="GOA:Q089Q7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q7"
FT                   /protein_id="ABI70008.1"
FT                   /translation="MARTTPIERYRNIGIVAHVDAGKTTTTERVLFYTGMSHKIGEVHD
FT                   GAATTDWMVQEQERGITITSAAVTTFWRGMEAQFAEHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQADKYHVPRLVFVNKMDRAGADFDRVINQIRNRLG
FT                   ATCVPIQLNIGAEENFKGVIDLIKMKAINWSETDQGMTFTYEDIPANLAAKAAEMHEYL
FT                   VEAAAEASDELMNKYLEEGELSEVEIKTALRQRTINNEIVLATCGSAFKNKGVQAVLDA
FT                   VVDFLPAPIDVPAITGIDESENEVKRPPDDNAPFAALAFKIATDPFVGTLTFIRVYSGV
FT                   LESGAGVYNSVKQKRERVGRIVQMHANDRTELKEVRAGDIAAAIGLKDVTTGDTLCDNN
FT                   HRVILERMDFPEPVITIAVEPRSKADQDKMGIALQKLAAEDPSFKVETDEESAQTLISG
FT                   MGELHLDIIVDRMRREFGVECNVGKPQVAYRETIRSKVEVEGKFVRQSGGRGQFGHVWL
FT                   RIEPLEEGAGYEFVNEIVGGVVPREFIPAVDKGIQEQMKNGVLAGYPVLDVRVSLFDGS
FT                   YHDVDSNEMAFKIAGSMGFKKGALEATPVLLEPCMKVEVTTPEDYMGDVVGDLNRRRGI
FT                   IEGMDDGIAGVKLVHAVVPLSEMFGYATDLRSASQGRASYSMEFLKYTDAPQNIAKAII
FT                   ESRN"
FT   gene            169019..170203
FT                   /locus_tag="Sfri_0146"
FT   CDS_pept        169019..170203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0146"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   son:SO0229 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70009"
FT                   /db_xref="GOA:Q089Q6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q6"
FT                   /protein_id="ABI70009.1"
FT                   /translation="MAKAKFERIKPHVNVGTIGHVDHGKTTLTAAISAVLSKTYGGEVK
FT                   NFAQIDNAPEERERGITINTSHIEYDTPIRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGQPEWEAKILELAEALDTYIPEPARDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVRVSDEVEIVGVRPTTKTTCTGVEMFRKLLDEGRAGENCGVLLRG
FT                   TKRDDVERGQVLAKPGSINPHTTFESEVYVLSKEEGGRHTPFFKGYRPQFFFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIYPIAMDDGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            170557..170868
FT                   /locus_tag="Sfri_0147"
FT   CDS_pept        170557..170868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0147"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: son:SO0230 30S
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70010"
FT                   /db_xref="GOA:Q089Q5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q5"
FT                   /protein_id="ABI70010.1"
FT                   /translation="MQNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERYTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            170896..171534
FT                   /locus_tag="Sfri_0148"
FT   CDS_pept        170896..171534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0148"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: son:SO0231 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70011"
FT                   /db_xref="GOA:Q089Q4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q4"
FT                   /protein_id="ABI70011.1"
FT                   /translation="MAIGLIGRKVGMTRIFTEDGTSIPVTVIEIAGNRVTQVKTLETDG
FT                   YRALQVTTGTKKANRITKAEAGHFAKGGVEAGRGLWEMRLADGEGEGIEVGAEINVDIF
FT                   ADTVKVDVTGQSKGKGFQGGVKRWNFRTQDMTHGNSLAHRSNGSIGQNQTPGRVFKGKK
FT                   MSGHMGAEQVTTQNLHVVRVDAERNLLLVRGAVPGATNGDLIIKPAVKA"
FT   gene            171552..172157
FT                   /locus_tag="Sfri_0149"
FT   CDS_pept        171552..172157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0149"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: son:SO0232 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70012"
FT                   /db_xref="GOA:Q089Q3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q3"
FT                   /protein_id="ABI70012.1"
FT                   /translation="MELVLKDAQSALEVSETTFGRDFNEALVHQVVVAYAANARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKGPIWRGGGVTFAAKTQDHSQKVNKKMYRGA
FT                   LKSIFSELVRQERLVVVESFGVEAPKTKELKAKLKAMNLEDVLIVTAEVDENLFLAARN
FT                   LYKVDVRDVAGLDPVSLIAFNTVLVTADAVKQIEEMLA"
FT   gene            172154..172456
FT                   /locus_tag="Sfri_0150"
FT   CDS_pept        172154..172456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0150"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: son:SO0233
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70013"
FT                   /db_xref="GOA:Q089Q2"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q2"
FT                   /protein_id="ABI70013.1"
FT                   /translation="MIREERLLKVILGPHISEKSTVLAEKNNTVVFRVAIDATKAEIKA
FT                   AVAKLFEVEVDSVRTLVNKGKTKRTGGRVGRRIDWKKAYVTLAAGAEIDFVGGAE"
FT   gene            172473..173297
FT                   /locus_tag="Sfri_0151"
FT   CDS_pept        172473..173297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0151"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: son:SO0234 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70014"
FT                   /db_xref="GOA:Q089Q1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q1"
FT                   /protein_id="ABI70014.1"
FT                   /translation="MAVIKCKPTSPGRRHVVKVVNTDLHKGKPFAGLLAKKTKSGGRNN
FT                   TGRITVRHVGGGHKQHYRIVDFKRNKDGIPAKVERLEYDPNRTAHIALVLYADGERRYI
FT                   LAAKGMKAGDPIQSGLDAEIKTGNARPLRNIPVGSVVHAVEMKPGKGAQIARSAGAYVQ
FT                   VVARDGAYATLRLRSGEMRKVPVDCRATFGEVGNAEHMLRQLGKAGAKRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGVPTKGYKTRSNKRTDKYIVRRRNK"
FT   gene            173312..173590
FT                   /locus_tag="Sfri_0152"
FT   CDS_pept        173312..173590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0152"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: son:SO0235 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70015"
FT                   /db_xref="GOA:Q089Q0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089Q0"
FT                   /protein_id="ABI70015.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAMEAGDKKPIKTWSRRSMIIPNMI
FT                   GLTIAVHNGRQHVPVFVTDEMIGHKLGEFSPTRTYRGHAADKKAKKR"
FT   gene            173606..173938
FT                   /locus_tag="Sfri_0153"
FT   CDS_pept        173606..173938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0153"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: son:SO0236 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70016"
FT                   /db_xref="GOA:Q089P9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P9"
FT                   /protein_id="ABI70016.1"
FT                   /translation="MEVLAKHRFARTSAQKARLVADQIRGLPVSKALEILTFSPKKAAV
FT                   LVKKVLDSAIANAEHNEGADIDELKVGAVFVDEGPTMKRIMPRAKGRADRIMKRTSHIT
FT                   VVVADR"
FT   gene            173951..174640
FT                   /locus_tag="Sfri_0154"
FT   CDS_pept        173951..174640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0154"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: son:SO0237 30S ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70017"
FT                   /db_xref="GOA:Q089P8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P8"
FT                   /protein_id="ABI70017.1"
FT                   /translation="MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRQYLTE
FT                   KLKAASVSKIVIERPAKSIRVTIHTARPGIVIGKKGEDVEVLRAYVSKITGTTAQINIA
FT                   EIRKPELDAKLVADSIAQQLERRVMFRRAMKRAVQNAMRIGAQGIKVQVSGRLGGAEIA
FT                   RAEWYREGRVPLHTLRADIDYSTAESHTQYGVIGIKVWIFKGEVLDGLVPAIEEPKQQP
FT                   KRKPRGK"
FT   gene            174652..175062
FT                   /locus_tag="Sfri_0155"
FT   CDS_pept        174652..175062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0155"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: son:SO0238 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70018"
FT                   /db_xref="GOA:Q089P7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P7"
FT                   /protein_id="ABI70018.1"
FT                   /translation="MLQPKRMKFRKMFKGRNRGLANGTEVSFGTFGLKAVGRGRLTARQ
FT                   IESARRAMTRHVKRQGQIWIRVFPDKPITSKPLEVRMGKGKGNVEYWVCQIQPGKVLYE
FT                   MDGVPESLAREAFALASAKLPLKTTFVTKTVM"
FT   gene            175062..175253
FT                   /locus_tag="Sfri_0156"
FT   CDS_pept        175062..175253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0156"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: son:SO0239 50S
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70019"
FT                   /db_xref="GOA:Q089P6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P6"
FT                   /protein_id="ABI70019.1"
FT                   /translation="MKASELREKSVEELNAELLGLLREQFNLRMQHATGQLTQTNQLKL
FT                   VRRNIARVKTIITSKAGV"
FT   gene            175253..175501
FT                   /locus_tag="Sfri_0157"
FT   CDS_pept        175253..175501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0157"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: son:SO0240 30S
FT                   ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70020"
FT                   /db_xref="GOA:Q089P5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P5"
FT                   /protein_id="ABI70020.1"
FT                   /translation="MSDKARTLQGKVISNKMDKSITVAIERQVKHPIYGKYIKRTTKIH
FT                   AHDETNQCNEGDFVAISQCRPLSKTKSWTLAEVVTKA"
FT   gene            175678..176046
FT                   /locus_tag="Sfri_0158"
FT   CDS_pept        175678..176046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0158"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: son:SO0241 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70021"
FT                   /db_xref="GOA:Q089P4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P4"
FT                   /protein_id="ABI70021.1"
FT                   /translation="MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKE
FT                   AIPRAKAKKGDVYNAVVVRTKKGVRRPDGSVIRFDRNAAVLLNANLAPIGTRIFGPVTR
FT                   ELRNDKFMKIVSLAPEVL"
FT   gene            176057..176371
FT                   /locus_tag="Sfri_0159"
FT   CDS_pept        176057..176371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0159"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: son:SO0242 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70022"
FT                   /db_xref="GOA:Q089P3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P3"
FT                   /protein_id="ABI70022.1"
FT                   /translation="MAAKIRREDEVIILAGKDKGSRGKVSQVLPTGKLIVEGFNLVKKH
FT                   QKPNPQLGVAGGVIEKEAPMQASNVAIFNQATGKADRVGFRFEDGKKVRFFKSNSELVK
FT                   "
FT   gene            176385..176924
FT                   /locus_tag="Sfri_0160"
FT   CDS_pept        176385..176924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0160"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: son:SO0243 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70023"
FT                   /db_xref="GOA:Q089P2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P2"
FT                   /protein_id="ABI70023.1"
FT                   /translation="MAKLHDKYQETVVAELAKKFGYSSVMQVPRIEKITLNMGVGEAVA
FT                   DKKVMEHALRDMTAIAGQKPIVTVARKSVAGFKIREGYPIGCKVTLRGERMWEFLERLV
FT                   DIAIPRIRDFRGLSAKAFDGRGNYAMGVREQIIFPEIDYDKIDKIRGMDIVITTTAKND
FT                   EEGRALLDAFNFPFKK"
FT   gene            176935..177240
FT                   /locus_tag="Sfri_0161"
FT   CDS_pept        176935..177240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0161"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: son:SO0244 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70024"
FT                   /db_xref="GOA:Q089P1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P1"
FT                   /protein_id="ABI70024.1"
FT                   /translation="MAKTSMKAREAKRAQLVAKYAEKRLALKAIISSPATSEEDRWDAV
FT                   LKLQALPRDSSAARQRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW"
FT   gene            177265..177657
FT                   /locus_tag="Sfri_0162"
FT   CDS_pept        177265..177657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0162"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: son:SO0245 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70025"
FT                   /db_xref="GOA:Q089P0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089P0"
FT                   /protein_id="ABI70025.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANHVSVKMPSAKLKVAIAKLLKDEGF
FT                   ITEYAVADEAKPELEITLKYFQGKPVVETIQRVSRPGLRIYKGKDELPKVMGGLGIAIV
FT                   STSQGLMTDRAARQNGTGGEVICYVA"
FT   gene            177668..178201
FT                   /locus_tag="Sfri_0163"
FT   CDS_pept        177668..178201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0163"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: son:SO0246 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70026"
FT                   /db_xref="GOA:Q089N9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N9"
FT                   /protein_id="ABI70026.1"
FT                   /translation="MSRVAKAPVTVPAGVEVTLNEQTLTVKGSKGSLTRVINNAVNVVI
FT                   EDAQVKFLPVDGVSNAWAQAGTARALVNNMVVGVSQGFVKKLKLVGVGYRAKIAGSDLD
FT                   LTLGFSHPLVHKLPAGVTAECPSQTEIVLSGVDKQVVGQVAAEIRGYRPPEPYKGKGVR
FT                   YDDEIVRRKEAKKK"
FT   gene            178212..178562
FT                   /locus_tag="Sfri_0164"
FT   CDS_pept        178212..178562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0164"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: son:SO0247 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70027"
FT                   /db_xref="GOA:Q089N8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N8"
FT                   /protein_id="ABI70027.1"
FT                   /translation="MDKKTSRLRRALRARKKIQELGVNRLVVHRTPRHIYAQVINPEAQ
FT                   VLAVASTVEKAVKELLKSTGNVDAAKAVGKIVAERAIEKGVATVAFDRSGFKYHGRVAA
FT                   LADAAREAGLKF"
FT   gene            178575..179078
FT                   /locus_tag="Sfri_0165"
FT   CDS_pept        178575..179078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0165"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="PFAM: ribosomal protein S5; ribosomal protein S5
FT                   domain protein; KEGG: son:SO0248 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70028"
FT                   /db_xref="GOA:Q089N7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N7"
FT                   /protein_id="ABI70028.1"
FT                   /translation="MAKLEAQQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNG
FT                   KIGYGYGKAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSKVYMQPASQGT
FT                   GIIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATVDALVHMKSPAQIAAKRGLNVD
FT                   EIRG"
FT   gene            179085..179273
FT                   /locus_tag="Sfri_0166"
FT   CDS_pept        179085..179273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0166"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: sdn:Sden_0188
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70029"
FT                   /db_xref="GOA:Q089N6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N6"
FT                   /protein_id="ABI70029.1"
FT                   /translation="MATKTLKVTQTKSSIGRLPKHRATLTGLGLRRINHTVEVEDTPSV
FT                   RGMINKVYYMVSVEELG"
FT   gene            179273..179707
FT                   /locus_tag="Sfri_0167"
FT   CDS_pept        179273..179707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0167"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: son:SO0250 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70030"
FT                   /db_xref="GOA:Q089N5"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N5"
FT                   /protein_id="ABI70030.1"
FT                   /translation="MRLNTLSPAAGSKSAPKRVGRGIGSGLGKTAGRGHKGQKSRSGGG
FT                   VRVGFEGGQMPLKIRLPKFGFTSRRALVTAEVRLLELAKVNGDVVDLNALKDANVITRN
FT                   IQFAKIVLSGTIDRPVTVKGLKVTKGARAAIEAAGGKIEE"
FT   gene            179715..181055
FT                   /locus_tag="Sfri_0168"
FT   CDS_pept        179715..181055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0168"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: son:SO0251 preprotein translocase, SecY
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70031"
FT                   /db_xref="GOA:Q089N4"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q089N4"
FT                   /protein_id="ABI70031.1"
FT                   /translation="MAKPGLDLKSAKGGLSELKTRLLFVIGAIIVFRAGSFVPIPGIDA
FT                   AVLAELFAQQKDTILGMFNMFSGGALERASIFALGIMPYISASIIMQLLTVVHPALAEL
FT                   KKEGESGRKKISQYTRYGTLVLGTLQSVGIATGLPNLMPGLVANPGFGFYFVAVVSLVT
FT                   GTMFLMWLGEQITERGIGNGISILIFAGIVAGLPSAIGSTAEQARQGDMNVLVLLLLAV
FT                   IVFAVTYLVVFVERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKINMAGVIPPIFASSII
FT                   LFPGTLAQWFGSNESMSWLSDFALAVSPGQPLYSLLYATAIIFFCFFYTALVFNPRETA
FT                   DNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGALYITFICLIPEFMLIAWKVQFYFG
FT                   GTSLLIIVVVIMDFMAQVQTHMMSHQYESVMKKANLVNKANLDRFGK"
FT   gene            181079..181192
FT                   /locus_tag="Sfri_0169"
FT   CDS_pept        181079..181192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0169"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: sdn:Sden_0191
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70032"
FT                   /db_xref="GOA:Q089N3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N3"
FT                   /protein_id="ABI70032.1"
FT                   /translation="MKVRASVKKICRNCKIVKRSGVVRVICIEPKHKQRQG"
FT   gene            181309..181665
FT                   /locus_tag="Sfri_0170"
FT   CDS_pept        181309..181665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0170"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: son:SO0253 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70033"
FT                   /db_xref="GOA:Q089N2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N2"
FT                   /protein_id="ABI70033.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGRTRARAICASTSIAEDAKI
FT                   KELSEAQIDILREEVAKYTVEGDLRREISMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIRK"
FT   gene            181683..182075
FT                   /locus_tag="Sfri_0171"
FT   CDS_pept        181683..182075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0171"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: son:SO0254 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70034"
FT                   /db_xref="GOA:Q089N1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N1"
FT                   /protein_id="ABI70034.1"
FT                   /translation="MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSW
FT                   ATSGGSGFRGSRKSTPFAAQVAAERAGIAAQDYGVKNLEVFVKGPGPGRESAIRALNAV
FT                   GYKITNITDVTPIPHNGCRPPKKRRV"
FT   gene            182108..182728
FT                   /locus_tag="Sfri_0172"
FT   CDS_pept        182108..182728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0172"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: son:SO0255 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70035"
FT                   /db_xref="GOA:Q089N0"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089N0"
FT                   /protein_id="ABI70035.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKLETAPGQHGARK
FT                   PRLSEYGIQLREKQKVRRIYGVLEKQFRNYYKEAARLKGNTGENLLQLLEVRLDNVVYR
FT                   MGFGSTRAESRQLVSHKSVMVNGRVVNIPSFKVSANDVVSIREKSRTQARIKAALEVAG
FT                   QREKPTWVEVDNAKMEGAFKRVPERSDLSADINEQLIVELYSK"
FT   gene            182753..183742
FT                   /locus_tag="Sfri_0173"
FT   CDS_pept        182753..183742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0173"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: son:SO0256 DNA-directed RNA polymerase subunit
FT                   alpha; TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase, alpha subunit domain protein; RNA
FT                   polymerase, dimerisation; RNA polymerase, insert; SMART:
FT                   RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70036"
FT                   /db_xref="GOA:Q089M9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089M9"
FT                   /protein_id="ABI70036.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVNSTRAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEILLNLKGLAVTIEGKDEALLTLSK
FT                   SGTGPVTAADITHDGDVTIVNPDHVICHLTGNNDISMRIRVERGRGYVPASARAQTEDD
FT                   DRPIGRLLVDASFSPVARIAYNVEAARVEQRTDLDKLVIDMTTNGTIDPEEAIRRSATI
FT                   LAEQLDAFVELRDVTEQAVVEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLV
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASLADDL"
FT   gene            183783..184178
FT                   /locus_tag="Sfri_0174"
FT   CDS_pept        183783..184178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0174"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: son:SO0257 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70037"
FT                   /db_xref="GOA:Q089M8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089M8"
FT                   /protein_id="ABI70037.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMACSIVRHEIIKTTVAKAKELR
FT                   RVVEPLITLAKVDSVANRRLAFARTRDAEVVGKLFTELGPRFQERPGGYTRILKCGLRT
FT                   GDKAPMAYIELVGRPEAAEAVEVEAAE"
FT   gene            complement(185244..185729)
FT                   /locus_tag="Sfri_0175"
FT   CDS_pept        complement(185244..185729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0175"
FT                   /product="CcmE/CycJ protein"
FT                   /note="PFAM: CcmE/CycJ protein; KEGG: son:SO0259 cytochrome
FT                   c biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70038"
FT                   /db_xref="GOA:Q089M7"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089M7"
FT                   /protein_id="ABI70038.1"
FT                   /translation="MNPRRKKRLTLAVALIAGVAAVASLLLYALNSNLNLFYTPYEITH
FT                   GKNDTGVMPEVGQRIRVGGMVTIGSMKRDPDSLHVEFAVHDSAGGTVFVTYDDLLPDLF
FT                   REGQGIVAQGVLVESGKLEATEVLAKHDENYMPPEVAEAMGQTHEKPTYNQKALEDK"
FT   sig_peptide     complement(185640..185729)
FT                   /locus_tag="Sfri_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.739 at
FT                   residue 30"
FT   gene            complement(185713..185925)
FT                   /locus_tag="Sfri_0176"
FT   CDS_pept        complement(185713..185925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0176"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /note="PFAM: Heme exporter protein D (CcmD); KEGG:
FT                   son:SO0260 heme exporter protein CcmD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70039"
FT                   /db_xref="GOA:Q089M6"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q089M6"
FT                   /protein_id="ABI70039.1"
FT                   /translation="MQFDSFKDFLDMGGYAFYVWLSYGVTFGCLATLITLSIRQKRKVL
FT                   IEIAKKITREQRLKETRGNNRESKT"
FT   gene            complement(185925..186671)
FT                   /locus_tag="Sfri_0177"
FT   CDS_pept        complement(185925..186671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0177"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: son:SO0261 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70040"
FT                   /db_xref="GOA:Q089M5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q089M5"
FT                   /protein_id="ABI70040.1"
FT                   /translation="MWKWLHSYADPERAYKLSGTLLPWFSTLAILLVGTGSIWGLLFAP
FT                   TDYQQGDSYRIIFIHVPAASMSMAAYMGMAIASFIGLVWQIKSADWAAAAIAPIGAVIT
FT                   FIALLTGAAWGKPMWGTWWVWDARLTSELVLLFLYLGVISLYASFEDKVLAARASGILA
FT                   IVGVINIPIIKYSVDWWSSLHQPSTIKITEKSTMSTDMLYPLLINIFGFGMMIGAITLI
FT                   RYRTEILARNGMRPWVRDLATAEEAK"
FT   gene            complement(186671..187357)
FT                   /locus_tag="Sfri_0178"
FT   CDS_pept        complement(186671..187357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0178"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG: son:SO0262
FT                   heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70041"
FT                   /db_xref="GOA:Q089M4"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q089M4"
FT                   /protein_id="ABI70041.1"
FT                   /translation="MKRGISYTTAFMTLLQRDLRIAIRHRGDIFNPLLFFILVVTLFPL
FT                   GIGPEPQVLTRVAPGIIWVAALLASMLSLERLFKADYNDGSLEQMLLSPQPLALMVLAK
FT                   VLAHWILTGVPLILVAPLLAVLLHLEDNSYGALMSTLALGTPILSLLGAIGVALTVGLR
FT                   KGGVLLSLLILPLYIPVLIFATSAIDAAGLNMAYDGQLAILAAMLVGSLILAPFAIGAS
FT                   LRVSTN"
FT   gene            complement(187367..188017)
FT                   /locus_tag="Sfri_0179"
FT   CDS_pept        complement(187367..188017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0179"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: son:SO0263 heme exporter protein CcmA;
FT                   TIGRFAM: heme exporter protein CcmA; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70042"
FT                   /db_xref="GOA:Q089M3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089M3"
FT                   /protein_id="ABI70042.1"
FT                   /translation="MTISNQSQVLLSANELTCIREERILFDGLSFNINAGDIVQIEGPN
FT                   GAGKTSLLRIIAGLSRPYAGEVEYSGENINRCRDEFNHDLLYLGHLAGVKSELTAEENL
FT                   NFNLRISGYDDFDTTAILAKVNLTGFEEALAGHLSAGQHRRTALARLQHSNCKIWILDE
FT                   PFTAIDKKGVEELEQLFIQHAESGGCVILTTHQDMSIISDAMLRKITLDYRFV"
FT   gene            188342..188635
FT                   /locus_tag="Sfri_0180"
FT   CDS_pept        188342..188635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0180"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: son:SO0264
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70043"
FT                   /db_xref="GOA:Q089M2"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q089M2"
FT                   /protein_id="ABI70043.1"
FT                   /translation="MKKLLAMTAVAALTLSANVFAQEGEAIYNKACQVCHSMGVAGAPK
FT                   VHDTAAWEPRLAKGLDALVGSVKSGLNAMPPGGMCTDCTDEDYKNAIQFMSK"
FT   sig_peptide     188342..188407
FT                   /locus_tag="Sfri_0180"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(188731..189984)
FT                   /locus_tag="Sfri_0181"
FT   CDS_pept        complement(188731..189984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0181"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: son:SO0265
FT                   cytochrome c-type biogenesis protein CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70044"
FT                   /db_xref="GOA:Q089M1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q089M1"
FT                   /protein_id="ABI70044.1"
FT                   /translation="MTTFWIFIALVVLIGLIMIWVPHFRQQKLLQAEESGVRRQTNLEL
FT                   FAERISILEKELQDQLLDQVEFEALKKELEINLLQDMSQKGDDSLDVEIKSKTALWPAF
FT                   MTLCLLAVSGYLYQHLGAYNELANPPQASNPHQGMDPAQIMSQRVQMMEAKVQAQPDDS
FT                   QAWFSLGHAYISANQYDKAIGAFDKVMELVGTQAELLGPKATALYYKANQQMSPAIQAV
FT                   IDQSLALDPQDPSTLLLVGMDAFFTADYKKAINAWQMILDSDRDDVDRTALMNAIESAN
FT                   MRLNEGSAMPNGESTQKPAVTSNANTVAIEISIAPELADKVADTDTVFIFARATQGPKV
FT                   PLAATKISASSLPVTVTLDDSTSMGGDVKLSSVGEVEIIAVLSKNGSVKPQSGDLKGNI
FT                   KAVKVGGNATLTLDTLVQ"
FT   gene            190402..192372
FT                   /locus_tag="Sfri_0182"
FT   CDS_pept        190402..192372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0182"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: son:SO0266
FT                   cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70045"
FT                   /db_xref="GOA:Q089M0"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q089M0"
FT                   /protein_id="ABI70045.1"
FT                   /translation="MIPELGHFSLILGLAFALLLASVPLYGSARKDQYLVRYAWPLTYG
FT                   MFFFISLSVIALGYSFAVDDFSVAYVAHHSNSQLPIFFKIAAVWGGHEGSLLFWVFALS
FT                   VWTASVALFSKGLEEVFTARVLSVLAMIVVGFGLFMILTSSPFERIFPIPLEGRDLNPM
FT                   LQDVGLIFHPPMLYLGYVGFSVCFAFAIAALMSGRLDSAWARWSRPWTLAAWIFLTGGI
FT                   SLGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALVHSLIVTEKRGAFRNWTVLLSIF
FT                   AFSLSLLGTFIVRSGVLTSVHSFAADPSRGLFILLLLGIAIGGSLTLFAFRASEMSSPA
FT                   RFELKSKETMLLICNVLLTVAAGTVLLGTLYPLLIDALGMGKISVGPPYFNAVFVPIVL
FT                   VLFGFMGIGPIIRWKKSKPGEIKKQLLVPAIIALVVGVSAPFVADGQFNAWVMCGVAAT
FT                   TWIMLSTLRAAYNIVSNKEGGISLNKMGRSQLGMIVAHFGIAVSVMGATIVSNYSIEKS
FT                   VRMGPGISQELAGYTFKYLETKNVVGPNYTAQQGQIEIYKDDEFITLLKPDRRQYNVRT
FT                   MDMTEAGIDWGLFRDLYVTMGDPISLTEFAVRLNYKPFVRWLWFGSIFMMIGGFLAASD
FT                   KRYRVKQVATEDAAKAKLATA"
FT   sig_peptide     190402..190485
FT                   /locus_tag="Sfri_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.807 at
FT                   residue 28"
FT   gene            192389..192943
FT                   /locus_tag="Sfri_0183"
FT   CDS_pept        192389..192943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0183"
FT                   /product="periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: Redoxin domain protein; KEGG:
FT                   son:SO0267 thiol:disulfide interchange protein DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70046"
FT                   /db_xref="GOA:Q089L9"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q089L9"
FT                   /protein_id="ABI70046.1"
FT                   /translation="MKKFVLFIPLVIFLGMGVFLYKGLFLNPKVLDSALEGKPVPAFQL
FT                   ERLEVPSEVLTEKDLPAKVSMLNFWATWCPACKYEHPYLMMLSKRNLLPIYGINYRDER
FT                   ALAVKELTTQGDPYTVNIFDKDGRLGLDLGVYGAPETFIVDHNGIIRYRYAGPIDQTVW
FT                   TQTLYPMIQQLQAEAKVDGAS"
FT   gene            192943..193425
FT                   /locus_tag="Sfri_0184"
FT   CDS_pept        192943..193425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0184"
FT                   /product="respiratory nitrite reductase specific cytochrome
FT                   c biogenesis protein NrfF"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   son:SO0268 cytochrome c-type biogenesis protein CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70047"
FT                   /db_xref="GOA:Q089L8"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR017565"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q089L8"
FT                   /protein_id="ABI70047.1"
FT                   /translation="MKFIFKMMVACTSLLFTLTVMATPVDTYEFQSADNQQRALSLAHQ
FT                   LRCPQCQNQNLVDSNSPVAQDLRLEVYTMVDSGKSDSEIIEFMTSRYGDFVLYNPKLDS
FT                   KTYILWLGPFGLLVLGLFIGFIFVRKQRIQATESTTLSTEQQAELDALLNRSKTTK"
FT   sig_peptide     192943..193011
FT                   /locus_tag="Sfri_0184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 23"
FT   gene            193486..194025
FT                   /locus_tag="Sfri_0185"
FT   CDS_pept        193486..194025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0185"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: son:SO0269
FT                   thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70048"
FT                   /db_xref="GOA:Q089L7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q089L7"
FT                   /protein_id="ABI70048.1"
FT                   /translation="MGTASVANAYPGMQAAAKQTSESTLERINILPQPFPIALVDFTNL
FT                   VGQSVNFEQYKGKVVVVNLWATWCPPCVRELPALNRLNQTLNAEHFALLPISIDAEAVA
FT                   IVQPFLESLGLGEFNSYFDPQQQLRDVFPLDTIPATFILNEQGELVAYVRSYVDWDDTS
FT                   VATFLEQFRQNAKEVQ"
FT   gene            194560..196094
FT                   /locus_tag="Sfri_R0013"
FT   rRNA            194560..196094
FT                   /locus_tag="Sfri_R0013"
FT                   /product="16S ribosomal RNA"
FT   gene            196482..199397
FT                   /locus_tag="Sfri_R0014"
FT   rRNA            196482..199397
FT                   /locus_tag="Sfri_R0014"
FT                   /product="23S ribosomal RNA"
FT   gene            199536..199657
FT                   /locus_tag="Sfri_R0015"
FT   rRNA            199536..199657
FT                   /locus_tag="Sfri_R0015"
FT                   /product="5S ribosomal RNA"
FT   gene            199760..199836
FT                   /locus_tag="Sfri_R0016"
FT                   /note="tRNA-Asp4"
FT   tRNA            199760..199836
FT                   /locus_tag="Sfri_R0016"
FT                   /product="tRNA-Asp"
FT   gene            201080..202354
FT                   /locus_tag="Sfri_0186"
FT   CDS_pept        201080..202354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0186"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="TIGRFAM: competence/damage-inducible protein CinA;
FT                   PFAM: molybdopterin binding domain; CinA domain protein;
FT                   KEGG: son:SO0272 competence/damage-inducible protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70049"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089L6"
FT                   /protein_id="ABI70049.1"
FT                   /translation="MKLEMICTGEEVLSGQIVDTNAAWVANTLMELGIEMQHRVTVGDR
FT                   MDDLVAAFQERSKHADVIIVNGGLGPTSDDMSALAMAKAKGEELVENVQWREHLEDWFT
FT                   RNNRVMAKSNLKQAWLPASAVMVDNPVGTACGFRVKLNNAWLFFTPGVPFELKHMVTEQ
FT                   FIPFITEEFGVQEKSALEKLLTIGHGESSLADTLSEITLPAGIELGYRSSMPHIEIKIF
FT                   ARGDKAIRQLPDVTKQVKALLGCAVVAENRPTLAAEIHHRLYQSGFSLSVAESCTGGMI
FT                   TSQLIDFAGSSSYLHHGLVTYSNESKVKVLGVNPQILDDHGAVSIPTVEAMAQGVRGIL
FT                   DSDFALATSGIAGPDGGSDDKPVGTVAIALATKHGVYSQMVKLPKRSRQLVRSMSTAIA
FT                   YDMLRRALLEEAVIVDYPSIPRFAK"
FT   gene            complement(202404..205463)
FT                   /locus_tag="Sfri_0187"
FT   CDS_pept        complement(202404..205463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO1096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70050"
FT                   /db_xref="GOA:Q089L5"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q089L5"
FT                   /protein_id="ABI70050.1"
FT                   /translation="MPLMDDVATLKAQLAELVSQQGAQQADVNQQLAKFSQQLDALALQ
FT                   VQAQNNNEQHISLADKNLHVPVYESRANDSSGNIVADKPQYSSSAWERQPLDTNHSASA
FT                   PSITAQQTSIVTKSPARQSALSAMVSQLAEAIGEFSTSALAPLSGLTEQAKSFYQHYQT
FT                   KGLGAVFLMTVAGIITLTLGFGYLLQFSINNWFSELGKALLGLGVANSIIVGGVFIRQK
FT                   RPGMQDFGSGLVGLGLILNYLCLYFLGPYFQLIPDTACFGLLLLNTVFGYGLSFKLDTK
FT                   VVAIVALLGGSLAPLMLLDGGQTPLLYLPYLMLIGICSMVQSHKLVWPILIEITALLHI
FT                   ACIQILSLFIQLPLSVIDWQTGLALLMINGLFYLYGIASLLFVIKSALTPRLLAVPIAL
FT                   MVFTLYTLTEWSIFAGELFALNALLCGLLYWVIKRDKDINALALAFAGSFAGFAALFLL
FT                   SVELMGLVLLLEGLLLLWIGCKQQFNPIRAEAYVLLILGIISSFANVFDVLTLPHYDNN
FT                   GLLGYQALLSLSMALTCAMTFAAQKLLSRHQADLMTFEHLAVRFIRELLGVLYTVTLLL
FT                   ISFFITEQYWLNTLPLISLLLLYMSAKHTLRFSEVLAWIVQLPLLGLVIIGMVDANSLS
FT                   FADQAMNAKLARIELFTGLLLAYYWYKKYYADAKLIRFAYYVQLACYLALPLLLLPKIV
FT                   RSYPDYIAIALWLSSLMSLGLAYLVNHKSLRYESQILTVLATMVTAAMCLAELWQGLIA
FT                   LVLGLSFIGLISWRYTQLPEKWQQMTTLQWHIGPYYIALVIAVLSQTVTNLIHPSWAIT
FT                   ALIICGYFSVITERSTRIGRHLKQALAPSYSLAYTAIFICAILPIVLHSETQLTLNINS
FT                   LLINLAEFGVLVLLARYLLTAKLGIRAHRKIVSHNALKWAWHALLVISYLLWSYQLDTS
FT                   MAAPMSAVLLVVHASAVMFISLRPQQASLVRLAALLFTLACIKVIFVDMASFELIQKIV
FT                   AFILIGVILLTVAYFYQKAKNNQLPEDLTA"
FT   gene            complement(205651..206190)
FT                   /locus_tag="Sfri_0188"
FT   CDS_pept        complement(205651..206190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0188"
FT                   /product="protein of unknown function DUF1439"
FT                   /note="PFAM: protein of unknown function DUF1439; KEGG:
FT                   son:SO0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70051"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:Q089L4"
FT                   /protein_id="ABI70051.1"
FT                   /translation="MITLVKTLGLGLLLLLTGCASQYSITESEIEQYLNKDMHFEVKQG
FT                   NKLIGVSLKLNDMQVVLGAKPNTMAVTAATMITVNNPLLPIHAKLKTTFEAVPWYDSNT
FT                   KSVYLRQLTLVKVESEPADIERYISQATPQLMGFLRNYLENQPVYTLDTRDSNQALMAK
FT                   MTKEIAVQQGKLVVKF"
FT   sig_peptide     complement(206110..206190)
FT                   /locus_tag="Sfri_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.415 at
FT                   residue 27"
FT   gene            complement(206187..208835)
FT                   /locus_tag="Sfri_0189"
FT   CDS_pept        complement(206187..208835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0189"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   son:SO0274 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70052"
FT                   /db_xref="GOA:Q089L3"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q089L3"
FT                   /protein_id="ABI70052.1"
FT                   /translation="MTEQTADMYASLRSNVGHLGQILGETMQNHLGDAFLEKVEQIRIL
FT                   AKKSRQGDEASREQMLALLTALPDEELVPFAKAFNQFLNLANIAEQFHTISRNCDELVC
FT                   VPDPVEQLLGRMLDTDLDKKDVIKSLKNLDIDLVLTAHPTEISRRTLIQKYAAVVDCLT
FT                   EQENSQLTDRERQQSTLRLRQLIAQIWHTNEIRNERPTPVDEARWGLSTIETSLWQAIP
FT                   DFLRQLNDQVEQKTGQQLPIDVSPVRFSSWMGGDRDGNPFVTSLVTQEVLDRNRHAAAR
FT                   LYLKDIVSLLGELSMEQANAELSALTDNSKEPYRDVLRKLRCQLHGTIDYLNARLEGKK
FT                   PDVDTSELIWHKSDLLEPLELLYKSLTDCGMKLIANGLLLDILRRLACFGIHMLRLDIR
FT                   QDATRHSDVIAELTRYLGMGDYNHWDENEKQAFLLRELTSKRPLIPTNWKPTDDVAEVV
FT                   RTCNLVAQQPVNALGSYVISMASKPSDVLTVLLLLKEAGCTNPMRVVPLFETLADLEGA
FT                   ADCMTSLLNIDWYRGYTKGMQEVMIGYSDSAKDAGVMAAAWAQYRAQEQLVAVCKKADV
FT                   KLMLFHGRGGSIGRGGGPAHKAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLA
FT                   LYTSAVLEATLLPPPEPKKSWRDCMQRIAEESVLHYRGIVREEPDFVEYFRSATPEVEL
FT                   GKLPLGSRPAKRKVDGGIESLRAIPWIFAWSQNRLMLPAWLGAGEALQDAADRGELELL
FT                   REMEEQWPFFETRISMLEMVYTKAEPNLAKYYELCLVKPELHHLGEKLRQRLQLGIEAV
FT                   LSLTQATELMSHTPWSRESVKLRNPYIDPLNFLQTELLARTRREVEPSADVQLALMLTI
FT                   AGVAAGMRNTG"
FT   gene            complement(208988..210139)
FT                   /locus_tag="Sfri_0190"
FT   CDS_pept        complement(208988..210139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0190"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   sgl:SG2161 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70053"
FT                   /db_xref="GOA:Q089L2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q089L2"
FT                   /protein_id="ABI70053.1"
FT                   /translation="MSTLPDLKSCFTQLIAAPSVSALEAEHDMSNHAVINLLQNWFSEL
FT                   GFECETPTVEDSRNKQNLIARIGSGSGGLLLAGHTDTVPFDEGRWSQSPFEMVEKDNRW
FT                   YGLGTCDMKGFFALVLEALKDMPLDQFKRPLTIFASADEETTMSGAKAFADSKVIAPDY
FT                   AVIGEPTSLKPVYMHKGHLAQGIRVIGRSGHSSDPARGLNAIEVMHKVISQLMKLKQHL
FT                   SENYREDAFTVPYPTMNFGHIHGGDAANRICGCCDLHLDIRPLPGMELADLELMVLNYL
FT                   SDISKEYPGSISVSTLYPGAESFAGKADNPWTKLVAELSGNEAEVVNYSTEAPYINKLG
FT                   CQTLVLGPGSINQAHQPDEFIGLEYLTPTVELIKKMIFHACIK"
FT   gene            210403..211383
FT                   /locus_tag="Sfri_0191"
FT   CDS_pept        210403..211383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0191"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: son:SO0275 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   Semialdehyde dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70054"
FT                   /db_xref="GOA:Q089L1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089L1"
FT                   /protein_id="ABI70054.1"
FT                   /translation="MKSIAIIGASGYTGAQITSLINADCNFSVQGLYVSENSLDKGRKL
FT                   ADLYPTYSHMAYTLSPLSDDAKKKIVAEADAVVLATEHSVSLELAAWFYQQGLAVFDLS
FT                   GAYRFADVAQYPKWYGFEHTHPDVLAQAVYGLAEWNSEQIKQTRMIAVPGCYPTASLTA
FT                   LKPLKPFLTEMYPVINAVSGVTGAGRKAQLHTSFCEVSLTPYGVLGHRHQPEIATHLGQ
FT                   EVIFTPHLGNFKRGILATITVQLKPGTTEADVAKAYSVYDNAPIVTVKHNQFPKVDDVV
FT                   NTPNCHLGWKYDANSGYLVVASAIDNLMKGAASQGLQCIKIHFGV"
FT   gene            211414..212193
FT                   /locus_tag="Sfri_0192"
FT   CDS_pept        211414..212193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0192"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: son:SO0276
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70055"
FT                   /db_xref="GOA:Q089L0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/TrEMBL:Q089L0"
FT                   /protein_id="ABI70055.1"
FT                   /translation="MATKSVLVLKVGGALLQCEMGMARLMAAAAEMLAAGQQVILVHGG
FT                   GCLVDEQLTANGKETVKLDGLRVTPEDQIPIIVGALAGTSNKILQAAAAKAGIVSVGMS
FT                   LGDGNVVTAKIKDERLGLVGEVEPKDATYLNFILSQGWMPICSSIAISSQGEILNVNAD
FT                   QAATALAKLVNGTLVLLSDVSGVLDGKGQLIHSLNKSEIEHLVAQGVIEKGMKVKVEAA
FT                   LEVAQWMGKPVQVASWRDAEQLKTLVKGGSVGTQIQP"
FT   gene            212208..213113
FT                   /locus_tag="Sfri_0193"
FT   CDS_pept        212208..213113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0193"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: son:SO0277 ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70056"
FT                   /db_xref="GOA:Q089K9"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K9"
FT                   /protein_id="ABI70056.1"
FT                   /translation="MQHLLSIKELTQSQLLAIIDLAKKIKNNPAEYRRALDGKSVVMLF
FT                   EKPSLRTRVSFDIGINKLGGHCLYLDQQNGALGQRETVADFATNISCWADAIVARTYSH
FT                   TTIEQLAQHGSVPVINALSDLYHPCQALADFLTLAEQFDDVSQAKLAYVGDGNNVTHSL
FT                   IYGAAILGMTMTVICPEGAFPDALIVTEAQALAKQNGGKLTLSADINAIEGHDAIYTDT
FT                   WISMGDETPLADIKARFAPYQVNSELMAQAGAKFFMHCLPAHRGVEVTDEVMDGEGSLI
FT                   LHQAENRMHAQNAVLVTLLS"
FT   gene            213206..214429
FT                   /locus_tag="Sfri_0194"
FT   CDS_pept        213206..214429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0194"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: son:SO0278
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70057"
FT                   /db_xref="GOA:Q089K8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089K8"
FT                   /protein_id="ABI70057.1"
FT                   /translation="MSNAVKKTGVKKVVLAYSGGLDTSAIIPWLKETYDDCEIIAFCAD
FT                   VGQGEEELVGLTEKALASGASECHIVDLKEEFVADYIYPTIATGAIYEGTYLLGTSMAR
FT                   PIIAKAQVEVARKVGADAVCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWEMRSRE
FT                   DLLAYLAERDIKTSASATKIYSRDANAWHISHEGGELEDPWNEPSKGVWTLTVAPEDAP
FT                   NEPEYVSLAVKHGRVTHVNDEALSPYAALMKLNDIAGKHGVGRIDITENRLVGMKSRGC
FT                   YETPGGTVMFAGLRAIEELVLDKTSRTWREQIAGQMSHLVYDGRWFTPLCKSLIAASES
FT                   LAESVNGDVVIKLYKGQATAVKKRSPNSLYSESFATFGEDDVYDQKHAEGFIRLYSLAS
FT                   RIRALNTK"
FT   gene            214516..215946
FT                   /locus_tag="Sfri_0195"
FT   CDS_pept        214516..215946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0195"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: son:SO0279 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70058"
FT                   /db_xref="GOA:Q089K7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K7"
FT                   /protein_id="ABI70058.1"
FT                   /translation="MTYSYIIKHPVLKTVFKTEDTDMALWGGRFQGETSALFKLFNDSL
FT                   PVDYRLFEQDVVGSIAWADAIASVGIITAKECTDLKAALNELLVEVGNDPQAIISNGAE
FT                   DIHSFVEQKLIAKVGDLGKKLHTGRSRNDQVATDLKLWCKKEGAALLARLGTLHAELIA
FT                   LAEREVDAVMPGYTHLQRAQPVTFGHWALAYVEMYERDISRLQDALNRADSCPLGSGAL
FT                   AGTAYPIDRHALAAALNFARPTLNSLDSVSDRDHVVELCSAASISMMHLSRMAEDLIFF
FT                   NSGEANFISLADEVTSGSSLMPQKKNPDALELIRGKTGRVYGSLMGILTTMKALPLAYN
FT                   KDMQEDKEGLFDVVDSWAICLDMAALVLSGLKVNRPQALVAAQQGYANATELADYLVAK
FT                   GMPFREAHHVVGEVVVFAIGEQKPIEDLSVAELQKFANVISDDVYPNLTIEACLEKRDV
FT                   LGGTAINQVQAVIAAKKA"
FT   gene            216592..217641
FT                   /locus_tag="Sfri_0196"
FT   CDS_pept        216592..217641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF2053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70059"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K6"
FT                   /protein_id="ABI70059.1"
FT                   /translation="MTKSIFLLLAGLLTGAAQAAVGSYPVVLVHGFQPDNLQSKPTGTQ
FT                   VADNGSEYWAQYWRDRADARIDWPSQERIANKITSQYVWPKLQQMSREGTCASGCVFVT
FT                   HSTGDLVMRYIIDNQALWLQNAGLKPLNIVATFDFSGAGGGVELADLAVNVASGSGLID
FT                   ATLKLAVSLWLGELPSSSNIGVLNDLRVNTARQLAAFPESRVPRLRFAGAGSDFLGVTG
FT                   AFLPGEDDGVVASHSSCGAAAVGSYNSCSRSVAFDGKLTSTNGPSGFMPYHYPMLMSEG
FT                   YSHGDTILNSAKDEVTSANSSANYLNGDNLQFNTYDEKRGWWIFSSRYRVVNHSNKTSM
FT                   SALVYQAAN"
FT   sig_peptide     216592..216651
FT                   /locus_tag="Sfri_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            217648..218703
FT                   /locus_tag="Sfri_0197"
FT   CDS_pept        217648..218703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70060"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K5"
FT                   /protein_id="ABI70060.1"
FT                   /translation="MKYKKIIITIALLATAVGFWVDTSESALEPPQSAAVIEQDDTAPT
FT                   KPKVVKSMPAKTMTVVEKLPQPISNSFQLMAEAYASELELPSYSMPLSVDDTHLLNPNA
FT                   YIPQPVQLQDGASASIVLPKYRFSFPEPVVINLEVNGLLVTGASAALHSELTSGSEPLI
FT                   SETMLGADGKWAIQLNAEEDWNGPMEVSVTFRAKGKKQTLKTGIEYSHPTATITGVGDI
FT                   RAEGSDMLIPVKLDVEQAGYYRLRANLYTADKQPIALLTDSDKLTEGSVVLDLKAYKGV
FT                   LAQYKGPYVLSTFVLERRPAVPGELTQYGHSEEPAYELGDFAVESLSDEPWQPDEQEMQ
FT                   RLEFLQKMAAD"
FT   sig_peptide     217648..217731
FT                   /locus_tag="Sfri_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.903) with cleavage site probability 0.265 at
FT                   residue 28"
FT   gene            complement(219013..219951)
FT                   /locus_tag="Sfri_0198"
FT   CDS_pept        complement(219013..219951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0198"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: hch:HCH_06939 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70061"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K4"
FT                   /protein_id="ABI70061.1"
FT                   /translation="MPQSPPVNLEPILLDALKLTPNCFGVLNQDKEVIYCNQHFASIFG
FT                   TTAEDAIGKKSGDLLRHAWETKQGVIINTDDFEQWLENLHKLHSEKALNQYETDLSDGR
FT                   WFKMTRINLDSGYTIIMGADITNLKQAQTSLEQAHQQIESLVNTDQLTGMHNRRSYNQL
FT                   AKQECARAIRFNQQLSLLVIDIDYFKVINDNFGHDGGDSILKQFAQICSDLLRQSDSLS
FT                   RIGGEEFTIILPMTDGEGAMIIAERIREHIAKHSFHTTQTNNNINVTVSIGVSSLTAGD
FT                   KVIQDLFSRADMAMYCAKRGGRNQVQQTQPV"
FT   gene            complement(220210..222513)
FT                   /locus_tag="Sfri_0199"
FT   CDS_pept        complement(220210..222513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0199"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding; KEGG: gox:GOX0587 membrane-bound
FT                   aldehyde dehydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70062"
FT                   /db_xref="GOA:Q089K3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K3"
FT                   /protein_id="ABI70062.1"
FT                   /translation="MSRMPKRGSAGITRRGFLIAMTAVGVSFGFPRHLMAAMDPASPDG
FT                   KVLPSEGDIYEPSLWYSIDTAGKIKVNIMRSEMGQHVGTAIARILADELEALWDDVEII
FT                   HVDSDPRWGYMVTGGSWSISQSWPVYRQAGAAGRTALIEAAAKKWGIAAKDCKASNGKI
FT                   ISSKGEMSYGELVTLGLTRQFTEEELKTLPLKPNADLKLVGQQVTSLDIANKTNGKTIF
FT                   GIDAKVDGMVYANPILPPTRYGSKVVKFDDSAAKAVKGYQQTIILDDASGSVPGWLMVI
FT                   ASSFNAAQKASKLVKVTWDAGKTANVSEADIIAHGKRLLGDQTKGSILDTGNTDTGPVF
FT                   ASAKSTIAEEYITSTVLHAQMEPLNALVFKNQDGIWEVHSGCQWQSLTLPVLATALGEE
FT                   EANIVIRSYMLGGGFGRRLNGDYTIPAALTSKALGGKPVKMVMMRPQDMLFDSARSASV
FT                   QQLKMAFDDKKAVTAMEHHATAGWPTQVLAPGFMPKGTNGEPFDPFSIAGADHWYTVGA
FT                   QKVRAVSNDLAIATFRPGWLRSVGPGWTGWAVESFMDEAAHHAGKDPLQFRLDMLIAEG
FT                   RNAGSTPVAEGGAARQAAVLKKAAEMIGWGTPQAKDTGLGIASTFGQERDMPTWVSCAV
FT                   QVHVDKSNGIVNVQKLVIAIDAGIIVDPNGAEAQCQGAALWGLSMALYEGTELLNGQYK
FT                   DSNFDTYTPLRLGQTPEVIIEFIPSKMPPSGLGEPAVTPVAPAIANAIYQAVGVRLRKI
FT                   PMKPSELKSALTNA"
FT   sig_peptide     complement(222403..222513)
FT                   /locus_tag="Sfri_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.979 at
FT                   residue 37"
FT   gene            complement(222497..222976)
FT                   /locus_tag="Sfri_0200"
FT   CDS_pept        complement(222497..222976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0200"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: gox:GOX0586 membrane-bound aldehyde dehydrogenase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70063"
FT                   /db_xref="GOA:Q089K2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K2"
FT                   /protein_id="ABI70063.1"
FT                   /translation="MAKFILNGKPMTADVESDTPLLWVIRDELDMTGTKFGCGIGTCGA
FT                   CTVHVGGRATRSCITPISSVEGAEITTIEGLSEKGDHPLQISWQKLQVPQCGYCQSGQI
FT                   MQAAALLKDIPEPSDKDIDAVMGGNLCRCMTYVRIRGAIHEAANAIKENNDEQNA"
FT   gene            complement(222995..224293)
FT                   /locus_tag="Sfri_0201"
FT   CDS_pept        complement(222995..224293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0201"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: gox:GOX0585
FT                   cytochrome c subunit of aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70064"
FT                   /db_xref="GOA:Q089K1"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K1"
FT                   /protein_id="ABI70064.1"
FT                   /translation="MLKRIVYGVCGAAIVGLGIFSIYAWHPAIDPVVPTQTDYSPQVIE
FT                   QGKILAAAGYCSTCHTPPGGTAYAGNYEMHTDFGTIYSSNITPDVETGIGGWSQAAFAR
FT                   AMRTGVSRDGHHLLPAFPFEHFNKMTDDDINAIYAYIMTSVPAVNQVKKDNGIPFPLNI
FT                   RWFQAGWKLLFADTQAFEVNSKQSAEWNRGAYLAEGIAHCGACHTPRNALGGEKYDQMY
FT                   QGAAIDGWIAPSLTSTSTSPIPWRAQDFYEYLTTGNSPYHGSAAGPMAPVMHKGLSALP
FT                   DSDIEAISGYFAEIARTNNTDDPDSSSTLQAAIAAQHQQPDQRIDEGARLYATACQACH
FT                   YNSDQLVKGRPLITIGSATHLNDPTNLINVILDGVRSDQGISGVVMPGFRDALSDEDIT
FT                   AIAAYLRQAAGENTWPKLQQQVGEIRNQPRFEH"
FT   sig_peptide     complement(224219..224293)
FT                   /locus_tag="Sfri_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.727) with cleavage site probability 0.726 at
FT                   residue 25"
FT   gene            224961..225278
FT                   /locus_tag="Sfri_0202"
FT   CDS_pept        224961..225278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70065"
FT                   /db_xref="GOA:Q089K0"
FT                   /db_xref="UniProtKB/TrEMBL:Q089K0"
FT                   /protein_id="ABI70065.1"
FT                   /translation="MELVSVSSLWLGCLFAYLASDKQQLISLPFPKLLAWSLCGLSVVF
FT                   AVWGFSHTYSVLVASLVVLICMMTMWILLVLVASHYKGRSIWVSSLGFALFVSILLVGV
FT                   K"
FT   gene            225281..225538
FT                   /locus_tag="Sfri_0203"
FT   CDS_pept        225281..225538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70066"
FT                   /db_xref="GOA:Q089J9"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J9"
FT                   /protein_id="ABI70066.1"
FT                   /translation="MWPKSVAAFLWGLLLAISLMLIVFRTLPAAVDVKLFVGLMLGFCV
FT                   WVGVMTFCYSRNSAKAASVVCAKWLVASSLINTLLFYSQN"
FT   sig_peptide     225281..225373
FT                   /locus_tag="Sfri_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.784 at
FT                   residue 31"
FT   gene            225563..227164
FT                   /locus_tag="Sfri_0204"
FT   CDS_pept        225563..227164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0204"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: pfo:Pfl_0927 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70067"
FT                   /db_xref="GOA:Q089J8"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J8"
FT                   /protein_id="ABI70067.1"
FT                   /translation="MNTSMKPDSPVQHKVVKNLIEAHSWLGLIISPLLFLVFWAGAVTL
FT                   FHDEIAQWAITPHHPVDNTQADIPLAKLVEQKLAEYPVDQAGRFRINMPTELVPYYIFY
FT                   FDVFGDTPQSDRQSMAILVDPKSGETVAGKDDFYLSQFIYRLHYNLDLPGGSYLIGVVT
FT                   LIFLFALVSGIFIHARKLLKHFFLYRVDKQRRDKLLDLHTVVGVMTIPFTLMYALSGLI
FT                   LNLAIVFQLAFVVFIYQGDRQALFNDAGFNRTSEPRSETSLDMSNAFTLIEQTKQQSNF
FT                   ELRNIIFHHYGADNALVQVRGTDTVNFAQRDEVTYRVQDGTVMDKVNADNYNVFRQGRD
FT                   VLVTLHFSNFAGLDIRILYFILAMAISAMIVTGNMLWINKRSAQRQSSQRSIAIVTAMT
FT                   IGGCGGIIVATAVGFLCERLLPATLSGRSEWLVGCFVTSLLLVMLCSIKVTDIKRHLSQ
FT                   LLLLTSGILIITIVADWLLFSEQIIALWQSGYHGVIGIQVGMMLVTAVCLLTANKLGVS
FT                   PRSQPAMVKNITPANG"
FT   gene            complement(227239..227934)
FT                   /locus_tag="Sfri_0205"
FT   CDS_pept        complement(227239..227934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0205"
FT                   /product="Pirin domain protein domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: vpa:VPA0042
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70068"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J7"
FT                   /protein_id="ABI70068.1"
FT                   /translation="MITLRPASERGKANFGWLDSKHSFSFGSYYDPYHMGFSALRVIND
FT                   DSVAPGAGFATHGHRDMEIISYVLEGSIAHKDSEGNVEVLPAGEFQLMSAGSGITHSEY
FT                   NASKTDPLKFLQIWIQPNTLGNTPGYQQKNFGQAVGLTTIATPTGENGTLQIKQNATLS
FT                   QLILASKSEITYQIATDRKMYVHQVAGELNIEDQQLTIGDGAKLTDITTVTLVNPTDTQ
FT                   ATALIFDLP"
FT   gene            complement(228017..228463)
FT                   /locus_tag="Sfri_0206"
FT   CDS_pept        complement(228017..228463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0206"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: vpa:VPA0043
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70069"
FT                   /db_xref="GOA:Q089J6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J6"
FT                   /protein_id="ABI70069.1"
FT                   /translation="MKALVKRITNSTAGFSTLALRLPVGIIFMAHGGQKLFGWFGGYGL
FT                   EGTGQWMASIGIEPGVLMAFLAGSAELVGGLFILLGLLTRPAAVLLAFTMIIAIASVHI
FT                   SNGLFMANNGYEFALALLAASVSLALSGSGKLAIDNAITTRLTK"
FT   sig_peptide     complement(228365..228463)
FT                   /locus_tag="Sfri_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.819) with cleavage site probability 0.818 at
FT                   residue 33"
FT   gene            228610..229503
FT                   /locus_tag="Sfri_0207"
FT   CDS_pept        228610..229503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0207"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO3318 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70070"
FT                   /db_xref="GOA:Q089J5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J5"
FT                   /protein_id="ABI70070.1"
FT                   /translation="MQNPITIDALRALDAIERKGSFAAAAASLYRVPSALTYTIKKLED
FT                   DMGTALFDRTKQKAQLTPAGKIVLEQGRQILLATNRLVDSVQQLESGWETEIRLSRDTV
FT                   IPQGVLFQLIEQFNQLEHSVDISVDVEAVGGGWDALHSRRADIVIGASGELPRGVFQTH
FT                   KIGEIEFVFAVAPHHPLAFVDGILEADKLTDYASVVVADTSQLLPTRSSGMFNSKQVIR
FT                   VNTMETKIAAQRQGLGIGFLPRHMVQCYFDSGELIEKSCSIPRPNQSLYIAWHKDHQGR
FT                   AFDWFVDHLPKADWGL"
FT   gene            complement(229640..230842)
FT                   /locus_tag="Sfri_0208"
FT   CDS_pept        complement(229640..230842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0208"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pfo:Pfl_5034 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70071"
FT                   /db_xref="GOA:Q089J4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J4"
FT                   /protein_id="ABI70071.1"
FT                   /translation="MPLALLALTLSAFAIGTTEFVIVGLIPTMAQDLNVSLPSAGLLVS
FT                   LYALGVAIGAPVLTALTGKWNRKHVLLAVMSLFVAGNLLAWQAPGYETLIAARIITGLA
FT                   HGVFFSIGSTIATGLVPKEKAASAIAIMFTGLTVALVTGVPLGTYIGQTFGWQATFLTV
FT                   AILGFVALIGSSLLVPNNLPQPPAAKLSSQLKVLTQPRLLLVYAITALGYGGTFTAFTF
FT                   LAPILEQVSGFESQSIGLIMLVYGVSVAIGNIWGGKMADKMGPIKALSIIFSGLATILV
FT                   IFNFTAVNPIAAVITILVWGAFAFGNVPGLQVYVVSLAQKYTPDAVDVASGLNIAAFNV
FT                   GIALGSWGGGLIVANAGLMHTPWVGAVIVVIALALTRFSGSLDKKTNASKNAQVSIQAS
FT                   S"
FT   sig_peptide     complement(230750..230842)
FT                   /locus_tag="Sfri_0208"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.807) with cleavage site probability 0.321 at
FT                   residue 31"
FT   gene            231035..231916
FT                   /locus_tag="Sfri_0209"
FT   CDS_pept        231035..231916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0209"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: ppr:PBPRB1652 putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70072"
FT                   /db_xref="GOA:Q089J3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J3"
FT                   /protein_id="ABI70072.1"
FT                   /translation="MLTRSDDLDILLMVVDSGGFSAAADALNIQVARVSRAVSKIEQQL
FT                   GVTILNRTTRRVELTDEGRQFVESVRGGLQQLQRAEDELVRRGELPQGRLRVDAASPFV
FT                   FHQLVPLMKDFRAAYPDIELALTSNEGYVDLLEKRTDVAIRIGKLADSTLHARPLGKSA
FT                   LHIVASAEYLARRGVPQKVSDLACHELLGFTEPKILNHWPLKGCDVITPTISTSNGETL
FT                   RQLALAGNGIACLSSFMINDDLAAGRLVPILQSEKFTHIEREQVNAVYYKSSIVARRIS
FT                   AFIEFIQPRLTL"
FT   gene            232046..232852
FT                   /locus_tag="Sfri_0210"
FT   CDS_pept        232046..232852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0210"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: xcb:XC_0279
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70073"
FT                   /db_xref="GOA:Q089J2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J2"
FT                   /protein_id="ABI70073.1"
FT                   /translation="MTTIPLLGTGTFRLKDQLAFDSVLMALKQGSRHIDTAQIYANEKQ
FT                   VGDAINASGIARADIFLTTKVWTDRFAHDQLIQSVHDSLALLQTDYVDLLLIHWPLRDD
FT                   SVPMREYLLALKEVQGAGLAKHIGVSNFTIAQVTQAIEILGADAIFTNQVEVHPYLQNN
FT                   RLVKFCQQHNIMVTGYMPFAYGAVLTDDTIVAIAKKHQMTPAQAVLVWMRQKGYVTIPS
FT                   STKLVNVQANMASLALSLPSEDMAAINKLDRNHRVAAPDFSPDWDQ"
FT   gene            233105..233551
FT                   /locus_tag="Sfri_0211"
FT   CDS_pept        233105..233551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0211"
FT                   /product="transcriptional regulator, MerR family protein"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: sde:Sde_1934
FT                   putative transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70074"
FT                   /db_xref="GOA:Q089J1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J1"
FT                   /protein_id="ABI70074.1"
FT                   /translation="MQVSELATLLGVTTDTIRFYTRIGLLAPTKSPSNGYKFYRDKEVS
FT                   RMRFIMSARNLGFSVDEIKVIFSKTDHGESACTMVKQLISQKLAETEILFNETLKLRNK
FT                   LTQAVSEWENLPALAPTGAMICHLIEGFDPNHETPCQASDKESL"
FT   gene            233551..235791
FT                   /locus_tag="Sfri_0212"
FT   CDS_pept        233551..235791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0212"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: ilo:IL1218 cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70075"
FT                   /db_xref="GOA:Q089J0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q089J0"
FT                   /protein_id="ABI70075.1"
FT                   /translation="MNTQTTTQLLIEGAGCASCVGKIEKALKTVAQVEQAEMNFADRSV
FT                   MVTGEVDVARLLDAVEQAGYHAIVINDQGGADAIDEKEQADAAYYKSLIKHTVVALAVG
FT                   IPLMIYGLLIGDMTVTSPMQQLVWGAIGVLTLGIMFVSGKHFYTGAWKSFINHSANMDT
FT                   LIALGTGTAWVYSMVVVLAPDLLPQMARHVYFEATAMIIGLINLGLALEVKARGKTSAA
FT                   IKRLIGLQAKTARVIRNGKAVDIDIALVQLNDKVSVRPGEKIPVDGVVVEGSSFIDESM
FT                   LTGEPIPVEKGINDDVVAGTLNKLGSLTFTTTRVGKDTALAHIITMVKRAQNSKPPIGR
FT                   MADVISGYFVPAMMIIAIISAMVWLNFGPEPSMGYAIVSAMTILIIACPCALGLATPMS
FT                   VMVGVGKAAESGVLIRNGEALQTASTITTMILDKTGTITEGAPKITDIIVVNGREQEHV
FT                   LQLAASIEQHSEHPLAQAVVQAAADKGLALFNVEQFTAIAGFGVQAQYQSTQLLFGNEK
FT                   LMREKGIALSDYQQQAQALAAEAKTPMYFAIDGELAAVIAVADPIKADSVAAIARLKNS
FT                   GIKVIMLTGDNHATAAAVAAKVGVDDFFADVLPQDKANKVAELQALGEVVGMTGDGIND
FT                   APALALANVGFAIGTGTDVAIESADITLMRGSLHGLADAIAVSKATLGNIRQNLVGAFI
FT                   YNMAGIPLAAGVLFPVFGVLLNPVVAGAAMAFSSLTVVTNANRLRFFTPQQH"
FT   gene            235801..236151
FT                   /locus_tag="Sfri_0213"
FT   CDS_pept        235801..236151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0213"
FT                   /product="likely secreted protein containing plastocyanin
FT                   domain"
FT                   /note="KEGG: ilo:IL1217 likely secreted protein containing
FT                   plastocyanin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70076"
FT                   /db_xref="GOA:Q089I9"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I9"
FT                   /protein_id="ABI70076.1"
FT                   /translation="MLLINLFCVALIALIVWWFWLYKPKATTHQATNAIVVKDGVYSPA
FT                   RITVPANTATQLTFLRQDKAGCSASLLFPDLDISEELPLDKSVVISLPALAKGEYPFHC
FT                   QMQMYKGVLLVE"
FT   gene            236331..236843
FT                   /locus_tag="Sfri_0214"
FT   CDS_pept        236331..236843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ilo:IL1543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70077"
FT                   /db_xref="GOA:Q089I8"
FT                   /db_xref="InterPro:IPR016917"
FT                   /db_xref="InterPro:IPR022584"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I8"
FT                   /protein_id="ABI70077.1"
FT                   /translation="MIRRLMDYFRLVLFICGVLIGIQVPAFVEQYGQRLEAHQLEAKLS
FT                   LAEFQRDADRFFAGDISKLIRHYQQNNDPVFSAGGESIESIYQRYTSLTEALGRFNQHS
FT                   YSPYQQIALAPQKDIQAEVWQAYSHVILLKPEAIAIGLLLGLLISILCESVLSILYLGC
FT                   RRVFAPR"
FT   sig_peptide     236331..236417
FT                   /locus_tag="Sfri_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.735) with cleavage site probability 0.734 at
FT                   residue 29"
FT   gene            236893..237366
FT                   /locus_tag="Sfri_0215"
FT   CDS_pept        236893..237366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0215"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   son:SO4640 antioxidant, AhpC/Tsa family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70078"
FT                   /db_xref="GOA:Q089I7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I7"
FT                   /protein_id="ABI70078.1"
FT                   /translation="MIATGQSLPKATLSQLTKDGMVNHDVTELFAGKKVVLFAVPGAFT
FT                   PTCSEAHLPGFVVLADEFKAKGVDLIACVSVNDAFVMKAWGEAQNASELMMLADGDASF
FT                   AKALGLEMDTAGFGGVRSQRYAMVIDNGVVTLLNVEEGKSFEVSTAEAVMAAL"
FT   gene            complement(237477..239423)
FT                   /locus_tag="Sfri_0216"
FT   CDS_pept        complement(237477..239423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0216"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: son:SO4635
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70079"
FT                   /db_xref="GOA:Q089I6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I6"
FT                   /protein_id="ABI70079.1"
FT                   /translation="MKISTLSLSASALLLLLAALLAATVLWSNQQRQTSEKLNLDLQHI
FT                   QHTFQYDVRRNIDSYLQTGQSNYLEQARSDITRITDNITQLSSAHPQLDSASLTSLMTQ
FT                   LISDLDTKYRAAGKLAGNPRQLLAFAESEMIDYSRSLHRYAQSAPNDSNTVEQYLALSL
FT                   ELPNLVYQLSQQTQALLIDQDAGANNSLNFSINSLNTWHDDLEKLSLLGIYRTEEVDEF
FT                   ALGDDEPERIETGEAPRAELLSLTQRYSKEVSNTKQMLSDNQQVQTALINATSQVEQQL
FT                   VTLANTQAVTDEQLKIRLQWLLYTMVILIALFSIGYLVLQQRRVVSPLKRLNRAFSMLS
FT                   ESNQREPLPVTSQCETGQIAAHFNRLLQRFEQDDEQQKSNMAQVSNSLSELVAKIGSLS
FT                   TSTQQTQDVVQQTQSQTADLITLANEVNRSSSLVTASAEQTMHDMQASQQEALAVLDAT
FT                   DHTVTKVNQCNHSLTQLSTSVNDAAKIVDVIGNIADQTNLLALNAAIEAARAGEQGRGF
FT                   AVVADEVRNLSQRTQQSLKDIMAIFEQLTRSNTALSHSVNDISEASAQQKGRAQSLLDV
FT                   ALQVQQQAQEMASSASQGSEHAKQQVGHLDEFVIAMDSLMLHAKDAFEQSETIALEVSN
FT                   SVDNIEQHLGIRG"
FT   sig_peptide     complement(239355..239423)
FT                   /locus_tag="Sfri_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.534 at
FT                   residue 23"
FT   gene            complement(239540..240880)
FT                   /locus_tag="Sfri_0217"
FT   CDS_pept        complement(239540..240880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0217"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO4634 osmolarity sensor protein EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70080"
FT                   /db_xref="GOA:Q089I5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I5"
FT                   /protein_id="ABI70080.1"
FT                   /translation="MKLKLKWWQRFLPRSAFSQTVLLIGSLLLINQLVSYWSVAVYFIK
FT                   PSYEQINQLIARQINILFVDGVDVGREHLTMVDALNAKVRDDGMTIYNQKQAQEAGLGQ
FT                   ATYYSFLSEQMSVYLGGEAEVRFSQGEKLDVWIKPPQAPTLWIKVPLTGINESDLSPLT
FT                   LYLLVIGGLSVAGGWLFARRQNRPLKRLQKAAVAVSQGDFPPTLPLSGSTEIVEVTHAF
FT                   NQMAHSMKQLEQDRALLMAGISHDLRTPLTRIRLASEMMVEDDQYLKEGIVTDIEDMDA
FT                   IINQFIAYIRNDREGVREPDQINRLIQEISQQESHREETIELSLADCPDVPMNSVAIKR
FT                   VLSNLVENAFRYGNGWIKISSYHQGNAVCFSVEDNGPGINEAEVEHLFQPFTQGDTARG
FT                   SIGSGLGLAIIKRIIDRHHGKVKLSNRPQGGLKAQVWLPLIDKNLYN"
FT   sig_peptide     complement(240773..240880)
FT                   /locus_tag="Sfri_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.788) with cleavage site probability 0.728 at
FT                   residue 36"
FT   gene            complement(240884..241609)
FT                   /locus_tag="Sfri_0218"
FT   CDS_pept        complement(240884..241609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0218"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4633 transcriptional
FT                   regulatory protein OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70081"
FT                   /db_xref="GOA:Q089I4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I4"
FT                   /protein_id="ABI70081.1"
FT                   /translation="MGQETSKILVVDDDMRLRSLLERYLIEQGFQVRSAANAEQMDRLL
FT                   ERENFHLLVLDLMLPGEDGLSICRRLRQQENPIPIVMLTAKGDEVDRIIGLELGADDYL
FT                   PKPFNPRELLARIKAVMRRQIAEVPGAPAQQEEMIEFGEFSLNLATREMFHGDESIALT
FT                   SGEFAVLKVLVNHPREPLSRDKLMNLARGRDYSALERSIDVQVSRLRRLIEKDAANPRY
FT                   IQTVWGLGYVFVPDGTTRK"
FT   gene            complement(241727..242524)
FT                   /locus_tag="Sfri_0219"
FT   CDS_pept        complement(241727..242524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70082"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I3"
FT                   /protein_id="ABI70082.1"
FT                   /translation="MFTVFKGIKPHIQSLNPVNLILLMLACSVLQANPLHAATQPSTNN
FT                   NIFGDWVINTPERITLLQLNRNSSYLHLELNLTTPQDSVAEWGRLDLQSTDAHFIPSYS
FT                   NNAQQGLVAYQFEHPQLNMMLTSLSLQLALAIDTNADSIADEQHHYNLTTNQSIYGVWH
FT                   QLSTPALSSLVLLDNGYYAMVNINLHQDPQANEHVTHLQWGRFELHQNQLTLEPIFNSH
FT                   PQHTSNLPSDIPSMIYQPSKQQLTLSFNVNKGNLTDHLLLFKR"
FT   sig_peptide     complement(242411..242524)
FT                   /locus_tag="Sfri_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 38"
FT   gene            complement(242736..243647)
FT                   /locus_tag="Sfri_0220"
FT   CDS_pept        complement(242736..243647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0220"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: pha:PSHAa2227 protoheme IX
FT                   farnesyltransferase (heme O synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70083"
FT                   /db_xref="GOA:Q089I2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089I2"
FT                   /protein_id="ABI70083.1"
FT                   /translation="MSAQLTSRLRGYVQVTKPGIIMGNLISVAGGFLLAAQGNVDLTLM
FT                   FATMIGLSLVVASGCAVNNCIDRDIDAKMQRTRNRVTVTGEISVQAVLSFGIGLGIIGF
FT                   AMLAIFTNSLAVLFAAIGYVVYVGVYSLYMKRNSVYGTLVGSFSGAVPPVVGYCAVTGQ
FT                   MDMGAVILLLMFSLWQMPHSYAIAIFRFDDYAAANIPVLPVAQGMTKAKLHIVLYIAVF
FT                   AVVSALLPLAGYTGIAFMAVTFATSLWWLAMALKGYRRDINLQSWARQVFGFSIITITA
FT                   LSVTMALDFQVVAQTPLLTLVP"
FT   gene            complement(243681..244010)
FT                   /locus_tag="Sfri_0221"
FT   CDS_pept        complement(243681..244010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0221"
FT                   /product="cytochrome C oxidase subunit IV"
FT                   /note="PFAM: cytochrome C oxidase subunit IV; KEGG:
FT                   cvi:CV3993 cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70084"
FT                   /db_xref="GOA:Q089I1"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I1"
FT                   /protein_id="ABI70084.1"
FT                   /translation="MSNAHASHGEGDFSASVKSYLVGFVLSVVLTGIPFWSVMTHQFDH
FT                   MTTLWVVVITALVQIVVHLKYFLHLDFSKEGRINTFSFLFTALIIVMVVGLSVWIIYAA
FT                   NELMM"
FT   gene            complement(244010..244645)
FT                   /locus_tag="Sfri_0222"
FT   CDS_pept        complement(244010..244645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0222"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   pha:PSHAa2229 cytochrome o ubiquinol oxidase subunit III
FT                   (ubiquinol oxidase chain C)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70085"
FT                   /db_xref="GOA:Q089I0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q089I0"
FT                   /protein_id="ABI70085.1"
FT                   /translation="MSIAIQADLQVAHSAEHNDQHHDDHHDTSGNTLFGFWIYLMTDCI
FT                   LFASVFATYAVLFMNTDGGVSGKDIFELDFVLIETAALLVSSITYGFAMICARHQKKAA
FT                   TLGWLLITFALGCVFIAMEVYEFHHLIEHGNGPDRSAFLSAFFALVGMHGLHVTAGLIW
FT                   MLIMMVEVLKTGLTNRSITRLSCLSLFWHFLDIVWVCVFTVVYLLGVL"
FT   gene            complement(244645..246627)
FT                   /locus_tag="Sfri_0223"
FT   CDS_pept        complement(244645..246627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0223"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   pha:PSHAa2230 ubiquinol oxidase polypeptide I (cytochrome o
FT                   subunit 1) (oxidase BO(3) subunit 1) (cytochrome o
FT                   ubiquinol oxidase subunit 1) (ubiquinol oxidase chain A)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70086"
FT                   /db_xref="GOA:Q089H9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H9"
FT                   /protein_id="ABI70086.1"
FT                   /translation="MSFLGKLTLESIPYHEPIIMVTLAAVAIIGVIIAALITKHQKWGV
FT                   LWHDWLTSVDHKKLGIMYIVLAMVMLVRGFSDAIMMRTQQALATNGAAGYLPPEHYDQI
FT                   FTAHGVIMIIFMAMPFMIGLMNLVVPLQIGARDVAFPFLNNLSFWLTTSGAVLINISLG
FT                   LGEFAKTGWVAYPPLSELAYSPGVGVDYYIWALQISGIGTTLTGVNFIATVLKMRAPGM
FT                   KLMQMPIFTWACTWANVLIVASFPILTAVLGMLTLDRYLDFHFFTNDGGGNAMMYINLF
FT                   WAWGHPEVYILVLPAFGIFSEVFSTFTSKRLFGYTSMVWATGAISVLGFIVWLHHFFTM
FT                   GSSANVNAFFGVMTMVIAVPTGVKLFNWLFTIYRGRLRFTVPVLWSLGFMVTFTIGGMT
FT                   GVLLALPGADYVLHNSLFLIAHFHNTIIGGAVFGYMAGFAYWFPKAMGFTLNERLGKAS
FT                   FWCWQIGFYVAFMPLYVLGFMGMTRRINQTDNPAWNFWLYFAVVGAFIILVGIILQFVQ
FT                   LYVSFRDREQNLDTTGDPWNGHTLEWSTSSPPQFYNFAQLDPVTDIDAFTDMKEKGTAY
FT                   QRRETYQPIHMPKNTASGIAMAACITAMGFAAIWHIWWLAIVGFAGTFVLFLLRAYDND
FT                   VDYFVQPDEVARIENAHLDNVARGR"
FT   gene            complement(246630..247670)
FT                   /locus_tag="Sfri_0224"
FT   CDS_pept        complement(246630..247670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0224"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase, subunit II; COX aromatic rich domain
FT                   protein; KEGG: pha:PSHAa2231 ubiquinol oxidase polypeptide
FT                   II (cytochrome o subunit 2) (oxidase BO(3) subunit 2)
FT                   (cytochrome o ubiquinol oxidase subunit 2) (ubiquinol
FT                   oxidase chain B)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70087"
FT                   /db_xref="GOA:Q089H8"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H8"
FT                   /protein_id="ABI70087.1"
FT                   /translation="MLIRNLSKPMLAALAFMLAGCEGGVLDPKGQIGIDEKNLIIVATL
FT                   LMLIVVIPVIFMTLYFAWKYRDGRDEEIYAPKWAHSTAIEIVVWVVPIIIVIILGVITW
FT                   NSTHDLDPYKPLEHDAKPVTVEVVSLDWKWLFIYPEYGIASVNELAFPANVPVNFKITS
FT                   DTAMNSFFIPQLGSQIYSMAGMATKLHLIANEPGTFEGISANYSGAGFAGMKFNAIATP
FT                   TAGDFDAWIAKVKQQGNTLDVEQYKQLAEKSENNPVQYYGSVQKGMFNYIVMQYMHPDS
FT                   NMKSMGSMDGMEGMHDMGNMKSMSGMDHTQHMQHMTDMDAEQHSGLSSSTHSTTEHSST
FT                   ASGEAE"
FT   sig_peptide     complement(247599..247670)
FT                   /locus_tag="Sfri_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.869) with cleavage site probability 0.352 at
FT                   residue 24"
FT   gene            complement(247848..248303)
FT                   /locus_tag="Sfri_0225"
FT   CDS_pept        complement(247848..248303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70088"
FT                   /db_xref="GOA:Q089H7"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H7"
FT                   /protein_id="ABI70088.1"
FT                   /translation="MPAGSVDSTTHSFELVWNHFLKFTLCQYLAKPLNSIARLSKLSKA
FT                   HLTLCFGLLLLQPVADSLSMSMGHVVDISEFIAVVDTLLAEVMGASLLGLLILNPLVIE
FT                   QFWRLFNLNSTFCNLLALSYALSALSAVTPKSLEYTAHGCRAPPLQA"
FT   gene            248689..249216
FT                   /locus_tag="Sfri_0226"
FT   CDS_pept        248689..249216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0226"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: ppr:PBPRB1080
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70089"
FT                   /db_xref="GOA:Q089H6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H6"
FT                   /protein_id="ABI70089.1"
FT                   /translation="MVVMLKHQIAASLEQAFSTHGFAEPNVAQLKAACNVSLRTLYKHY
FT                   PSKEAMIVAALEYRHQRYLDFLLNDNPHKGIESVIHIFQMLELWMTESAPHGCLSMNAI
FT                   AAFPDNALISKAVKEHKAEVRHMLGQQSNRDDLATALFILHEGVSSAWPVLGTEAVISA
FT                   QKTLLQFFKQEQ"
FT   gene            249219..250268
FT                   /locus_tag="Sfri_0227"
FT   CDS_pept        249219..250268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0227"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   ppr:PBPRB1079 hypothetical oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70090"
FT                   /db_xref="GOA:Q089H5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H5"
FT                   /protein_id="ABI70090.1"
FT                   /translation="MMIPKTMKGVLLTGHGGPEVLQYRDDIAVPLPSPNEVLIRVHAAG
FT                   VNNTDINTRIAWYSKNDGGDTDASWSGNALVFPRIQGADVCGVIVAVGDNVSAARIGER
FT                   VLIEPCIREANGEALESPWYNGSECDGGFAQYTVIAAKHAYAVNSALSDIELASFPCSY
FT                   STAENMLTRANVTAHDRVLISGASGGVGSAAIQLAKARGAQVIAITSPSKNQQLLDLGA
FT                   DQVILRDVDLVDTLGENSIDVVIDLVAGPQWPQFLQVLTPGGRYAVSGAIGGALVELDI
FT                   RTLYLKDLSFFGCTVLESKVFQNLIHCIEQGKITPIVAQTFPLEAIAQAQDVFLKKKHV
FT                   GKIVLTIPD"
FT   gene            250509..251321
FT                   /locus_tag="Sfri_0228"
FT   CDS_pept        250509..251321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0228"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: vfi:VFA0909
FT                   putative regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70091"
FT                   /db_xref="GOA:Q089H4"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H4"
FT                   /protein_id="ABI70091.1"
FT                   /translation="MQRPPLRQAKTIDNVFNSAYWHLGQQDFTINEIRTKLERKTDNQQ
FT                   WIDTVLARLIEGGYLKSDFDFAVRYCELAFSNEIGIGAIRRKLQLRGVSATEIDTAIEQ
FT                   VMHEQTVDLFELATSRLLSRFENFYGTNIEKVYSQMTTKGFSRAEIDHALAQHPQRETL
FT                   RSKLALKADKADLTTEIIKLFNKGKGKTLILQELKQRLIDVSDFEETLYQLTLTEHVDF
FT                   YQSCKNELAKKRYNLADYKEKSKAYAYLSRKGFGSDEIKEAMTLDDES"
FT   gene            complement(251511..252884)
FT                   /locus_tag="Sfri_0229"
FT   CDS_pept        complement(251511..252884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0229"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: vch:VC1573 fumarate
FT                   hydratase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70092"
FT                   /db_xref="GOA:Q089H3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H3"
FT                   /protein_id="ABI70092.1"
FT                   /translation="MSKMRIEYDSMGKVQVPDDVYYQAQTQRARDNFQFSERRFPTPAI
FT                   LALLDIKSAAAQANSQLGLLDSAMAKAIQQAIIAAKKLHFSQHFPIDLFQTGSGTSSNM
FT                   NVNEVIASLASDILQAKVHPNDHVNMGQSSNDVVPACIHISTVRQLKGLLYPAIKGLND
FT                   RLAFLADEYSNTVKTGRTHLMDAMPITLGQELQCWQQQLNSAQARIQQVELSLHQLPLG
FT                   GTAVGTGVNCDPNFAKLACDDLQQQDKIPWQAAVMPALYMSSQDHTLAMASALKGLAVT
FT                   LLKIANDLRWMNSGPVAGLQEISLTALQPGSSIMPGKVNPVIPEAVAMIAAEVIGNETT
FT                   ITIAAQSGNFQLNVMLPLIADKLLSSIDLLTHACQAMTDKVFAEFQPNVEHLTQALEKN
FT                   PILATALNSVVGYDMAAKIAKRADKEHKSVLAIALEETDLDEEKLKAILDPLHLAKPY"
FT   gene            252977..255703
FT                   /locus_tag="Sfri_0230"
FT   CDS_pept        252977..255703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0230"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: hch:HCH_06874 aconitate
FT                   hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70093"
FT                   /db_xref="GOA:Q089H2"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H2"
FT                   /protein_id="ABI70093.1"
FT                   /translation="MNHSMQLLKQLESNGKTFRYYSFDRLAEHYDLTRLPFAAKILLEN
FT                   LLRYENSDFVQPEDIEILARWDLDNWSETEIAFVPSRVILQDFTGVPSVVDLAAMRDAI
FT                   VTLGGNADAINPLNPVELVIDHSVMVDVFAETGALQKNTAIEIQRNRERYQFLRWGQQA
FT                   FDNFKVVPPGRGIVHQINLEYLARVVFVKEDDDNLLYPDTLVGTDSHTTMINGLGVLGW
FT                   GVGGIEAEAAMLGQPVTMLLPEIVGFEFIGKLPPGVTATDLVLTVTEQLRSFGVVGKFV
FT                   EFFGAGVDQLTLADRATIANMAPEYGATCGIFPIDQQTLDYLKLTGRDPERIALIKAYL
FT                   KQMGMWASASDNKACYHARLQLDLGSIVPSIAGPKRPQDRIALEQAGVSFRQWLDSQIP
FT                   VSHIDAEGKDELASEGGPSVQVPVADGSTGVACRYRDKDFVLEAGAVVIAAITSCTNTS
FT                   NPSVLIAAGLLARNARKKGLQVKPWVKTSFAPGSQVVTDYLIKSGLNVDLDALGFQLVG
FT                   YGCTTCIGNSGPLPQPVSEAIQQGRLKVCSVLSGNRNFDGRIHPEVQANYLASPPLVVA
FT                   YALAGNMKADMVTEALGEDVDGNAVYLKDIWPDNQEIQQVMASAVQSEMFVSRYADVYS
FT                   GDADWQGLEVVQSQKYNWPDSTYVKQPPFFDGISAEVPKIMAIDNARCLLKLGDSVTTD
FT                   HISPAGSIAPDSPAGDYLQQAGVAIKDFNSYGSRRGNHEVMMRGTFANVRLKNLLAPGT
FT                   EGCWTRLMPNCESMTVFDAAMQYQQQGTPCIVLAGKEYGTGSSRDWAAKGPALLGVKAV
FT                   IAQSYERIHRSNLVGMGILPLQFMPDDSAESLNLTGEEQFSIPAVSAEQKTVKVSVTDK
FT                   AGKQHSFEAKIRIDTPNEFSYYRHGGILHYVLRNLAR"
FT   gene            256270..256950
FT                   /locus_tag="Sfri_0231"
FT   CDS_pept        256270..256950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0231"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: tbd:Tbd_2287 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70094"
FT                   /db_xref="GOA:Q089H1"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H1"
FT                   /protein_id="ABI70094.1"
FT                   /translation="MAKNIMEHKRYFLILSVIFGIEFLVISISPHDRADWALENVLVVL
FT                   SAIFIFFTYKKCPLSRLSYSLIFAFMSLHEIGSYYTYSNVPYDAFLTSYFNFSLNECMG
FT                   WTRNNFDRLIHLAYGLLLAYPVRDLYCRIAGLKGFWSYLTPLNLIMATSMLYELIEWGA
FT                   AETFGGELGMAYLGTQGDVWDAHKDMALASLGGFIAMAITLFIHSRIQKDFREQWKLSL
FT                   TVKK"
FT   gene            complement(257187..257966)
FT                   /locus_tag="Sfri_0232"
FT   CDS_pept        complement(257187..257966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0232"
FT                   /product="acetoin reductases"
FT                   /note="TIGRFAM: acetoin reductases; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; KEGG: ilo:IL0792
FT                   acetoin(diacetyl) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70095"
FT                   /db_xref="GOA:Q089H0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q089H0"
FT                   /protein_id="ABI70095.1"
FT                   /translation="MSLQGKVALVTGAGQGIGRAIALRLAKDGANVAIVDLNEEKMLAV
FT                   SLEVEAFGRKSTTFKADVSDREQVYAAINHAEKTLGGFDIMVNNAGIAQVQAISDITQE
FT                   DMDKIQKINVDGTLWGIQAAAKKFIERKQKGKIINASSIAGHNGFALLGAYSATKFAVR
FT                   ALTQAAAQEYASAGITVNAYCPGVVGTDMWVEIDKRFSEITGAAIGETFKKYVKGIALG
FT                   RAQTPVDVANFVSYLAGPDSDYMTGQAPMIDGGMVYR"
FT   gene            complement(258460..259071)
FT                   /locus_tag="Sfri_0233"
FT   CDS_pept        complement(258460..259071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC2320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70096"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR032555"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G9"
FT                   /protein_id="ABI70096.1"
FT                   /translation="MCEVDDGKQEAFSQSQSAWSQLSTCNGFVGQAGGWEASSSTAIIL
FT                   GFWESQFHVSEFMRTIHDDIYLSNKQQSTYRHCSVNYFELVSTISDLQINFSGAGVLRI
FT                   AYCSRVLDIDRFNRDQQLIWNPQLSTQLGCLGGHVWRHVKHHDCYLVVTHWESPEAHEI
FT                   YANNVLPKLREIARPSEYIEQLLGKVVVLDTKWNVTPNNG"
FT   gene            complement(259285..259770)
FT                   /locus_tag="Sfri_0234"
FT   CDS_pept        complement(259285..259770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0234"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: vpa:VP0152 transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70097"
FT                   /db_xref="GOA:Q089G8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G8"
FT                   /protein_id="ABI70097.1"
FT                   /translation="MKTKLITLEGYNKLRIEHDYLWKEQRPEVTKIVTWAAGLGDRSEN
FT                   ADYTFNKRLLRQIDRRVRYLRKLLPELKIVYYAPEQEGKVFFGATVEIENDAGDIKTFK
FT                   IVGPEEIYDERKDYISIDSPMARALLKKQVDDEAVVSTPQGDKTWYINKISYKLEQK"
FT   gene            259984..262356
FT                   /locus_tag="Sfri_0235"
FT   CDS_pept        259984..262356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0235"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG: son:SO4629
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70098"
FT                   /db_xref="GOA:Q089G7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G7"
FT                   /protein_id="ABI70098.1"
FT                   /translation="MHNIAQIIAQELNVREQQVTATIALLDDGATVPFIARYRKEATGG
FT                   LDDTQLRNLFSRLGYLRELHDRRQVVLSSIDAQGKLTPALTQAINDADSKTRLEDLYLP
FT                   FKPKRRTKGQIAIEAGIEPLVDAVLANRQLDIESKATEFINPDAGFADSKAVLDGARFI
FT                   LMERFAEDAELLRKVRQHLLQQAVLESRMVKGKEKEGAKFRDYFEHNELMSKIPSHRAL
FT                   AMLRGRNEGMLSLSMNADPDTQATEGSYCEVIISDHFKLELTNSSVDEWLKTVVTSTWR
FT                   IKVALQMETEFIAKMRESAEEEAIRVFARNLGDLLMAAPAGAKATMGLDPGIRTGVKVA
FT                   IVDNTGKLVAHTTIFPHAPQNLWDKSIRTLSNLVTMHKVEIIAIGNGTGSRETDKLTGE
FT                   LIAAVKETHPTLTKVIVSEAGASVYSASEFAANEFPNLDVSIRGAVSIARRLQDPLAEL
FT                   VKIEPKAIGVGQYQHDVSQSQLSQSLEAVVEDCVNAVGVDLNMASAPLLAQVAGLTKTL
FT                   AKNVVDFRDANGQFTNRKQLLSVARLGPKAYEQAAGFLRIRNGDNPLDSSSVHPEAYSL
FT                   VESIAGAKQLPLTELIGNSDLLKQINAADFVTDAFGVPTINDILAELDKPGRDPRGEFK
FT                   TATFKDGIEELKHLKVEMILEGVVTNVTNFGAFVDVGVHQDGLVHISSLTDKFVSDPHT
FT                   VVKAGDVVKVKVMEVDIERRRIALSMRLDEKIDTEKAIRQSQGKPQNSYQKKPAAGKFS
FT                   VNTKSSGHNKPASKPVKAPQNAAMGNAFADAFAKIKK"
FT   gene            262621..264228
FT                   /locus_tag="Sfri_0236"
FT   CDS_pept        262621..264228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0236"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; protein of unknown function
FT                   DUF1705; KEGG: vfi:VFA0210 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70099"
FT                   /db_xref="GOA:Q089G6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G6"
FT                   /protein_id="ABI70099.1"
FT                   /translation="MTCIIAVYFGLVLNFPIIRKIYQLSADGHVLFSLSPALLLSSCFM
FT                   LIFSLFAFKFVFKPVMIVLLLTSSAAMYAMLQYNVMFDYGMIENIFETNSGEAFSYISL
FT                   PSISYVMVLGVIPSVLLYRTKLSSGPSLAKIVLRRAGFTIFSVVLVGLMVLFFYKDYAS
FT                   VGRNNNYLNKMIIPAHIYNTVKYLNNRYFTEKLTFDPIGQDAQLTPSVNGKPTLMVLVV
FT                   GETARAENMAYNGYQRNTNPYTENLGMIALQNVSSCGTATAHSLPCMFSNLIHDNYNRE
FT                   VADARNNVLDVVKAAGVNVTWFENDGGDKDVGARINKIDISPSEPNPLCDGLSCYDEIL
FT                   VEKLSQKLQQDSQASALSGKGLENQFIALHTIGSHGPTYWQRYPADKALFTPACSRSDI
FT                   ENCSDQEIVNVYDNTIAYTDFVLAETINVLKQYQDKYNVALVYLSDHGESLGESGMYLH
FT                   GTPYSIAPSQQTHVPWFMWLPQDYTQAKDIDRECVAEHALSGSYSHDNLFHTLLGLYGV
FT                   SSSVRDPKLDITTDCKMN"
FT   gene            264239..264682
FT                   /locus_tag="Sfri_0237"
FT   CDS_pept        264239..264682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0237"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="PFAM: diacylglycerol kinase; KEGG: pha:PSHAa2773
FT                   diacylglycerol kinase (DAGK)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70100"
FT                   /db_xref="GOA:Q089G5"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G5"
FT                   /protein_id="ABI70100.1"
FT                   /translation="MTISVSSSTSDDNVTKNTAKNATAKQPKIVVKRHGIMRLLYTCKH
FT                   TFNGLKWMCRNEAAFQQELMLFIPLTVFAYMANISAAQSAMLVLALLFVLFAELVNTAV
FT                   EVVVDRIGLEFHELSGLAKDIASAFVFLSMLMAAIVWWVVLWA"
FT   gene            264859..265533
FT                   /locus_tag="Sfri_0238"
FT   CDS_pept        264859..265533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0238"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: vfi:VFA0211 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70101"
FT                   /db_xref="GOA:Q089G4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G4"
FT                   /protein_id="ABI70101.1"
FT                   /translation="MKVLLIEDSEALRRGIRVGLDHLGYTVDETGDGSEGLSMALTNSY
FT                   DFIILDLMLPNVDGLSLLKSIRKLGNQSKVIILSAKSQAEDRVTGLLAGADDYLSKPFS
FT                   FDELQARLLCLGRRGELNQQVKTICVANFVLDTNNKSLHADGHYIDLTKNEFKIVEYLF
FT                   SNPKQVLNPEQISEAVVGSFNHLSKNTIEAHLSSVRKKAKAVGVTLPIKNKRGFGYFVG
FT                   EH"
FT   gene            265533..266969
FT                   /locus_tag="Sfri_0239"
FT   CDS_pept        265533..266969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0239"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: pha:PSHAa2776 sensor transduction kinase
FT                   (copper resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70102"
FT                   /db_xref="GOA:Q089G3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G3"
FT                   /protein_id="ABI70102.1"
FT                   /translation="MRSLTTNLVNTMTYVVSGMLILVFLAIDISIDNWVDVEFDSALTD
FT                   KSNYLKTLVKVTPEGTEFDFAGEFMPEFGTSTKASFFQLWQGSSVFERSESLRNFEGVD
FT                   LLKKDMPINSAFFADVVLPDGRDGRAMVSYFEPQVPKVDREIIGQVEPMWLTIAITTED
FT                   LSQILVIIDSSLAIGLLLVIVLIRWAVVKVIHRGLTPLNELNVSLKSVDVTKKYIPLSS
FT                   ESERYLEIEPIRNELNKFVKISQQYLQTEKRITADIAHELKTPISELISLSEIYIRYPD
FT                   DQRIGVSYKQDVLSISLRMKTIVNNLLLLQQATSENINLHRQHINIKTVMDQVINELAF
FT                   KYSTIHSRLNIENSVLDPSCLADEFSLHLILTNLFDNALYYSPPKSSIKIRLVADNKGL
FT                   RFSIENQLVTSINANDLERLTLPLFQAEQSRSNSERHGLGLAIVENIAKVNGFEFSFEL
FT                   VSDDKIMFAVLIPNGHAAMV"
FT   gene            267322..269358
FT                   /locus_tag="Sfri_0240"
FT   CDS_pept        267322..269358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0240"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: son:SO4628 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70103"
FT                   /db_xref="GOA:Q089G2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G2"
FT                   /protein_id="ABI70103.1"
FT                   /translation="MAVNFFSLGTNSSEFSTKKTSNNLFQAIVIFSVISLLIMSLSRIG
FT                   LSLWQAERVSDAQGWGYILLQGLRVDFASLCWLWGIAALGTVVFAGEHLVGRVWLMILR
FT                   VWLTLGLWVVVFLEASSPSFIAEYGFRPNRLYVEYLVYPKEVLSMLWAGRKGELILSAL
FT                   ITVGTLWGGWWLSGKLTQYIRFPKWYWRPVLAVIVIAITVLGARSSLGHRPLNPSLVAF
FT                   SDDPLVNSLVLNSSFSLIFAIKQMSNEEDASKVYGKLADEKVIDIVRRESGRPLSAFTS
FT                   STIPTLSFNQASYTGKPKNLVIILQESLGARFVGSLGGLPLTPNIDELSQQGWFFENLY
FT                   ATGTRSVRGIEAVTTGFTPTPARAVVKLGKSQTGFFTIADLLKQHGYTTQFIYGGESHF
FT                   DNMRSFFLGNGFTDIVDQGDYKDPAFVASWGVSDEDLLFRADEEFSRMHKEGKPFFSLV
FT                   FSSSNHDPYEFPDDRIELYEQPQYTMHNAVKYADYAVGEFFKKAKKSDYWKDTLFLIVA
FT                   DHDSRVGGAALVPVSRFRIPGLILGDGIDAKRDPRVVSQIDMSPTLISLLGISDSYPML
FT                   GRDLTKMPDSWPGRAMMQYDKNFGLLEGDKMTILQPELPPESVTYDFVTEKLTPTTLNE
FT                   PQAEAALGWALWGSLAYNKMLYRTANSEAKPTLSDMATTEVSR"
FT   gene            complement(269350..269856)
FT                   /locus_tag="Sfri_0241"
FT   CDS_pept        complement(269350..269856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70104"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G1"
FT                   /protein_id="ABI70104.1"
FT                   /translation="MIITTHYPQIPLATSNVATDLARVDNQQKPPIIPPQEPTKEHAER
FT                   PLNQQNERATPYTVAEKKQQQEQAKRQQQSATQQAVESKAIASPVIRPQVIRIMASQTP
FT                   ALQRKDIQLKTQSTNAKTTPEPRQRQALDTGVSKASYQQFGQRIGQFYQQQSAPNNESQ
FT                   LKILA"
FT   gene            complement(269934..270740)
FT                   /locus_tag="Sfri_0242"
FT   CDS_pept        complement(269934..270740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0242"
FT                   /product="bioH protein"
FT                   /note="TIGRFAM: bioH protein; PFAM: alpha/beta hydrolase
FT                   fold; KEGG: son:SO4626 bioH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70105"
FT                   /db_xref="GOA:Q089G0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q089G0"
FT                   /protein_id="ABI70105.1"
FT                   /translation="MSFPALHIDTVGSQGQDIVLLHGWGVNNQVFSPLKNALHQYRVHY
FT                   VDLPGFGLSPNIDGGITQWSQALAEQLPQQAIWIGWSLGGLIASQIAIDYPESVAALVT
FT                   IASSPCFMARESVMTSGIDDISPAWPGIQPDVLAQFSSQLSRDLSRTVERFLAIQAMGS
FT                   DNPKADIQQIKSLVLSKPLPTQQGLSQGLDMLAQVDLRATITQIQRPWLRIWGKLDSLV
FT                   PRKIISSLPSSDNIEDVLLHKASHAPFISHPDAFLDHLLPWITKYR"
FT   gene            270784..271590
FT                   /locus_tag="Sfri_0243"
FT   CDS_pept        270784..271590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0243"
FT                   /product="competence protein ComF"
FT                   /note="KEGG: son:SO4625 competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70106"
FT                   /db_xref="GOA:Q089F9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q089F9"
FT                   /protein_id="ABI70106.1"
FT                   /translation="MPPINISIDITHILGLCLKRIQHARVILLGSLPNRCLLCQQRIDQ
FT                   TGYQQLFPNQVLTGVCQVCLAASLYQHEVCLGCGREIALLQAYCGKCLKQEPNYVVAPC
FT                   SYHQGLGPVIAAIKYQQQCAPLNAITQQLACRIALLIKHGIIRRPQVLIPVPLHPNRLR
FT                   QRGFNQAWLIAKELSLLTNIPLDDRCLIRIVDTLPQTGLAGKQRRKNCHGAFALQPNMT
FT                   YQRVALIDDVVTTGTTVDEIAGLFSLQFIHVQTWCLARAEAPGLLD"
FT   gene            271862..272440
FT                   /locus_tag="Sfri_0244"
FT   CDS_pept        271862..272440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0244"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; nitrogen-fixing
FT                   NifU domain protein; KEGG: son:SO4619 YhgI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70107"
FT                   /db_xref="GOA:Q089F8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089F8"
FT                   /protein_id="ABI70107.1"
FT                   /translation="MITISDTAQAHFVKLLADQPEGTHIRVFVISPGTAQAECGVSYCP
FT                   PDAAEADDVELPFNGFSAMVDEKSAPFLDDASIDFVTDQLGSQLTLKAPNAKMRKVSGD
FT                   APLVERIEYIIQSEINPQLASHGGNIMLVEITEAGVAVLQFGGGCNGCSQVDITLKDGI
FT                   EKQLLDMFPTELTGVRDVTEHEHGEHSYA"
FT   gene            complement(272549..272878)
FT                   /locus_tag="Sfri_0245"
FT   CDS_pept        complement(272549..272878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0245"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   cvi:CV0705 probable FkbP-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70108"
FT                   /db_xref="GOA:Q089F7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q089F7"
FT                   /protein_id="ABI70108.1"
FT                   /translation="MTQELIITDIEVGNGKTAVKGALITTRYSGRLADGSQFDASDAFQ
FT                   CVIGTGRVIKGWDQGIIGMNVGGKRQLSVPAHLAYGERQIGERIPAHSDLFFDIELLEV
FT                   LTRDD"
FT   gene            complement(272915..274849)
FT                   /locus_tag="Sfri_0246"
FT   CDS_pept        complement(272915..274849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0246"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S15; peptidase S9, prolyl
FT                   oligopeptidase active site domain protein;
FT                   phospholipase/Carboxylesterase; KEGG: son:SO4618 prolyl
FT                   oligopeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70109"
FT                   /db_xref="GOA:Q089F6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q089F6"
FT                   /protein_id="ABI70109.1"
FT                   /translation="MKRILWLVVISLCLFSLSSFAKPLPIEAFASIPDVRFVSLSPDGK
FT                   KIASLVRVSTNELEGQVLTIRDIQTNKDIYPLQTDNQKFVILSLTWANNDVILIESKYP
FT                   AIRRGVPTTETRLIKYSLSDNKTSSVFSNRSLSRFVDLPQLQASVIDYLDTDPNHILMQ
FT                   IQGLGSKPQYESVVKVSLKTGGIKTLQPARMHIGNWLTDRQHNVRIGIYRDDTTYRIYE
FT                   QKGAGEDLRKLWEFEALAEDVIWPIGFDHDPNILYISAYHQGFKAIFKVNLTDPTLTKE
FT                   LVSHNENYDIEGWLVYSALKQKVIGLSTDIEGEYLFWDQDYIKLNNGLTTALPESHNVI
FT                   TQFSDDERRYIVYATGPIESGAYYFGNRDQKALYPIAYRYSQLPPEVLSQPQTVHYNAR
FT                   DGLAIEAFLTTPKDIDAKNLPTIIFPHGGPISYDSTTFDYWAQFLANRGYAVLQMNFRG
FT                   SSGYGFNFMSSGLKNWGLEMQTDIEDGTHWLIEQGISDPKRVCIVGASYGGYAALMGVA
FT                   ITPDLYQCAISVAGVTDLEYLVKSSRRYDNSKIVKKQIGDDYDDLYQRSPISKVANINV
FT                   PVLLIHGTKDRVVRVQHSEEMYDALKDLHKPVKYIELENGDHYLSNNEHRLTTFIAIEH
FT                   FLATNLGVK"
FT   sig_peptide     complement(274784..274849)
FT                   /locus_tag="Sfri_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(274921..276264)
FT                   /locus_tag="Sfri_0247"
FT   CDS_pept        complement(274921..276264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0247"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: son:SO4617
FT                   DNA-damage-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70110"
FT                   /db_xref="GOA:Q089F5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q089F5"
FT                   /protein_id="ABI70110.1"
FT                   /translation="MSISALLLNRQKNRQLLALATPMILSNITIPLLGLVDTAVIGHLG
FT                   QAYYLGGVALGSTIITLMIWLLGFLRMSTTGLVAQAYGANDTSTQQQLLIQGCSLALTL
FT                   GVACVILHSPILDLALSLSDASEQVMFYCRQYVEIRIWSLPFALVNLVLLGWLLGRQAP
FT                   KAAMWQLIIANSANIILDIVFVIIFKWNVQGAALASVIADISAFSVALIMVKRQLVHTG
FT                   GLNLSQVIAHLSWRGYARLLTLNRDIFIRSLCLQAAFSFMTFYGAGLGDNTIAANAVLL
FT                   NLLMLISYALDGIAYYAEAEVGRAFGQKNPTLLHDSVVLAFCWSAMVAVLFSLLFWSVG
FT                   PWIIQLLTNIEAVQNTANIYLIWLIFMPILAFGCYLFDGVYIGAAHGSIMRNSMIIATF
FT                   GVYFPSWYLLQDWGNHSLWAAMSIFMLCRSVTLGWHYYYKLRYQLAAA"
FT   gene            276279..277337
FT                   /locus_tag="Sfri_0248"
FT   CDS_pept        276279..277337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0248"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: son:SO4616
FT                   polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70111"
FT                   /db_xref="GOA:Q089F4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q089F4"
FT                   /protein_id="ABI70111.1"
FT                   /translation="MVKKIALLLAVFSLSVLHFDANAVVILQYHHVSDDTPKSTSVTPS
FT                   QFSEQMQYLADNDFTVISLAEAVDSIKHNTPIADRRIVITFDDGYDSIINNAAPILASH
FT                   QFPYTVFISVAPIDAGFKGMMSWKDITALSDQGVTIANHSWGHEHLIRRQGKETQAQWQ
FT                   ARVEDNILSTEAEILKRTGQSVKMFAYPYGEYTNKLEAILAKQGFVGFGQQSGAAGEYA
FT                   SLTALPRFPVANAYADLASLTVKFSSLPMPVIKQNISDPLLVSGKWRPKLELTLDTQDI
FT                   YPHQVMCFIQGQGPKKPIWLSENRLSIQASSDLAPGRSRYNCTAPSKTKTGYYWFSQAW
FT                   IRPQDNGQWLEE"
FT   sig_peptide     276279..276350
FT                   /locus_tag="Sfri_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.984 at
FT                   residue 24"
FT   gene            complement(277356..277970)
FT                   /locus_tag="Sfri_0249"
FT   CDS_pept        complement(277356..277970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0249"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   son:SO4615 SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70112"
FT                   /db_xref="GOA:Q089F3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q089F3"
FT                   /protein_id="ABI70112.1"
FT                   /translation="MIAVGLMLLALVGGVVYQQTQTEPMPLETSYVFEQQRPLAPFTLA
FT                   DQYGNAFTNQTVQGKWSLFFIGYTACPDVCPTTLNKLAAAYPQLQKIASNVQVVFVSAD
FT                   PKRDTQAKRLDYINFFNKDFKAVSAEHTDLFPFSRDLGFVYAMVGEDSDYQVDHSASYV
FT                   LVSPRGEKIAVFKPKPQPGQLAQILNAELISDFSQIVQSWR"
FT   sig_peptide     complement(277914..277970)
FT                   /locus_tag="Sfri_0249"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.870) with cleavage site probability 0.692 at
FT                   residue 19"
FT   gene            complement(277998..278909)
FT                   /locus_tag="Sfri_0250"
FT   CDS_pept        complement(277998..278909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0250"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: son:SO4614 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70113"
FT                   /db_xref="GOA:Q089F2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089F2"
FT                   /protein_id="ABI70113.1"
FT                   /translation="MTKPLTISQVQPKITLQWRAYFEMTKPKVVALMLLTVLVGMCLSV
FT                   PGIVPLQPLVAGMAGIAMMAGSAAAFNHLIDRKIDGLMARTYNRPLPKGKISTTKAVTF
FT                   AVSLGSLGFVVLYTLVNPLTAWLTFASLIGYALVYTAYLKRATSQNIVIGGLAGAMPPL
FT                   LGWTAITNELHGYALLLVIIIFTWTPPHFWALAIHRRKEYAKVDIPMLPVTHGVEFTKT
FT                   CILLYTILLAIACLLPVLVGMCGPIYLVGSTVLSCGFIYKAWQLKFHDYPELSMQVFKF
FT                   SIYHLMVLFIVLLVDHYFWVNA"
FT   gene            complement(278923..279903)
FT                   /locus_tag="Sfri_0251"
FT   CDS_pept        complement(278923..279903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0251"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG: son:SO4613
FT                   cytochrome oxidase assembly protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70114"
FT                   /db_xref="GOA:Q089F1"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q089F1"
FT                   /protein_id="ABI70114.1"
FT                   /translation="MAIQRLIKFTLVFTLAVILMGAYTRLSDAGLGCPDWPGCYGHLAV
FT                   PSASHDLANIESRFPDAQIEPEKAWLEMIHRYIAGTLGLMVLAILIMCLKQPQAPKKLP
FT                   VFIAVLIVFQAALGMWTVTMKLMPVVVMAHLIGGFSLFALLLLLYLRLKPLRIPGGDTY
FT                   ARKLIPLALASLGVLVIQIILGGWTSSNYAALACTTLPICEGNWVDNLRFADAFSPFQG
FT                   DHPSFEFGVLDYATRMTIHVSHRIWAVVTAITLIVLALKLRYAQSHIMRNSGYLLLLLV
FT                   IAQVGLGISNVVMNLPLGIAVSHNGGAALLLLTLVFINYALWRKA"
FT   sig_peptide     complement(279814..279903)
FT                   /locus_tag="Sfri_0251"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.809) with cleavage site probability 0.393 at
FT                   residue 30"
FT   gene            complement(279903..280454)
FT                   /locus_tag="Sfri_0252"
FT   CDS_pept        complement(279903..280454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70115"
FT                   /db_xref="UniProtKB/TrEMBL:Q089F0"
FT                   /protein_id="ABI70115.1"
FT                   /translation="MNSLPKKSNKALLVLLLVFILPVALAKLVLSLELYNGAATNKGAL
FT                   IAPDINYANLAMENPKPHAWQVLFFLPETCNEQCQERLYILHQSYIALGKDRDRVTPII
FT                   VVNSHSDTKILKQLNISFDQANANDALAALLTNQQLIIVDPLGSLVMQYDNVIGHDANI
FT                   AQGKAMIADLRKMLKLSRVG"
FT   sig_peptide     complement(280374..280454)
FT                   /locus_tag="Sfri_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            complement(280512..281339)
FT                   /locus_tag="Sfri_0253"
FT   CDS_pept        complement(280512..281339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70116"
FT                   /db_xref="GOA:Q089E9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q089E9"
FT                   /protein_id="ABI70116.1"
FT                   /translation="MNTSNETKTNLTMKGVVTGNPFKSVGVSRVLFVIITLVVFSLLVK
FT                   LGLWQLSRATFKQEWQSTLIQRQQQQALTYDEMLAIVETSEASTSSQPETRLLTGYRLK
FT                   ISAKPVNNMMMLLDNQVYQGQVGYLAYQIFEITPEQPWIMVELGFVPANKDRRILPELT
FT                   PLKTNYYTLVGRVYQKQPNPLSDRLDAEQLADAHTPVRFQNINIPALTDMFGHTLTSVV
FT                   LQPDNVPNYHLPQPWIPIPLSAQKHQGYALQWFTMAAVFLGLMSWIAFRQFRR"
FT   gene            281326..281505
FT                   /locus_tag="Sfri_0254"
FT   CDS_pept        281326..281505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70117"
FT                   /db_xref="GOA:Q089E8"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q089E8"
FT                   /protein_id="ABI70117.1"
FT                   /translation="MLVFILFNLGRALFIMVKGEHQQSMSRFLGRRVLFSVVVIMVLLV
FT                   ALGLGYIQPNPRPY"
FT   gene            complement(281522..282397)
FT                   /locus_tag="Sfri_0255"
FT   CDS_pept        complement(281522..282397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0255"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   son:SO4609 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70118"
FT                   /db_xref="GOA:Q089E7"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q089E7"
FT                   /protein_id="ABI70118.1"
FT                   /translation="MTTKYQTYYVPAQSAWPIIGAIGLFLIAFGAGNYVQQLTTEKTSG
FT                   GYILITGLAVIIFMIFGWFKTVIDESMAGLYSPQMDRSFRQGMSWFIFSEIMFFGAFFG
FT                   ALFYARMISVPWLGGASNNAMTHEVLWPAFEAMWPLVKTPDGTATEAMPWTGLPLINTI
FT                   ILLTSSVTLHFAHTNLEKANRKPLIIWLALTVILGIAFLCLQVEEYSHAYQEMGLTLSS
FT                   GVYGNTFFLLTGFHGMHVTIGTLFLIILLLRIVKGHFTHDKHFAFQAGSWYWHFVDVVW
FT                   LCLFIFVYVL"
FT   gene            complement(282394..282957)
FT                   /locus_tag="Sfri_0256"
FT   CDS_pept        complement(282394..282957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0256"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: son:SO4608 cytochrome c oxidase assembly
FT                   protein coxG"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70119"
FT                   /db_xref="GOA:Q089E6"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q089E6"
FT                   /protein_id="ABI70119.1"
FT                   /translation="MTQPTKSNRKLLIILIAGSIGMFGFGFALVPLYDVLCDTLGINGK
FT                   TQNSASSYEAVVVDKNRTVTIEFVTQVQSGMPWEFSPKVNQISVHPGELTHAQFLVKNL
FT                   STRDTVGQAIPSVSPGQGAAYFNKTECFCFNQQPLAAAATAELPLIFYVDPDLPASINT
FT                   LTLSYTLYDITDRQAIVIEQGASK"
FT   sig_peptide     complement(282871..282957)
FT                   /locus_tag="Sfri_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.980 at
FT                   residue 29"
FT   gene            complement(282959..284554)
FT                   /locus_tag="Sfri_0257"
FT   CDS_pept        complement(282959..284554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0257"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   son:SO4607 cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70120"
FT                   /db_xref="GOA:Q089E5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q089E5"
FT                   /protein_id="ABI70120.1"
FT                   /translation="MSTTTHDTLATAHDDHHHGAPKGLMRWLLTTNHKDIGSLYLWFSF
FT                   IMFLTGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAFTGLANWLIP
FT                   MMIGAPDMALPRMNNWSFWILPFAFAMLLGSLFMEGGGPNFGWTFYAPLSTTYSPDSTA
FT                   LFVFSIHIMGISSIMGAINVIVTIVNLRAPGMTWMKLPLFVWTWLITAFLLIAVMPVLA
FT                   GAVTMVLTDKFFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAIVPTFS
FT                   RKKLFGYSSMVYATASIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIAIPTGVKVFN
FT                   WVATMWRGSMTFETPMLFAVAFIILFTIGGFSGLMLAITPADFQYHDTYFVVAHFHYVL
FT                   VTGAIFSIMAAAYYWLPKWTGHMYNETLGKWHFWCSVISVNVLFFPMHFLGLAGMPRRI
FT                   PDYAVQFADVNQIVSIGGFAFGLSQLIFLVVVLKCIKGGKPAGDNPWEAAEGLEWSIAS
FT                   PAPYHSFTTPPEIK"
FT   gene            complement(284564..286150)
FT                   /locus_tag="Sfri_0258"
FT   CDS_pept        complement(284564..286150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0258"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="PFAM: cytochrome c oxidase, subunit II; cytochrome
FT                   c, class I; cytochrome C oxidase subunit II, transmembrane
FT                   region; KEGG: son:SO4606 cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70121"
FT                   /db_xref="GOA:Q089E4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q089E4"
FT                   /protein_id="ABI70121.1"
FT                   /translation="MKQWLYCLLVVFVALPLGATEMPLNMTQGVTDISGKVYDLHMTIL
FT                   YICCVIGLVVFGIMIYSMIYHRKSKGAVAANFHESTKVEIAWTVIPFIILIGMAIPATK
FT                   TLIAMEDPSDADLTIKITGSQWKWHYSYFDKDIEFYSTLSTPRAQIDGSEAKGEHYLLE
FT                   VDKPLVLPINQKVRFLMTSDDVIHSWWVPAFAVKKDANPGFINESWTRIDKPGIYRGQC
FT                   AELCGKDHGFMPIVVQALSEADFDNWLVEQKQLASNAAAAAAASMSKTLSLEELTSQGE
FT                   QIYIARCAACHQPNGAGLPGVFPSLIGSPIIKGPVEDHLNIVLNGKPGTAMQAFAKQLS
FT                   AQEIAAVITFERNAWGNNSGDVVQAVDIGNFLGSNEASTEPSKAVTDAASTIAATATDI
FT                   TDAVTDKANQVVEAVAETVVPEDLPTLTLEQLIAEGEQVYATTCAACHQATGAGLPGAF
FT                   PSLIGSPVVTGPVSGHIDIVMHGKPGTAMQAFSGQLSPRKMAAVITYERNAWGNNSGEA
FT                   VQPADVASHGQ"
FT   sig_peptide     complement(286091..286150)
FT                   /locus_tag="Sfri_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.956) with cleavage site probability 0.762 at
FT                   residue 20"
FT   gene            complement(286546..287052)
FT                   /locus_tag="Sfri_0259"
FT   CDS_pept        complement(286546..287052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70122"
FT                   /db_xref="GOA:Q089E3"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q089E3"
FT                   /protein_id="ABI70122.1"
FT                   /translation="MNKLMGIAPRHPGLWVDLTETELHSTQTIQTLQTVTQGEAELSQL
FT                   CSQLAILSQQGRWIVLISPPHIGYKHMLASAGVRMDRILLVHTKDEVETLWAMEKALTS
FT                   GTSSAVVTWTSSLDARDSRRLEIVAKSARALGVVIEDVNAHLPHKHQLVSPTLTNGTSN
FT                   FCSFH"
FT   gene            complement(287049..287663)
FT                   /locus_tag="Sfri_0260"
FT   CDS_pept        complement(287049..287663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0260"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /note="KEGG: son:SO4603 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: peptidase S24, S26A and S26B; LexA
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70123"
FT                   /db_xref="GOA:Q089E2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089E2"
FT                   /protein_id="ABI70123.1"
FT                   /translation="MRPLTPRQAEILDLIKNNIAETGMPPTRAEIANRLGFKSANAAEE
FT                   HLKALAKKGFIEIMPGTSRGIRLPQEEQVETGLPLIGQVAAGEPILAQEHVEQYYQVDP
FT                   NMFKPAADFLLRVRGDSMKNIGILEGDLLAVHKMQQARNGQVVVARVDDDVTVKRFEQK
FT                   GNVIYLHAENEDYNPIKVDLSCQSLTIEGLAVGVIRNGDWL"
FT   gene            287928..290351
FT                   /locus_tag="Sfri_0261"
FT   CDS_pept        287928..290351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0261"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   son:SO4602 glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70124"
FT                   /db_xref="GOA:Q089E1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089E1"
FT                   /protein_id="ABI70124.1"
FT                   /translation="MSKPDSIFLRALRWIQKWMVQTIVVPHDPFDDLNIDPTKPLVYLM
FT                   KTESISDIAALSEITEGFGLPSPYEPLQLDGLTVPRVVCLEGRKPLFGKRESGDKFLNY
FT                   FTSLLSLHSESPELDIQLVPVCLYWGRTPGKEEDSMKAAVFERENPTWLRKWLMILFLG
FT                   RHNFVQFSNALSLRHMADEHGTDKRIAHKLTRVARVHFRRQRKVMTGPQLPNRQALFAS
FT                   LLKSESIKKAIEEESANKKVTVEKARETAIEYLDEIAADYSDSLVRIAERFLTWLWNKL
FT                   YSGINIKGAEQVRQLHHDGHEIVYVPCHRSHMDYLLLSYILYYQGMVPPHIAAGINLNF
FT                   WPAGPMFRRGGAFFIRRSFNGNKLYTAVFREYLDQLFAKGYAVEYFTEGGRSRTGRLLA
FT                   PKTGMLAMTINSVLRGIERPVTLVPVYLGYDHVMEVATYHKELSGKKKKKESVWQVFGA
FT                   IRKLGNFGQGYVNFGEPINLQQFLNQQAPEWRDELAKDPDQKPSWFTPSVNLLANRVMT
FT                   NINGAAAASSVTLTSLVLLASEQNALERSQLERQLDLYLALLKTVPYTEYASVAEGNGK
FT                   SIVDHCLSLNKFVSTKDLIGEIISVDEKIAITMSYYRNNIIHLMALPSLIASCLVHYDV
FT                   CDRQRIHAIVMDFYPLLKAELFMSIDDVPKHVDCILDFMVEQGLLTGSDQFEITPRHIT
FT                   QVLLLAETISETLQRYAIIFNLLAIKPDLERSELERDSHLLAQRLGALHGITAPEFYDK
FT                   KLYNTLSVKLKELGYLCSDEHRAEVIRIRDNANKLLSSLVRQTIVDSVEAEHGQ"
FT   gene            290351..291607
FT                   /locus_tag="Sfri_0262"
FT   CDS_pept        290351..291607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0262"
FT                   /product="aromatic amino acid transporter"
FT                   /note="TIGRFAM: aromatic amino acid transporter; PFAM:
FT                   aromatic amino acid permease; Amino acid transporter,
FT                   transmembrane; KEGG: son:SO4601 tryptophan-specific
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70125"
FT                   /db_xref="GOA:Q089E0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:Q089E0"
FT                   /protein_id="ABI70125.1"
FT                   /translation="MANHMNAAKHRTSGKSVLGGAMIIAGTTVGAGMFSLPVVGAGMWF
FT                   GYSIAMLLGVWFCMLMSGLLLLEANLHFEPGDSFDTLTRVTLGQFWRVINGVSIAFVLY
FT                   ILTYAYISGGGSIVNHSLSALGVSLPQSVAGLVFAVVLALVVFISTKAVDRITTIMLGG
FT                   MVITFFLAIGNLLIDIDTIKLVSPDGESRYLPYLLAAIPFGLASFGYHGNVPSLVKYYG
FT                   KDAKTIVKAIITGTTIALVIYICWLVATMGNIQRSQFADIIAQGGNIGVLVGALSGVIA
FT                   SQWLDNMLTLFANLAVASSFLGVTLGLFDYLADLFGFDDSRSGRIKTAAVTFVPPTILG
FT                   LLFPNGFILAIGFAALAATIWAVIVPALLAYKVRQQYPDSKGFKVPGGTPLIAIVVLFG
FT                   VITATCHLLAMADILPVFK"
FT   sig_peptide     290351..290473
FT                   /locus_tag="Sfri_0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.942 at
FT                   residue 41"
FT   gene            291753..292529
FT                   /locus_tag="Sfri_0263"
FT   CDS_pept        291753..292529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0263"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: son:SO4600 antigen, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70126"
FT                   /db_xref="GOA:Q089D9"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D9"
FT                   /protein_id="ABI70126.1"
FT                   /translation="MKVQQYQQGQPCWIELATHDWAAGKAFYQALFGWGADDMPMPEGH
FT                   YTMLQIDGDDIAAMYPMPAEMEALPTHWTIYFAVDDVDATSKAVTQAGGEIIAGPHSVG
FT                   DAGRMALCTDPEGCRFALWQGQDHIGIKRSQESNTLCWVELACRDTAAAKQFYSQVLGY
FT                   QTQLNDVADFEYTEWYADEQAIGGMMAMTAEWGDTPAHWMSYFAVDDCDVSVTKAQTLG
FT                   ATVCVPATDIPNVGRFSVLNDPQGGVFSIIALFAAQ"
FT   gene            292779..293042
FT                   /locus_tag="Sfri_0264"
FT   CDS_pept        292779..293042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70127"
FT                   /db_xref="GOA:Q089D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D8"
FT                   /protein_id="ABI70127.1"
FT                   /translation="MTQENTQITLASIHRNMLLVALIDFPGTILFGLGLYGILVGFDQD
FT                   FLPMLANPLIIIIMLIIGAIIMLWGIIRMMLLARQKQGILQQ"
FT   gene            293039..293305
FT                   /locus_tag="Sfri_0265"
FT   CDS_pept        293039..293305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70128"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D7"
FT                   /protein_id="ABI70128.1"
FT                   /translation="MKKWIIQLSLLSSLVILTGCRGTDIINIGNNIGNADDNKNDTDYM
FT                   ILNVPRAILASDPCKYGHPDDIAACRKKKQDEADQLNESLKRK"
FT   sig_peptide     293039..293107
FT                   /locus_tag="Sfri_0265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.666) with cleavage site probability 0.492 at
FT                   residue 23"
FT   gene            complement(293402..296545)
FT                   /locus_tag="Sfri_0266"
FT   CDS_pept        complement(293402..296545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0266"
FT                   /product="heavy metal efflux pump, CzcA family protein"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: son:SOA0153 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70129"
FT                   /db_xref="GOA:Q089D6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D6"
FT                   /protein_id="ABI70129.1"
FT                   /translation="MLAKIISASIKQRVMVLILTAVIALVGYQAMRMTPLDALPDLSDV
FT                   QVIVKTSYPGQAPQLVEDQITYPLSSAMLAVPGAKTVRGFSMFGDSFVYVIFEDGTDIY
FT                   WARSRVLEYLSQTQDQLPDGVTPSIGPDASGVGWIFQYALVDRNGQYDLAQLRSLQDWF
FT                   LKLELQSVAGVSEVATVGGMEQTYQVVVDPHKLALYKIDLMTIKNALDNSNSSTGGSVI
FT                   EMAEAEYMITSSGYRQTIADFAEVPLGILSETGTPVLMKDVAQLRTGPAARRGIAELDG
FT                   KGEVVGGIVVMRYGENALETINNVKQKLKEISNGLPDGVELVTTYDRSELILRSVDNLK
FT                   HKVLEEMLVVGLICLLFLLHARSTLVAIITLPISILVSFIAMNIIGVNANIMSLGGIAI
FT                   AIGAVVDASIVMVENTHKHLEHYRQKHGKAPEGDDHWQLVKEASIEVGPALFFSLLIIT
FT                   LSFTPVFALEAQEGRLFHPLAFTKTFAMAASAILAITLIPVLMGYFVRGKIPDERKNPI
FT                   SRVLIAIYQPLLKWVLHFPKITIGLAIIVLFSAYYPLSQMGSEFMPTLEEGDLLYMPTT
FT                   LPSVSAGKAAEILQQTDRLIKTVPEVKRVFGKVGRAMTATDPAPLTMLETTIMLKPPGE
FT                   WREGVTLESIIAELQKTVRIPGMTNAWVQPIKTRIDMLSTGVRTPVGIKISGANVEELQ
FT                   RIGAEIEAVVNQLPGTESAFSQRSSGGRYIDITPDLKNAARYGMTLKDIQDVVKIAIGG
FT                   MTIGESIQGQERYPINIRYPRELRDNIEKLRNLPVLTKTGKYLPLSYLAELKITDGAPM
FT                   LASENGRLISWVFVDLKDISIGEYIVAAEKALKQQITLPPRYNYSFAGQYEYMQRVDAK
FT                   MKMVIPLMIAVIFMLLMMTFNSVIQASVIMLSLPFSLVGSAWLLYGLDFNFSVAVSVGM
FT                   IALAGVAAEFGVVMQVYLNNSIKAYKEADNYHSKADLTAALIEGAVMRIRPKAMTVATI
FT                   FFGLLPIMWGSGTGNEVMQKIAAPMVGGMVTAPLLSLFVIPAIYLLIYGRKLPKQSLS"
FT   gene            complement(296557..298065)
FT                   /locus_tag="Sfri_0267"
FT   CDS_pept        complement(296557..298065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0267"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: son:SOA0154 heavy metal efflux protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70130"
FT                   /db_xref="GOA:Q089D5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D5"
FT                   /protein_id="ABI70130.1"
FT                   /translation="MKKFPLSSVLLGAFVGVMIPAAFTSPVAYGAEHDHAQHQSQASKT
FT                   YTCPMHPEVISDKEGTCPICNMFLVVKEEEEESTIDDTQDPMANMQSATPVKQSQADKV
FT                   FSQPKPTLVPAANQSDSTNVKYVCPMHPHVVSDAPGTCPICGMNLEKVTVTDASQEIVV
FT                   GVSGGMQQALGMRSHVVEKTSLSRQVNTIGTVQYNENAIGHVHTRATGWIETLTVHNVG
FT                   QQIKKGQLLYELYSPELVNAQDDYSQAQDYLLQDKKRGSSLLLKARKRLELLGVDTSII
FT                   DRLEKTGETIFKVPFYAPQDGFISKLTVRHGMYIQPGDTLFEIVNLDSVWVIADVFENE
FT                   QSWLQQGRKVSVSAAAQGLFDIDSTIDYIYPELDPVTRAMRVRIKLNNHNDKLRPGSLV
FT                   DVTLFGLPKDNVLTVPTEALILTGRENRVVVQRSDTSFASVPVKIGMMADGRAEILEGL
FT                   NEHDKVVISGQFLLDSEASIQGSLQRLSNAPTTKESTTTDAHQH"
FT   sig_peptide     complement(297973..298065)
FT                   /locus_tag="Sfri_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.678 at
FT                   residue 31"
FT   gene            complement(298161..298478)
FT                   /locus_tag="Sfri_0268"
FT   CDS_pept        complement(298161..298478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO4597 heavy metal efflux system protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70131"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D4"
FT                   /protein_id="ABI70131.1"
FT                   /translation="MKKFPFFNVLLSAFVGVIIPAALTSTVAYGAEHDHAQHQSQATKT
FT                   YTCPMHPEVISDKEGRCPICNMFLVVKDDQQESSAGDTQHPMANMHGAIPKEPSLADKF
FT                   N"
FT   sig_peptide     complement(298386..298478)
FT                   /locus_tag="Sfri_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.886 at
FT                   residue 31"
FT   gene            complement(298584..299030)
FT                   /locus_tag="Sfri_0269"
FT   CDS_pept        complement(298584..299030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SOA0156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70132"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D3"
FT                   /protein_id="ABI70132.1"
FT                   /translation="MRAKQSNYWIIVITLFALVGQGLLTNDSLMVPMAHAEMTQALSSQ
FT                   TDKITNTTSAMSHKAMKNCHDDMQNAVNDVGEPIATKLPQNSCCNGSGFCSLDCNHCLT
FT                   ISFTANLIDIPLAMTITPVYSAPLTMVVNHVSIAFPPAFRPPIA"
FT   gene            complement(299214..299939)
FT                   /locus_tag="Sfri_0270"
FT   CDS_pept        complement(299214..299939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70133"
FT                   /db_xref="GOA:Q089D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D2"
FT                   /protein_id="ABI70133.1"
FT                   /translation="MFWVRKLHKWASVIVGIQLLLWLISGLYFNLMDHDKAQGLTHLND
FT                   THAEVAIETHRLLEPGTILAAFKPSVSLNIITLLDKPYYLLIHEKGLYNHLNNDYSLVD
FT                   AYDGNQVIIDITMAQQLAKASYSGEATISSTLLLTPPLDDFPKQHNDTWQINFADNIGT
FT                   SVYIEAQSGRLVGHSDEHTRLADIFFMLHFMDYTSEGSFNNIPIMIFAFITLWLTFSGL
FT                   IWVIDMLKRNRYRPKLKRK"
FT   gene            complement(299939..300697)
FT                   /locus_tag="Sfri_0271"
FT   CDS_pept        complement(299939..300697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70134"
FT                   /db_xref="GOA:Q089D1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D1"
FT                   /protein_id="ABI70134.1"
FT                   /translation="MHKAARTLHKWLMLFLGLQFVIWSVTGTYMVFMHIDYIHGDSLIS
FT                   NPQTKINPDKLQYSLAKLLQTYPEAEQISVGKLMQQDVYRFSIPAINTTIITTQQVMLN
FT                   AQTGERLSPLNQTAAIALAQYYYLGNESITKVSLLNDNPPFELSARHLPAWRINFDHFS
FT                   APSLYISADSGLVVGKRHAFWRLFDWMFRFHVMDYGDAEEIDNQLLFWIALFSTLATVS
FT                   GLILVYFRVLRRTKNKRKSMLSKRKHSGVA"
FT   gene            301407..301970
FT                   /locus_tag="Sfri_0272"
FT   CDS_pept        301407..301970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0272"
FT                   /product="NapC/NirT cytochrome c domain protein"
FT                   /note="PFAM: NapC/NirT cytochrome c domain protein; KEGG:
FT                   son:SO4591 tetraheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70135"
FT                   /db_xref="GOA:Q089D0"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q089D0"
FT                   /protein_id="ABI70135.1"
FT                   /translation="MNWRALFKPSAKYSIIALIVVGVIVGVVGYFATQQTLHATSSDAF
FT                   CMTCHRDHSLRDEVMASAHGGGRAGVTVQCQDCHLPHGPFDYLVKKIIVSKDIIGLMTI
FT                   DGFMTQEWLDENRKEQADLALKYFRSNDSANCQHCHTRIYEDQPDTMKKMAVRMHSMNF
FT                   KKAPEDRKTCVDCHKGVAHPYPKK"
FT   sig_peptide     301407..301505
FT                   /locus_tag="Sfri_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.790) with cleavage site probability 0.625 at
FT                   residue 33"
FT   gene            complement(302050..302352)
FT                   /locus_tag="Sfri_0273"
FT   CDS_pept        complement(302050..302352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70136"
FT                   /db_xref="GOA:Q089C9"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C9"
FT                   /protein_id="ABI70136.1"
FT                   /translation="MPMSIHDIVLIGKTATLSMWCLVAYGFFIFSPDVSLFLNVFASIT
FT                   AAMHMLLVLLTRLKNIRNKKPAVHYRAILLWGVFALFEQYHSRHSSQLVNGINKY"
FT   gene            complement(302357..302956)
FT                   /locus_tag="Sfri_0274"
FT   CDS_pept        complement(302357..302956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0274"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: conserved
FT                   hypothetical protein 95; KEGG: son:SO4587 putative
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70137"
FT                   /db_xref="GOA:Q089C8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C8"
FT                   /protein_id="ABI70137.1"
FT                   /translation="MAKKNTSSGQVRIISGQWRSRKLPIHDLEGLRPTTDRVRETLFNW
FT                   LANDIRGAKVLDCFAGSGALCLEALSRYASFATIIELQKNAANQLKQNLATLQCQNAEV
FT                   INADCLQVLAKGTPGGFDIVFIDPPFRKDLVNKTIELLMQHQWLNPNAQIYLETESELT
FT                   SVNVPATWVALKEKKAGQVCYRLYQYQPNDNLLLAD"
FT   gene            303137..304900
FT                   /locus_tag="Sfri_0275"
FT   CDS_pept        303137..304900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0275"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: son:SO4586 cell division protein FtsY;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54, G-
FT                   domain; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70138"
FT                   /db_xref="GOA:Q089C7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C7"
FT                   /protein_id="ABI70138.1"
FT                   /translation="MAKKGFFSWFRKDKPVPEVEEQQQLDVDAENEVVTETAEQPQQAE
FT                   QLEQTEATARLDVERLEQERLETELAEQARIDAERIAADKLAADVLTSEKLAAEKLATE
FT                   QAEQQKQALETERLEAERVEQLRLEQLDLENKRLEQERVDNERAELARIDAERIAAEKL
FT                   ATEQAEQQKQAQETQRLETERLEAERVEQLRLEQLNLEKKRLEQERVDNERVEQARVDA
FT                   ERTAAETLATEALAAELAAQQLAEQQLAEQQAAEQQAPIESIELAQQDEPQAKPQKEGM
FT                   FARLKRGLMRTSENIGSGFIGLFRGKKINEELFEELEEQLLIADVGVETTNKLIKSLTE
FT                   HASRKQLKDAEALYDLMREEMQKMLDPVAIPLVPDNANGPFVILMIGVNGVGKTTTIGK
FT                   LAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGADSASVIFDALQAA
FT                   KARKVDVLIADTAGRLQNKSHLMEELKKVVRVMKKLDPDSPHEVMLTLDASTGQNAISQ
FT                   AQLFKEAVGVTGITISKLDGTAKGGVIFAIADKFSIPIRHIGVGEQIDDLRTFNSNDFI
FT                   EALFSQDKTDQ"
FT   gene            304904..305593
FT                   /locus_tag="Sfri_0276"
FT   CDS_pept        304904..305593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0276"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: son:SO4585 cell division ABC transporter,
FT                   ATP-binding protein FtsE; TIGRFAM: cell division
FT                   ATP-binding protein FtsE; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70139"
FT                   /db_xref="GOA:Q089C6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C6"
FT                   /protein_id="ABI70139.1"
FT                   /translation="MIQFEQVSKIYAGGQKALMDVNFHLRQGEMAFLTGHSGAGKSTLL
FT                   KLITVIERATAGKVSINGHNIANVGPKHVPYLRRNIGVIFQNHHLLMDKTVFDNIALPL
FT                   VIEGFTHGEIRKRVAGALDMVGLYGKERHLPIMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPKLSMDILRLFEAFNDSGTSVLIATHDLGLIARMKYRTFTLREGRMLGGESST
FT                   AGGETIR"
FT   gene            305590..306555
FT                   /locus_tag="Sfri_0277"
FT   CDS_pept        305590..306555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0277"
FT                   /product="cell division protein FtsX"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   son:SO4584 cell division ABC transporter, permease protein
FT                   FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70140"
FT                   /db_xref="GOA:Q089C5"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C5"
FT                   /protein_id="ABI70140.1"
FT                   /translation="MSKKVNITQSKLPLSGRIVMFFIRHVQQGMSSMGELWRSPVSSIM
FT                   TMAVLGVSLSLPAALQVLVKNAENITQSWNSAAEISLFINKGRSEQSIQSLLSRIKAFR
FT                   EVESVTYISRDQALEEFQRLSGFGEALSYLDENPLPAVVTVTPSLKYSSPTGARELLVK
FT                   LERESEVNFGRLDIEWLERLQALLKLLEKTVLAIAALLVLAVVLVIGNTIRLAIMNRRT
FT                   EIEVMKLVGATEAFIQRPFLYTGIWYGVIGGILAWLIINVLVWYLDGALAELLGLYGSE
FT                   LTIQSLSFSELIKLVLLASFLGWLGSYLSVRQHLRSIEPS"
FT   gene            306788..307645
FT                   /locus_tag="Sfri_0278"
FT   CDS_pept        306788..307645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0278"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; PFAM:
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; KEGG: son:SO4583 RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70141"
FT                   /db_xref="GOA:Q089C4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C4"
FT                   /protein_id="ABI70141.1"
FT                   /translation="MTYQTQSMALAVPHNASSLEAYIQSVTSINMLDADTEYDIAKRLQ
FT                   ENGDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPDVGVRL
FT                   VSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNIRKSKKRLGWFSDAEVTMVAEN
FT                   LGVSKADVTEMESRMAAQDPAFDLTNDSDDDHHDFAPALYLEDHSSDVADQVEHANWEA
FT                   DSQTRLLSAIKTLDERSQHILRARWLDDTKVTLQELASTYEVSAERIRQLEKNAMNKLK
FT                   SCME"
FT   gene            complement(307891..309438)
FT                   /locus_tag="Sfri_0279"
FT   CDS_pept        complement(307891..309438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0279"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: son:SO4576
FT                   O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70142"
FT                   /db_xref="GOA:Q089C3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C3"
FT                   /protein_id="ABI70142.1"
FT                   /translation="MMSPLHQAALNHPDAIAIEGRHEAIDPSITTGNKTCNNTCTTTRV
FT                   SYAQLSGLVHCVAQQLQSQGVKHGDIVACLSHNNIEMICLYWACIDAGWIFLPLSPRLA
FT                   DVQINQLIKRFDLQWLWTDNVSRKTAIEIANWLDIELPQKVDQLINQAVEISPHQASNI
FT                   ILTSGSSGTPKAAVHCLTNHLSSAKGAATFIALAPSDAWLLSLPLFHIGGLAIIHRCTL
FT                   AGACIVLRDPALTLAEQLTSSHITHVSLVPTQAIQILRQHPAAFTNISALLLGGGVIEP
FT                   ALIDALQHLHINAYTSYGMTEMSSQITTAKANLLGHHGCPLPSRQLRLKDGLIWVKGEC
FT                   LFLGYLTDQGLSLPLDEQGWFCTHDKGQLDLEGQLSILGRMDNMFICGGENIHPEQLEA
FT                   VLLTHPNVAQAIVFAIDDIIFGHLPAAIIDYCVADNNTNAIGLETVNAKAADLNGVNID
FT                   NINLQLSQLVESTLARFKRPRQFFGWPKDIVSSGLKVPRKSIINAIQTQIDAAKTAS"
FT   gene            complement(309438..310532)
FT                   /locus_tag="Sfri_0280"
FT   CDS_pept        complement(309438..310532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0280"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /note="KEGG: son:SO4575 O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70143"
FT                   /db_xref="GOA:Q089C2"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C2"
FT                   /protein_id="ABI70143.1"
FT                   /translation="MSSDNSTITSCTLYQYQIELNPSLPVGIQRIDIRKGLVLATQLNN
FT                   QQVAWVEIAPLSGIDIDSQPITGFSQESLDEVTSQLLQVLPNFIDQPLVILTNIAEQIS
FT                   LPSLAFSLSLLHAKLTDKLPVRIENPQTQLAVVPLLYDGMSAHVITQKLQTLTSINSVK
FT                   IKVAQTSMESDIQFIYQVLAIAPHVTLRLDANRGFSLEQAIDFLACLPKHKIEYIEEPC
FT                   INPSDNAQIYRQLGIKYALDESLNSSQFDLDLALQQPGLGALIIKPMLLGSLEKLQNMI
FT                   SQAHLAGVRCILSSSLESDLGISDLRIVSQALTPDEPPGLDTLSAFSKPVLLATSGFSP
FT                   RLNHQVLKLLTHIGQPQDSDEAGI"
FT   gene            complement(310535..311347)
FT                   /locus_tag="Sfri_0281"
FT   CDS_pept        complement(310535..311347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0281"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: son:SO4574
FT                   hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70144"
FT                   /db_xref="GOA:Q089C1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q089C1"
FT                   /protein_id="ABI70144.1"
FT                   /translation="MIMIRRFGQPQLPALLMLHGFLGSKDDWSILMPRLSQYFHCICID
FT                   LPGHGANEDTLDSPGLHQAAELIVSKMHNMGYMQFHLLGYSLGGRIALHIADGYADSLL
FT                   SLTLESAHPGLQDAQQQAARAKSDNIWAKKLQHLPIADFLALWYQQAVFNDLSEAQKQQ
FT                   LIAIRRSNDPQRLANCYITTSLSLQQDCRTVLEPLKCPCHFMYGVDDKKFAQVAIDWRA
FT                   TLAESGLGTLQLHPLHAAGHNIHSLHPQLFTDTLLGLLCLDPLTDPKE"
FT   gene            complement(311347..313086)
FT                   /locus_tag="Sfri_0282"
FT   CDS_pept        complement(311347..313086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0282"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /note="KEGG: son:SO4573 2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate
FT                   decarboxylase; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: thiamine
FT                   pyrophosphate enzyme TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70145"
FT                   /db_xref="GOA:Q089C0"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q089C0"
FT                   /protein_id="ABI70145.1"
FT                   /translation="MQQQTSADMNLLWGQLILEELARLGVKHVCMAPGSRSTPLTLAAA
FT                   SQTQLTRHIHFDERGLGFMALGLAKASNAPVAIITTSGTAVANLYPAIVEAWLTHVPLI
FT                   ILSGDRPPELIDCGANQAIIQPAIFAQYAKQVNLPTPDLGYPANALLSTIDHALANQHQ
FT                   PVHINCMYREPLYPTELVTLAHVKKTASVTTSTYLAPLNQWFENTKPLTRYASLTSAEL
FT                   PTTDTLMRFVHGKGVIVVGTLAPEDNPQQIVALAQKLGWPVLVDAQSQLRQHPGVIGHV
FT                   DQLLLNPKANKQLEQAERILVFGGRFISKRLLQYIAQQSWHSYWHVVKHGDRLDPTHQS
FT                   KEFYQASVQAVCQLPWPRSSQANWALQLLPLNESLESLFKQQIDNTTFGEAQVVRAIAL
FT                   AQSDQHILFIGNSLPIRLYDMYAPIATNTPAIYTNRGASGIDGLIATACGVAADKNAPT
FT                   TLVMGDLSCLHDFNSLALLKQMTQPFVLVIINNDGGNIFNLLPVPNESLRNDFYRLSHG
FT                   LEFGYGAAMFGLAYRQADDIESFNQAYQEAFEFNCASVIEVNVSPTQASDQITQISQWV
FT                   KQH"
FT   gene            313307..314140
FT                   /locus_tag="Sfri_0283"
FT   CDS_pept        313307..314140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0283"
FT                   /product="putative signal transduction protein"
FT                   /note="KEGG: son:SO4563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70146"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B9"
FT                   /protein_id="ABI70146.1"
FT                   /translation="MESAALLKRVDELPRLPKAVSELLDAVNNENTTVKSISAKVAQDP
FT                   LISARVLRLANSAHFGRSREVGSIDEAVIRLGMQTLRTLVIASAVIGAIPDVEGIDLAE
FT                   FWGETFEVALYAQEVAKRCGVAPDEAFTCAILHNIGDLLIAFVEPSISAQIRAAVAEGA
FT                   DKQKLETSLLGFDSPSVGALLAKTWKFTPALVQGIEYQREPLNAKPASKLAAVIYLSHE
FT                   VFAHWNDQRDDESFTAWLAAITNNKAGMIKMDMAGLGEKLLELRGKGLEIGKQLA"
FT   gene            complement(314189..314662)
FT                   /locus_tag="Sfri_0284"
FT   CDS_pept        complement(314189..314662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0284"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   son:SO4567 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70147"
FT                   /db_xref="GOA:Q089B8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B8"
FT                   /protein_id="ABI70147.1"
FT                   /translation="MTERSCDTQLSGYKSLDKFDKAIINELRHNARQSISFIAEQVSLS
FT                   RSAVTERIKKLEQTGVIRGYQVLLSESQKQGVSAYFEIQHRCARCAEVIHIFTTIPEVI
FT                   TCQGITGDMDLLVYVHANSMQRLHEIREFIDAQADIVKIKTHVVMSEWINNQA"
FT   gene            314791..316074
FT                   /locus_tag="Sfri_0285"
FT   CDS_pept        314791..316074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0285"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   son:SO4565 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70148"
FT                   /db_xref="GOA:Q089B7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B7"
FT                   /protein_id="ABI70148.1"
FT                   /translation="MNQMTATIGRWQGAGLMATTLLGTGVFILPQMTIEVAGSGSLLAW
FT                   LLLTVAIIPVALVFGLLASRFPHAAGPAYFIEKAFGATAGRTIGLIFLLVIPIGAPAAI
FT                   LMTFQFLEALISISGLGQLVAELLIVAVLLLLNIKGIQVSAKLQFALTLLIVSVVAILF
FT                   GASGLNVDQLETFAHSSHPQFSGVMLAMGIGFWSFLGIEAMTHLASDFRQPDKDLLPAM
FT                   MMGTVLVGVIYLACTFLLLMVPTEGDGLAMISAFDYLLSNTFLGGYGAYIIGVLGIASG
FT                   LATVNVYAASAARLLWSFSKEGILPRYFDKLNPHGVPFRALFAILGAMAVVIIVTFYST
FT                   QELEDLIAWSNGVFVIIYLLAMLSAAKLLSKRYLPLVIAGCLFCVGLGIALGSNMIYAI
FT                   VLVLVVAPFMWWQKAHLTRKYLLNNSQG"
FT   gene            complement(316086..316535)
FT                   /locus_tag="Sfri_0286"
FT   CDS_pept        complement(316086..316535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0286"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="PFAM: protein of unknown function DUF1332; KEGG:
FT                   son:SO4562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70149"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B6"
FT                   /protein_id="ABI70149.1"
FT                   /translation="MIAKLKQFLQSHTQESSPEDKQKNLNLAAATLLQEVVYADENLAA
FT                   AEAALLPEMLINTLGINSEEAITLIEEAKQSRKNATSLFEFTAEINAQFSIDDKQKLLL
FT                   SMWQLAYSDGELSQYEDQIIRRTADLLHLKHSELIQMRNIAMETR"
FT   gene            complement(316665..317228)
FT                   /locus_tag="Sfri_0287"
FT   CDS_pept        complement(316665..317228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70150"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B5"
FT                   /protein_id="ABI70150.1"
FT                   /translation="MKLASALPVLFTVFAFSAPASAGWLDNVAEITKKPVTEQAKTIAL
FT                   SETIEQSETTEQSSALVGDVMSQLGLSQTQAEGGLGSLLSLAQTNLGENDFSQLSDSIP
FT                   NADGLLAAVPALSSDSGMSGLLSQAGNLGSALQGSAMVYDAFEKLGISKEYITPMVDIA
FT                   KNYLQQSGGDGTVDLLMKGLGSVL"
FT   sig_peptide     complement(317160..317228)
FT                   /locus_tag="Sfri_0287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            317399..318121
FT                   /locus_tag="Sfri_0288"
FT   CDS_pept        317399..318121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70151"
FT                   /db_xref="GOA:Q089B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B4"
FT                   /protein_id="ABI70151.1"
FT                   /translation="MSLFAILTEAFNFFRNHIRQLAVLTLPLLLIQVAIQLWLGNEMLQ
FT                   ADAENPQFGAVHAAAMMVLLLVFSFLIAALTLYLELRSQGHDLAPAQILKASLPFVPPL
FT                   LLAGVFSGLAILAPVMIFAAFGPLWLIGLIVSLYLFSRLAYVNFMVVVERLTPLEAIKS
FT                   SFKFSGPITIKTIAVLLLYVPLSLLAGMFSQVAMQVGFPLQLVVEATFSFLGLFVNIAL
FT                   FRLYMVNRKTPDADKAEG"
FT   gene            318154..319662
FT                   /locus_tag="Sfri_0289"
FT   CDS_pept        318154..319662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0289"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: son:SO4559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70152"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B3"
FT                   /protein_id="ABI70152.1"
FT                   /translation="MLNDIEFINGFSTELSDDYRLAKSYVRDIPTQALVYIRSFTHKLA
FT                   AQLAVQHGVTFTSANLYDRIEQLNQRRVIDVAAVRALHRLRSDGNRGAHPEKYHLTQTQ
FT                   LVNIAEKSIHQILQVIEKLYPSLHPGVAPHYQFEAFDSFAGRDLCYRAVMKNDPEAQYL
FT                   VGMSLKAKGLMLQEQERALAQTTDDSLLASSNSSSASSSSTSSSSNSAESNTPSLISTT
FT                   VEQTSADVFAQAAHWFHIASAHHQAALFEHGVSLLHGYSGAENPATGEAFIAQAAAQGI
FT                   VNAQALLGFFYLVGSDQFEVDINQAETLLTLAANAEDAEAMSNLGVLFYQNQQFEQAYL
FT                   WINKAAQTGYPHAQYHLALMLEQGEGCQIDLATSQQWMQEAAEQGQLDAMLRCSSDILH
FT                   DDDASQEQLNIAEHYLHEVIKYGRNVTAMIELSVALADGILGRIDVVQAAYLLQQANLH
FT                   ANEIQRQVIEPLWQSLQMQIDSVIALNPTEDELATLQQAKCLLA"
FT   gene            319895..321751
FT                   /locus_tag="Sfri_0290"
FT   CDS_pept        319895..321751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0290"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: cps:CPS_3372 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70153"
FT                   /db_xref="GOA:Q089B2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B2"
FT                   /protein_id="ABI70153.1"
FT                   /translation="MTAINITTLPPLPDAHALAVLLLVLLALFLFTRESIAIETSSLFI
FT                   LAMLSIGFTVFPYVNSQGQHLEALQFFSGFGHEALVAVCALMIAGNGLVRTGALVPLGR
FT                   ILARLWLVSPALSMLLTLLVGAFLSAFVNNVPIVVLLLPILISVSLRTGEPASGMLMPM
FT                   GFATLVGGMSTSIGTSTNLLVVSVAADMGLRRLQMFDFFVPAAIVAAIAIVYLWLIAPR
FT                   LLPARKAILSDTSPRIFTAQLVILEDGFAVGKTLTELIEKSSGLLEVSRIMRGTGTYVV
FT                   PLPDAQIQAGDRLMVNDTPENLKELESALDAMLYVGDTPVDEEHPLSGEGQQIAEIVVM
FT                   QGSPLLGMTLRQLNFYDRYQLMVLAIHREGNSVETLREKIAQARLRIGDVLLVQGDQDT
FT                   IGEIKRAGELLVLDATADLPYTDKAVTALLIMAAIILVSAFGDVPIAISAVGGVLLMLV
FT                   TRCLTWRHASMALSTQVILIVAASLAMGSALLKTGGAEYLAQVFVALTAGASPAVIVSG
FT                   LMLLMAIMTNIVSNNAAAVIGTPIAISIAQQLQVNPEPFVIAVLFGANMSYATPMAYKT
FT                   NLLVMHAGGYKFTDFVRVGVPLTIIVWLSLSLLLPVMYSLSW"
FT   sig_peptide     319895..320008
FT                   /locus_tag="Sfri_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.629) with cleavage site probability 0.420 at
FT                   residue 38"
FT   gene            322133..322510
FT                   /locus_tag="Sfri_0291"
FT   CDS_pept        322133..322510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70154"
FT                   /db_xref="InterPro:IPR041018"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B1"
FT                   /protein_id="ABI70154.1"
FT                   /translation="MFPMEFYILPEELFRLGNSTSPKLANVRARDVDIIEINGIKVIIA
FT                   NGKGISVFDKVGINESPMTGWAWRFAPNTRPPVGLKMVQDKPHHYCISPACNMPVDKYK
FT                   GLLEEMALIATRVFKKEGKFA"
FT   gene            322507..322740
FT                   /locus_tag="Sfri_0292"
FT   CDS_pept        322507..322740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70155"
FT                   /db_xref="UniProtKB/TrEMBL:Q089B0"
FT                   /protein_id="ABI70155.1"
FT                   /translation="MSSIQLDLTASEAKIILEALTEMEAKMTAICETSVDEDEVADVGN
FT                   DLIEVRLLLNPLKKQAITQFGENVINFSRELL"
FT   gene            complement(323577..324215)
FT                   /locus_tag="Sfri_0293"
FT   CDS_pept        complement(323577..324215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0293"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; Male sterility C-terminal; KEGG:
FT                   pha:PSHAa2082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70156"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A9"
FT                   /protein_id="ABI70156.1"
FT                   /translation="MNKTLILGASGQIGNMATKQLLADGQSVIALVRDKNKLADIASDK
FT                   KLDIVEADLEQDFSQAFNDCDQVIFSAGSGGKTGADKTMLIDLWAACKAIDYAKAANVS
FT                   HFIMVSSIGADDPDQGSEQMKPYLVAKHMADEYLISSGLNYTIFRPGSLTDDRATGKVQ
FT                   TQRPSSKEKMTIHREDVARALTYAVGKPQLGGKVFELFNGSKSLTDVLN"
FT   gene            complement(324562..324900)
FT                   /locus_tag="Sfri_0294"
FT   CDS_pept        complement(324562..324900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70157"
FT                   /db_xref="GOA:Q089A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A8"
FT                   /protein_id="ABI70157.1"
FT                   /translation="MKFNQSFHTANLKSRFSAMNPILALLMFFSIAFTTIVLLPFILLL
FT                   GFLSFITLQLLGKKILQRNQSQAQQGDIYQDSADVQREQAAPYADMFSRPKSNQTQHTG
FT                   RTFEHQAD"
FT   sig_peptide     complement(324802..324900)
FT                   /locus_tag="Sfri_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.750 at
FT                   residue 33"
FT   gene            complement(325302..325619)
FT                   /locus_tag="Sfri_0295"
FT   CDS_pept        complement(325302..325619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70158"
FT                   /db_xref="GOA:Q089A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A7"
FT                   /protein_id="ABI70158.1"
FT                   /translation="MFRSIYTHKIMQRLQKMRPLAALTTVVTVLIGGLLLLPLILLFVF
FT                   VGFIGMTLLRRQYMRQHHAASSPLSTANPKDNIYHQHPNIERENSNQQSCLSHAKSAEL
FT                   S"
FT   gene            complement(325730..326713)
FT                   /locus_tag="Sfri_0296"
FT   CDS_pept        complement(325730..326713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0296"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO4556 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70159"
FT                   /db_xref="GOA:Q089A6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A6"
FT                   /protein_id="ABI70159.1"
FT                   /translation="MNLDNLARIDLNLLVILQVLLEEQSVTRAAHRLHVSQSAVSKSLN
FT                   RLRETLDDPLFQRTAHGLKPTAHADALRQQLPLVLQNLYKLTQPPNFHPATSNRQFSFS
FT                   MVESAYETLIPYFIGPLLQQAPLIKLDSYVWTEKSMQDLQQGQIDFGIAGRDILPQTDV
FT                   NIDKVPEGIESQILFNDHQVCLVRKNHPILQAVKDGRWDQAHYLNMSHVQVRCEGNDWW
FT                   ALDYHLANLGLHRNLSTTVPDFYGAASVCAHTDLIFTLPSSFANHAQKLYSLVSIPLPF
FT                   EFMPMAYVFLWHERNNQEPGHQWFRNIIFSSVDKAIANQHISKPNN"
FT   gene            326840..328045
FT                   /locus_tag="Sfri_0297"
FT   CDS_pept        326840..328045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0297"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   son:SO4555 drug resistance transporter, Bcr/CflA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70160"
FT                   /db_xref="GOA:Q089A5"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A5"
FT                   /protein_id="ABI70160.1"
FT                   /translation="MRRNLLPLLMFMVLLSPLAIDIYLPSMPAMALEYGVSNSEVQSTL
FT                   VLFLFAMGVGQILIGPLADRFGRKPVALFGIVLYGISSLLGAYAVEFEWLQIARVFQGL
FT                   AACSTSIVVFSAVRDCYSRKESVSMYSYLNGAICVVPALAPTFGGLLALQFGWRSTFIF
FT                   MALYAIFVLFLVGFRFPETRPLNTDSTGPLYRWSRYKPVIGDPHFMFYASCCMIAMASI
FT                   LCYVSYSPVWLIGHLGISELTFSGLFGLNAAVNIAACFAAPVLVKRIGNRPGVVVALSL
FT                   MLLAAVIEAAMYFAGPQEGLAAAIAFMAPMMILCVGFAVLLGPATSMALSAFGERAGTA
FT                   TAMLGCIQMSGASILTALIQLTDIPAPYAIAVVMGGFSAVLLIIIAMNRLSHLHQEQLQ
FT                   HD"
FT   sig_peptide     326840..326935
FT                   /locus_tag="Sfri_0297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.761 at
FT                   residue 32"
FT   gene            complement(328127..329092)
FT                   /locus_tag="Sfri_0298"
FT   CDS_pept        complement(328127..329092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70161"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A4"
FT                   /protein_id="ABI70161.1"
FT                   /translation="MTRTKMSVALMLALATIPAYAAQDNTYHHEAEIGFLDSSGEADGL
FT                   VNANYRYYFKAVEQADKPYALAGFFNQGSTVSARYATTDFQDLYNISGEYVFDSKWFLG
FT                   AGVNQLNADDAVFDITTYEISAGYFFSEHSKLSLNYTTNSESESNNGAYLEYEFESYFS
FT                   QNIDAITLTYEHFIPLQSTAGVFITGAVGYQNPQYINNEMLTQVDGSTPTIVQDSKINF
FT                   ENDIYTVAVFADWYINNAWSVGATYYRTDVNTDLSSSNIDDSNKSSHSNNITETGLNTR
FT                   YFWHFSDVFSAKFSLEHYFDNGEYNSDSETNVGIAINARF"
FT   sig_peptide     complement(329027..329092)
FT                   /locus_tag="Sfri_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 22"
FT   gene            329194..329805
FT                   /locus_tag="Sfri_0299"
FT   CDS_pept        329194..329805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0299"
FT                   /product="DTW domain containing protein"
FT                   /note="PFAM: DTW domain containing protein; KEGG:
FT                   son:SO4554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70162"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A3"
FT                   /protein_id="ABI70162.1"
FT                   /translation="MSRSYCIYCQYPQSACVCHALKPVTSNTEVVVMQHPSEVDHAKNT
FT                   VRLLKLVMPQMKIYVGESAADFIELQHYLAAQTKPIYVVYPNEHSQTVAEAGASEAAII
FT                   ILVDGTWRKAYRMLQLNPWLLNYPSLHLECEDESQYIIRKAKRSDSLSTLEAVAHTLIA
FT                   LNPAADIAPIFAVFNAMVQHKLTAMPALVRERYNGDKIKG"
FT   gene            329811..330194
FT                   /locus_tag="Sfri_0300"
FT   CDS_pept        329811..330194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70163"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A2"
FT                   /protein_id="ABI70163.1"
FT                   /translation="MKHRLISSVILLVTASTLAFFTVATDKPHKKMTLAEKGEQARQES
FT                   AEFEQTQLQKAREAAKTTSDREQEILAKSQSNDWEAQQLEKARAQSDERLTRQQKYLQQ
FT                   AQEAATQTRKIPKDTSIEPVQSD"
FT   sig_peptide     329811..329885
FT                   /locus_tag="Sfri_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.961 at
FT                   residue 25"
FT   gene            330238..330882
FT                   /locus_tag="Sfri_0301"
FT   CDS_pept        330238..330882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0301"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: son:SO4550 methyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70164"
FT                   /db_xref="GOA:Q089A1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A1"
FT                   /protein_id="ABI70164.1"
FT                   /translation="MSSCPLCHHETAAFSQDKSRSYVRCPQCFLVSVPAAFYLDEIAEK
FT                   AHYDCHNNDVADLGYQQFLSRTLTPLIARIKPGAIGLDFGCGEGAVLSQMAVAQGIKVV
FT                   NYDLFYHPDTLALSQKYDFVCLTEVIEHIANAQALMAQLSTLLLPGGILAIMTKHIPSL
FT                   DKFNNWYYKIDPTHINFYSIETFQWVALQQGWQLEIIDSDVVFFHIPTSPA"
FT   gene            331001..332314
FT                   /locus_tag="Sfri_0302"
FT   CDS_pept        331001..332314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0302"
FT                   /product="carboxypeptidase Ss1. Metallo peptidase. MEROPS
FT                   family M20D"
FT                   /note="KEGG: ilo:IL0586 metal-dependent hydrolase of the
FT                   aminoacylase-2/carboxypeptidase-Z family; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70165"
FT                   /db_xref="GOA:Q089A0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q089A0"
FT                   /protein_id="ABI70165.1"
FT                   /translation="MNMRLTSVALLLSSVFAASVYSTTTVASVPNAAELTAQVESKVIA
FT                   WRRDLHQHPELSNREFRTSKVIEKHLKSLGLEVQTGIAHTGVVAILTGGNPGPLIGLRA
FT                   DMDALPVTEVVDLPFASKATDTYRNQTVGVMHACGHDTHVAMLMGVAENLVKVKDSLAG
FT                   DVMFIFQPAEEGAPEGEQGGAELMLKQGLFAKRKPEQVFGMHVTSSMPTGMIGLRSGPA
FT                   MASEDSFTIKVTGKQTHGSRPWSGVDPIVASAQIINSVQTIISRQVDITKAPAVVSFGA
FT                   INGGIRSNIIPDEVELIGTIRTFDQDMRADIKVKLAQVAANAAKTVGATAVTVIQPGYP
FT                   VTVNNPELVSKMRPVIASVVGDNMLIEPGLITGAEDFSYYALETPGMFFFLGVTPADQD
FT                   INNVASNHSPAFYVDESALKVGVQTMTQIALTALSAAQ"
FT   sig_peptide     331001..331069
FT                   /locus_tag="Sfri_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.323 at
FT                   residue 23"
FT   gene            332400..333728
FT                   /locus_tag="Sfri_0303"
FT   CDS_pept        332400..333728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0303"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   son:SO4537.2 hypothetical Zn-dependent peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70166"
FT                   /db_xref="GOA:Q088Z9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z9"
FT                   /protein_id="ABI70166.1"
FT                   /translation="MTRKIMALLMTLGVLSAPNVSATQAEDINSFTLDNGMKIMVLEDS
FT                   SIPNANMYIFWKVGSRNEVPGITGISHFFEHMMFNGSKKFGPKMFDRTMEAAGGANNAY
FT                   TSEDLTVYTDWFPANGLETIFDLEADRIANLDINPEMVESERGVVQSERTTGLENSNWR
FT                   TIQEALKSVAFAAHPYSWSVIGYESDIAAWTLADLQQYHKTYYAPNNALVVITGDVKLA
FT                   EVKALANQYFAPIPAQAPPKAVRTVEPQQNGERRVFVKKESVSTPNIMLAYHVPATSHA
FT                   DYYALDLLTSMLSEGNSSRFYQALVDKQLAVAADTYMPMSFDPNLFYILGVANAGVSAE
FT                   TLEKALIEQIDLIANKGVTQQELEKVKNIKLMDFYRTMETINGKANTLGTYELYFGDYA
FT                   KLFNAPEAYNKVTPADIQRVAQTYLIKANRTVGVLAATEESDK"
FT   sig_peptide     332400..332468
FT                   /locus_tag="Sfri_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.783 at
FT                   residue 23"
FT   gene            333725..335176
FT                   /locus_tag="Sfri_0304"
FT   CDS_pept        333725..335176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0304"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ppr:PBPRB1337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70167"
FT                   /db_xref="GOA:Q088Z8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z8"
FT                   /protein_id="ABI70167.1"
FT                   /translation="MKTVTHTRIKISLSAIALACSIGISGCATTQKNTADSANPVTASF
FT                   VMPRYQSVTLDNGLQVKLMVQKEVPLVTIDAVVRAGAVNDITSGMAYITSQSLLLGAAG
FT                   QSKADIEQQLDFIGASIDTNADLEGSYIRANMMSKDVDTVLDIFSHVLRQPDFDSAEFD
FT                   KLKQREIVGLSQQKESPRAVIGRYFNKLVFGDHPYANPVSGNSDTIAKLSVEELRAFHK
FT                   GYYQPSNMTINVVGDFDVADMTAKLNKAFGDWQTTETVVQSDLSQHLPTLTQPHVLLVD
FT                   KPDAIETTFLIGGVGIRYDNPDYVGLTVVNTILGGRFTSWLNDELRVNAGLTYGARSGF
FT                   SPYAQSGVFQISTFTKSSTTKEAIDLALKTYARLWGKGIDQTTLDSAKAYVKGQFPPKY
FT                   ETSGQLAGLLSDMYLYGFNDDFINQFQAKVDGLTLAETQRLIKQYFPQQNLQFVLIGNA
FT                   EKIADIAAQYGEVTKVDITATGFGQ"
FT   sig_peptide     333725..333817
FT                   /locus_tag="Sfri_0304"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.744 at
FT                   residue 31"
FT   gene            335401..335964
FT                   /locus_tag="Sfri_0305"
FT   CDS_pept        335401..335964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70168"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z7"
FT                   /protein_id="ABI70168.1"
FT                   /translation="MIHTCRFILLLTAMLLLTHSTSSYAAKVTLDSFCGQLAGEWQGSA
FT                   ANPNVAPKQVSTSVMCSADKRNLYISVSRGSRFSNSETWWFRQQQDHILLVYANGITDD
FT                   ISQQLTLYEQAGSYSFLGKGEINQRPALVQLQFDPMMSDTKPSTAGWQWQQSAHYLDDD
FT                   SEQYQVIRAISLLKPSANNTLPTE"
FT   sig_peptide     335401..335478
FT                   /locus_tag="Sfri_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            complement(335993..336331)
FT                   /locus_tag="Sfri_0306"
FT   CDS_pept        complement(335993..336331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO3676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70169"
FT                   /db_xref="GOA:Q088Z6"
FT                   /db_xref="InterPro:IPR021339"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z6"
FT                   /protein_id="ABI70169.1"
FT                   /translation="MKKTLSPETQQNALAIAKATQKPGQVKEQTKLIAAGVEKGIAEYK
FT                   KREKAKARERDKARKQQQKAKSATSSNDDDSDASYIETESQFNSLTWSLLGLLILSWAL
FT                   FAAYLFYR"
FT   gene            complement(336331..336795)
FT                   /locus_tag="Sfri_0307"
FT   CDS_pept        complement(336331..336795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0307"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   son:SO4529 RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70170"
FT                   /db_xref="GOA:Q088Z5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z5"
FT                   /protein_id="ABI70170.1"
FT                   /translation="MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDLEEKKLR
FT                   RAGLDYSDLTSVTRHKNYTAFLEAMAGKRIIACTTKGSRPHTQIAFQENDVLLFGPETR
FT                   GLPMDIIDATPLAQRLRIPMTANSRSLNLSNSVAIISYEAWRQLGFAGAE"
FT   gene            complement(337046..338425)
FT                   /locus_tag="Sfri_0308"
FT   CDS_pept        complement(337046..338425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0308"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pha:PSHAa2520 mechanosensitive channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70171"
FT                   /db_xref="GOA:Q088Z4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z4"
FT                   /protein_id="ABI70171.1"
FT                   /translation="MICRFLLNSFPRSNQRSSSRLNRWILLWSLVIAVVCLTSFVPTDA
FT                   QAAPSPDTVKQLIQINDPSSVIDIEIQGSVVHLNGSVTEQASKERILQTIAALPDVTQV
FT                   VDNIHLQPIAPLSLAPLQQDAEQFWDKALLYLPRLALGLSIFLLLFWLSHPLARLLISP
FT                   LAWVTKSELIRLVMQRSISVLIILLGLYIFLRLAGLTQFAVAIISSTGVIGLILGFAFK
FT                   DIAENFISSLLLSVQRPFKLGDVISVEGNLGVVKQVTARATTLVDYDGNHIQIPNATIY
FT                   KNVIKNLTANPRMRGHFVIGIGYDASIRKAQDIAMEIMSDHHGVLADPEPQVLIKNLGP
FT                   STINLQVYFWVNAETHSVPKVASILMRLLVRAYEANQISLPDDARERIFPQGIQLVTNG
FT                   HPQDETPLNTIQSTEHNSNKAQESLEDTHNETSDDISSDTDDIRQQAAQSRDPESGANI
FT                   I"
FT   sig_peptide     complement(338282..338425)
FT                   /locus_tag="Sfri_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.940 at
FT                   residue 48"
FT   gene            338743..338901
FT                   /locus_tag="Sfri_0309"
FT   CDS_pept        338743..338901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0309"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057; KEGG:
FT                   rru:Rru_A2519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70172"
FT                   /db_xref="GOA:Q088Z3"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z3"
FT                   /protein_id="ABI70172.1"
FT                   /translation="MDLLRILIAILLPPLGVFLQVGLSKTLLLNIILTLLGYIPGIVHA
FT                   VWVIAKR"
FT   gene            complement(339162..340562)
FT                   /locus_tag="Sfri_0310"
FT   CDS_pept        complement(339162..340562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0310"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO4478 sensor protein CpxA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70173"
FT                   /db_xref="GOA:Q088Z2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z2"
FT                   /protein_id="ABI70173.1"
FT                   /translation="MLKNNPFNGLFFKLLLGFWLCSSLIIALVSLLPLLQQNHDRSPLP
FT                   PSLERVLKSVAKRIQEQPQLLEGKNLQRLHRSRNKQGDRNHNAGPLRLYLTDGEGQVLN
FT                   TKRVSRGFRRFQLMAEEADHPISHQFRDELIFGPYSFVVNGKPYQLFGRFPDNHPRPWF
FT                   FFFADNKLLTAGLAILLSGLLCGLLAWYLGKPLRSLKHSANALARGDLSSRVDAATANR
FT                   RDEMGQLAQAFNGMADAVQAMINNQQRLMGDISHELRTPLTRLQLALALGRKKGQQSEE
FT                   LERIGYEALQLEALISELLTLSRVSLASHENKVVLELAESLSQVLDDAEFEAEQQGKLL
FT                   QIDIPEALQLPLHPKTLSRAIENLLRNAICYANSQITISAAQVGKHILITVEDDGPGID
FT                   PKELEAIFKPFYRPDTARDRQSGGWGLGLAITQAAITLHQGSIVAENLIGPTGKREGLK
FT                   LSISLPVS"
FT   sig_peptide     complement(340455..340562)
FT                   /locus_tag="Sfri_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.297 at
FT                   residue 36"
FT   gene            complement(340562..341248)
FT                   /locus_tag="Sfri_0311"
FT   CDS_pept        complement(340562..341248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0311"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4477 transcriptional
FT                   regulatory protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70174"
FT                   /db_xref="GOA:Q088Z1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z1"
FT                   /protein_id="ABI70174.1"
FT                   /translation="MNRILLIDDDIGLSDLLSQLLELEGFVLTQAYDGEQGLMMAQQQD
FT                   FDLILLDVMLPKLNGFEVLRALRQRKQTPILMLTARGDEIDRVVGLEIGADDYLPKPFN
FT                   DRELVARIRAILRRAQTTQQDSQANEMMQFGDLRLDPTRQETYCNEQLIILTGTEFSLL
FT                   FHLIEKSGELVTKESLSENVLGKKLMPFDRSLDMHLSNLRKKLPERQDGRPRVKTLRGK
FT                   GYIWIP"
FT   gene            complement(341365..342804)
FT                   /locus_tag="Sfri_0312"
FT   CDS_pept        complement(341365..342804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0975 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70175"
FT                   /db_xref="GOA:Q088Z0"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Z0"
FT                   /protein_id="ABI70175.1"
FT                   /translation="MEYIMNRLIGQLLLLLCVLILAPSSIASTAASTDNSLWYTQQNQQ
FT                   PVVKLHFFWSKTCPHCREAHPFIDALGERFDWIELHDYAISEPGNVDKLMEMGQHTGVE
FT                   PKSVPYFAICGEAVVGYNSHDVTGRFILERLVNCYQRQGGKADIGNKLDDYLGASPVVS
FT                   APLFETCGDTSEDPQAESSCGMSFDQASDITPIPTVQPVDIPLIGAVHPEEMSLPVLTL
FT                   VLAGVDAFNPCAFFVLLFLLSIMVNAGSRKRMLLVGGIFVFFSGFIYFIFMSAWLNLFQ
FT                   LLGGGDGGIIITCAGVLALIAAIVNIKDYFYGRGDVSLSMSVENRGSLIKRMGKLSKAS
FT                   SLPTMILGSTILAILANTYELLCTAGFPMIYTSVLSLSDLDTMQRYLYLIAYNVVYVIP
FT                   LAAIVIVFSMTLGKRKLTEKEGEVLKLMSGIMMLGLGSMLVFNPNSLQNAVFSVGLIFG
FT                   SIVLTFIIARIKRYIVQNKAG"
FT   sig_peptide     complement(342712..342804)
FT                   /locus_tag="Sfri_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.558 at
FT                   residue 31"
FT   gene            343068..343559
FT                   /locus_tag="Sfri_0313"
FT   CDS_pept        343068..343559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0313"
FT                   /product="spheroplast protein y precursor, putative"
FT                   /note="KEGG: son:SO4476 spheroplast protein y precursor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70176"
FT                   /db_xref="GOA:Q088Y9"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y9"
FT                   /protein_id="ABI70176.1"
FT                   /translation="MKTSSIIKTSLVALVASSALLAGQLYAVDAADNTVKTENVTAKGD
FT                   RHHGHKGGMHKMLRKLDLTDAQKVQVKAIFDKYQANRPERPTKEQRAEHRTEMLALITT
FT                   AGFDEAKATEMAEAQQQKHLQKMLTHLKIQNEIYQLLTPEQQQTFQDKFKLGKGHKPRR
FT                   "
FT   sig_peptide     343068..343151
FT                   /locus_tag="Sfri_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            343760..344629
FT                   /locus_tag="Sfri_0314"
FT   CDS_pept        343760..344629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0314"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: son:SO4475
FT                   cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70177"
FT                   /db_xref="GOA:Q088Y8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y8"
FT                   /protein_id="ABI70177.1"
FT                   /translation="MSTSSEYDFWVKLASRASVATALCLIVIKLIAWMYSGSASMLGSL
FT                   TDSFADALASIVNFIAIRYAIVPADKDHRYGHGKAEPLATLAQAAFILGSASLLLLYGG
FT                   EKLIHPVAVTNAMSGIVVSIIAIVLTFALVLLQRHALKKTNSSLVEADSLHYKSDLLLN
FT                   AAVLFALILAQYGWWWADGLFAVFIALFIGNQALGLGYRSIQSLLDRELDNETRDKIKA
FT                   LAKQDPRVKGIHDLRTRQAGKTTFIQLHMELAGDLSLLEAHAIADKAGMTIKAAFDDAE
FT                   VIIHQDPV"
FT   gene            complement(344741..345499)
FT                   /locus_tag="Sfri_0315"
FT   CDS_pept        complement(344741..345499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0315"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; KEGG: xft:PD1809 dihydrolipoamide
FT                   acetyltranferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70178"
FT                   /db_xref="GOA:Q088Y7"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y7"
FT                   /protein_id="ABI70178.1"
FT                   /translation="METLQDKGAKYHLFGDVTTEPLTKIRRIIANNVLESWTHIPHVTH
FT                   HDEVDIGAIEALRHKLNIEHSADVLGVTEEAQIHFTLLPFILKATIEALKLFPAFNASL
FT                   SDDGETLMLKHYYNLGIAVDTSNGLLVPVIKNVDALTLEELAIASQQLAERTRAGKLTF
FT                   ADTEGGSFTVTSLGPMGGTSFTPIINMPEVAILGVSREITKVVAQNGQIVIRPMLPLSL
FT                   SYDHRVIDGAMATRFMVQLKQNLSQAETFC"
FT   gene            complement(345514..345816)
FT                   /locus_tag="Sfri_0316"
FT   CDS_pept        complement(345514..345816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70179"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y6"
FT                   /protein_id="ABI70179.1"
FT                   /translation="MKLKAAFMFLSPDASHEKSVVSTPSVELTVIATRNYDDAVSVATE
FT                   LADLGIKSIELCGGFGHIGTARIANAVEGKATVGVVRFDIHPGLDGASGDSIFTK"
FT   gene            complement(345829..346128)
FT                   /locus_tag="Sfri_0317"
FT   CDS_pept        complement(345829..346128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0317"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: reu:Reut_B5552 alpha/beta hydrolase
FT                   fold:biotin/lipoyl attachment"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70180"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y5"
FT                   /protein_id="ABI70180.1"
FT                   /translation="MANNINAITMPKFGLTMEKGSVSAWHVEVGKTVAVGDEIADIETE
FT                   KVTSAYESPIAGTWRRSVASVGDELPIGSLIGVMASPEIDDAQIDSFIAKFTPT"
FT   gene            complement(346128..347138)
FT                   /locus_tag="Sfri_0318"
FT   CDS_pept        complement(346128..347138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0318"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein; KEGG: reu:Reut_B5551 transketolase, central
FT                   region:transketolase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70181"
FT                   /db_xref="GOA:Q088Y4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y4"
FT                   /protein_id="ABI70181.1"
FT                   /translation="MSIKSFREALNEGMRDAMLEDPSVILLGEDIAGGLGAAGQQDAWG
FT                   GVLGATHGLMTEFGRDRVFDTPISESAFIGAAAGAAATGLRPVAQLMFVDFFGVCGDQI
FT                   INQMAKFRYMFGGKATTPVVVRTLYGAGTGAASQHSQCLYPIFTHIPGLKVVIPSSPYE
FT                   AKGLMLQAIRDDDPVIFFEHKAMFNDKGEVPDEPYVIPFGQARTVREGRDVTIVAIGRM
FT                   VGFASKAADALAQAGIECTIIDPRTTSPLDEKAILASVEQTGRLVVVDEASPRCGMAAD
FT                   ISSIVAEYAFSALKAPIKRVMPPHSPVPFAPNLEQAYIPSVADIEIAVQAVMRKH"
FT   gene            complement(347152..348126)
FT                   /locus_tag="Sfri_0319"
FT   CDS_pept        complement(347152..348126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0319"
FT                   /product="dehydrogenase, E1 component"
FT                   /note="PFAM: dehydrogenase, E1 component; KEGG:
FT                   bur:Bcep18194_A5140 pyruvate dehydrogenase (lipoamide)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70182"
FT                   /db_xref="GOA:Q088Y3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y3"
FT                   /protein_id="ABI70182.1"
FT                   /translation="MHIDREQLLEAYRQMRTIREFEERLHKEFTTGQIPGFVHLYAGEE
FT                   TSAVAVCQQLNNEDHIASTHRGHGHCIAKGCDVMGMMKEIYGRAEGLCAGKGGSMHIAD
FT                   LDKGMLGANGIVGGGGPLACGAALSSKVRGTDGVAVAFFGDGAFNQGTILESMNFASVN
FT                   QLPVLFVLEDNGYAESTASAWSMGGHDPVARAAGFGIKGKKVDGHDYFAVYRAAKEAVD
FT                   AMRAGLGPRFIAIEFTRYYGHFEGDATTYRPPGEVRDERTYLDALKFFRARVTGGEMLT
FT                   VVELDAIDDEVKTLIDAAVDEAKAAEIPNIDQLTTDVYANYSL"
FT   gene            complement(349239..350651)
FT                   /locus_tag="Sfri_0320"
FT   CDS_pept        complement(349239..350651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0320"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis family"
FT                   /note="KEGG: son:SO4472 nitrogen regulation protein NR(I);
FT                   TIGRFAM: nitrogen regulation protein NR(I); PFAM: response
FT                   regulator receiver; sigma-54 factor, interaction
FT                   domain-containing protein; helix-turn-helix, Fis-type;
FT                   ATPase associated with various cellular activities, AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70183"
FT                   /db_xref="GOA:Q088Y2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y2"
FT                   /protein_id="ABI70183.1"
FT                   /translation="MNISEQVWILDDDSSIRWVLEKALKGASLSTASFAAAESLWQALE
FT                   ASQPQVIVSDIRMPGTDGLTLLDRLQLHYPHIPVIIMTAHSDLDSAVSAYQAGAFEYLP
FT                   KPFDIDEAINLVERALTHATEQAPQPVIDTTIKTPEIIGEAPAMQEVFRAIGRLSRSSI
FT                   SVLINGQSGTGKELVAGALHKHSPRKDKPFIALNMAAIPKDLIESELFGHEKGAFTGAA
FT                   NVRQGRFEQANGGTLFLDEIGDMPIDVQTRLLRVLADGQFYRVGGHQAVQVDVRIIAAT
FT                   HQNLEVQVQKGTFREDLFHRLNVIRVHLPPLSQRREDIAQLANHFLNTAAKEIGVEPKI
FT                   LTKETAVKLANLPWPGNVRQLENTCRWLTVMASGQEILPQDLPPELLKDPIATQQKQVG
FT                   ASDWQTALTDWIDEKLAAGESDLLTEVQPEFERILLETALRHTQGHKQEAAKRLGWGRN
FT                   TLTRKLKELSMD"
FT   gene            complement(350688..351725)
FT                   /locus_tag="Sfri_0321"
FT   CDS_pept        complement(350688..351725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0321"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: son:SO4471 nitrogen regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70184"
FT                   /db_xref="GOA:Q088Y1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y1"
FT                   /protein_id="ABI70184.1"
FT                   /translation="MDTNNLLNHLVTAVLVINNELKPSYANAAAAQLLGVGNYKLLEQT
FT                   LPELYQLMGVEPQLLRDAINAGQGLTVNTAALITLDGQHHTIDITLVPIENDNNLSILE
FT                   LRQVDQQRRIHQQLNMDAQQQAAQFLVRNLAHEIKNPLGGLRGAAQLLSRELDSPELKE
FT                   FTSLIIEQADRLRNLVDRLLGPQRPTQHTEHNIHQVIQKVLKLVEMALPDNICLKRDYD
FT                   PSIPDIQMDPDQMQQAVLNIVQNAIQALEHCGGDIVIRTRTQHQVTIGTQRYKVVLALS
FT                   IIDNGPGIPAELMDTLFYPMVTGRDEGSGLGLSIAHNIARLHGGRIDCVSAPGHTEFII
FT                   NLPLQ"
FT   gene            complement(351865..352389)
FT                   /locus_tag="Sfri_0322"
FT   CDS_pept        complement(351865..352389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70185"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Y0"
FT                   /protein_id="ABI70185.1"
FT                   /translation="MRLILLISLLLLSAQSLATVYRWVDEKGKVHYSDEQKNNAEAVEL
FT                   NENTQNNMTINTPTKINITPTTEASINYSISITSPQEEATVRDNNGAFTVSVSITPQLP
FT                   RGVLMTLLVDGVITAPAQVSNIFQLTGINRGEHSLVVNAVTQSGKVLASSSPRKIFLHQ
FT                   ASVFGPAKKSK"
FT   sig_peptide     complement(352333..352389)
FT                   /locus_tag="Sfri_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 19"
FT   gene            complement(352521..352832)
FT                   /locus_tag="Sfri_0323"
FT   CDS_pept        complement(352521..352832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0323"
FT                   /product="protein of unknown function DUF1255"
FT                   /note="PFAM: protein of unknown function DUF1255; KEGG:
FT                   son:SO4467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70186"
FT                   /db_xref="GOA:Q088X9"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088X9"
FT                   /protein_id="ABI70186.1"
FT                   /translation="MSMLQQVSVAKKANVYFNGKVISRSVVLADGSKQTFGVVLPGEYE
FT                   FSTAQGEIMQVISGKFDVLLPGKTEWVAYAEASQFELAPNVSFSIRTDQISEYCCQYI"
FT   gene            complement(353180..354991)
FT                   /locus_tag="Sfri_0324"
FT   CDS_pept        complement(353180..354991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0324"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor, GTP-binding; elongation factor
FT                   Tu, domain 2 protein; KEGG: son:SO4408 virulence regulator
FT                   BipA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70187"
FT                   /db_xref="GOA:Q088X8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q088X8"
FT                   /protein_id="ABI70187.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKMLAQSGTLASRGEATERVMDS
FT                   NDLEKERGITILAKNTAIQWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTKKAFAQGLKPIVVINKIDRPSARPDWVIDQVFDLFVNLGATDEQLDFPIV
FT                   YASALNGFATLDPDVASDDMTPLFQTIVEKVAFPDADAEAPFQMQISQIDYNSYVGVIG
FT                   IGRITRGSVKTNQQVTIIGADGKTRNGKMGQVLGYMGLDRTEVPIANAGDIVAITGLGE
FT                   LKISDTICAVNAVEAMPPLTVDEPTLTMTFQVNTSPFAGKEGKYVTSRNILERLQTELV
FT                   HNVALRVEETESPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVILKTIDGELHEP
FT                   YETVTVDVEEEHQGTVIEKLGVRKGEMKDMQLDGKGRVRIDFVIPSRGLIGFQTEFLTA
FT                   TSGTGLIYHSFDHYGPHKGGDIGQRANGVLISNATGKALTFALFALQDRGRMFIGHAAE
FT                   VYEGQVVGIHARSNDLTVNCLKGKQLTNMRASGTDEAQVLTTPINLTLEQALEFIDDDE
FT                   LVEVTPKNIRVRKRFLTENERKRNNRG"
FT   gene            355472..356881
FT                   /locus_tag="Sfri_0325"
FT   CDS_pept        355472..356881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0325"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: son:SO4410 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70188"
FT                   /db_xref="GOA:Q088X7"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q088X7"
FT                   /protein_id="ABI70188.1"
FT                   /translation="MSVESVLKQLVELEVKFVDLRFTDTKGKEQHVSIPSHQVDEDFFE
FT                   DGKMFDGSSIVGWKGINESDMVLMPDPTTFVLDPFTEETTALIRCDILEPGTMTGYDRD
FT                   PRSIAKKAEAYLISTGIADTVLIGPEPEFFLFDDVRFGTDMSGCFVKIDAKEASWNSAK
FT                   SYEEGNTGHRPMVKGGYFPVAPVDSSQDLRSAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTLTKKADEIQILKYVVHNMAHAYGKTATFMPKPIVGDNGSGMHVHQSLAKDGVN
FT                   LFAGDKYAGLSDLALYYIGGIIKHARALNAFTNPSTNSYKRLVPHFEAPVMLAYSARNR
FT                   SASIRIPVVPSPKGRRIEARFPDPHANPYLGFAALLMAGLDGIQNKIHPGEAMDKDLYD
FT                   LPAEEAAEIPQVATSLENALENLQADHEFLTKGGVFSEDFIQSYIQLKTAEAERVARTT
FT                   HPLEFEMYYSL"
FT   gene            357125..357325
FT                   /locus_tag="Sfri_0326"
FT   CDS_pept        357125..357325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0326"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /note="KEGG: rfr:Rfer_2487 response regulator receiver
FT                   modulated diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70189"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q088X6"
FT                   /protein_id="ABI70189.1"
FT                   /translation="MATASSILELIKQPFQIGTYSLTISACIGAAIYKGVDRDTDSLIH
FT                   RADVAMYQAKYAGKSQVILAD"
FT   gene            357379..357918
FT                   /locus_tag="Sfri_0327"
FT   CDS_pept        357379..357918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0327"
FT                   /product="methylation site containing protein"
FT                   /note="PFAM: methylation site containing protein; KEGG:
FT                   hch:HCH_06146 type II secretory pathway, pseudopilin PulG"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70190"
FT                   /db_xref="GOA:Q088X5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q088X5"
FT                   /protein_id="ABI70190.1"
FT                   /translation="MIHTSSFNHGRLSWRKQQGFSLIELVVVIIILGILAVVVAPKFIG
FT                   LKSNAYASSMQGVAAAINSGKILVYSACVISAGCDETAPGTSNGLGNSIMVQGQSVTLA
FT                   YGYPRHTSAGIVRMINIADNSGGGEFNITTYDVNNRSGLRIRPNADYAANKCEIRYSQP
FT                   QAAGESPLVVVDIDEC"
FT   gene            358111..358581
FT                   /locus_tag="Sfri_0328"
FT   CDS_pept        358111..358581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0328"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   pha:PSHAa0053 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70191"
FT                   /db_xref="GOA:Q088X4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q088X4"
FT                   /protein_id="ABI70191.1"
FT                   /translation="MDKKDLKLLEILQRQGRMAVSELADKVNMSDTPCLRRVKKLEQDK
FT                   VILGYGAQVDPFKVGLNVVVYTSIRLTEHTDQSTALFESTMAQLPQVMECAVVTGAYDY
FT                   MLKIVAKDLVSYEQFIKKSLGNLKFVASIETTVVLKPIFSRTALPVDQSPID"
FT   gene            complement(358697..359344)
FT                   /locus_tag="Sfri_0329"
FT   CDS_pept        complement(358697..359344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70192"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:Q088X3"
FT                   /protein_id="ABI70192.1"
FT                   /translation="MKKWISLALLSSSLLLSGCQSAYYGAMEKVGYHKRDIMVDRVQEA
FT                   KESQEEAQEQFSSALEEMQALLAFDGGDLEDAYNKAKDEYESAQSAADEVSHRIEKVED
FT                   VADALFDEWQTEIEEISKASLRRNSTSKLNETKRSYKTLVRSMRRAEAKMPPILTAMKD
FT                   NMLYLKHNLNAQAIGAIKGEFANLQTDISSLIKEMNKSIAESNKFIASMEQG"
FT   sig_peptide     complement(359276..359344)
FT                   /locus_tag="Sfri_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.577 at
FT                   residue 23"
FT   gene            complement(359407..359631)
FT                   /locus_tag="Sfri_0330"
FT   CDS_pept        complement(359407..359631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70193"
FT                   /db_xref="GOA:Q088X2"
FT                   /db_xref="UniProtKB/TrEMBL:Q088X2"
FT                   /protein_id="ABI70193.1"
FT                   /translation="MSQQGSAGNVLAAVASLFFPGLGQLLQGRILAALLFFCITAVCYF
FT                   FFVLVIPAIIGGLFHLWSIIDAAKFKSGS"
FT   gene            359737..360699
FT                   /locus_tag="Sfri_0331"
FT   CDS_pept        359737..360699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0331"
FT                   /product="tRNA-processing RNAse BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: son:SO4401 ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70194"
FT                   /db_xref="GOA:Q088X1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088X1"
FT                   /protein_id="ABI70194.1"
FT                   /translation="MPKKFDYSPIAAFFSGIWQFLLHLKQRLAEDQINIRAGHLAYVTL
FT                   LSLVPMLAVTMSMLSAFPVFKGIRGNIEGFIYNNFIPAAGDTVQVHINEFVANASKGTF
FT                   VGIIALVFVAIMLISAIDKALNNIWRITEKRSYVVSFSMYWMVLTLGPVLIGASLVATS
FT                   YVVSLEVVAGTELSGLVPWIVERLPLIFSAASILLLYMVVPNKKVHFLHALLGAIVAAV
FT                   LFEAGKKGFAFYVTQFPSYEAIYGALAVVPILFVWVYLSWMIVLLGAEITAALPEYLES
FT                   LAVIAEDLKAEIFAETEDEHVNNVHDPIVVDKSVPSDKS"
FT   gene            360849..361286
FT                   /locus_tag="Sfri_0332"
FT   CDS_pept        360849..361286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0332"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   son:SO4398 D-Tyr-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70195"
FT                   /db_xref="GOA:Q088X0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088X0"
FT                   /protein_id="ABI70195.1"
FT                   /translation="MIALIQRVKRASVSVDNTIVGKIDQGLLVLLGIEREDNIEKMVKL
FT                   ATKVINYRVFSDEDGKMNLNLAQVGGQLLVVSQFTLAADTGKGLRPSFSCAATPEQADR
FT                   LYLAFVEYCRQQGVMTQTGQFGADMQVELVNDGPVTFNLQV"
FT   gene            361356..361850
FT                   /locus_tag="Sfri_0333"
FT   CDS_pept        361356..361850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0333"
FT                   /product="thioesterase domain, putative"
FT                   /note="TIGRFAM: thioesterase domain, putative; KEGG:
FT                   son:SO4397 hypothetical acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70196"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W9"
FT                   /protein_id="ABI70196.1"
FT                   /translation="MLDISFTEAQSDAKVTALLQTLCETWHSTIPVSQFMNIKPVLFNG
FT                   DSLQVTAPLEPNVNLHHTMFAGSIYTLMTLTGWGMVWLQQQLSQAHGDIVLADAKVRYL
FT                   KPVTKQPYAKVIWPYTDLNPLNRGRRVKITLEVALYCDDIMCATFTGQFVSLPPKNISI
FT                   D"
FT   gene            362004..362597
FT                   /locus_tag="Sfri_0334"
FT   CDS_pept        362004..362597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0334"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   son:SO4396 acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70197"
FT                   /db_xref="GOA:Q088W8"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088W8"
FT                   /protein_id="ABI70197.1"
FT                   /translation="MAKVLILKSSILGSYSQSSALVDYLNQQWSSKGAQIKVRDLGENT
FT                   LPMLDGELASGLRGGDNLSERQLSALALSDELVAEIKAHDTIIIAAPMYNFGIPTTLKN
FT                   WIDLIARAGVTFTYTDTGAVGLIEGKRAIIVTTRGGAHKGGPTDHVVPYLTTVLGFIGI
FT                   NNVETIYAEALNMGPDAAETGISQAKLAIDAITL"
FT   gene            362853..363464
FT                   /locus_tag="Sfri_0335"
FT   CDS_pept        362853..363464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0335"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   sde:Sde_0045 GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70198"
FT                   /db_xref="GOA:Q088W7"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W7"
FT                   /protein_id="ABI70198.1"
FT                   /translation="MKINKIVIASALILLAVSLVPILMLINQWDSGSQSYGITTSDSQQ
FT                   IHFRWQDVNQQVHQYPTSAGTYTYLFLGFLSCSEICPIRIEQLNQLEQRIEQDASFNKA
FT                   EVQFLFVTIDPDNDTLALRQAVIDARSTHFVSASLSESDLHQLELRLSDNINRQLATIN
FT                   HVGNLFLLNPNGQIARIYTAKQLSISKMLIDLNHIISSQL"
FT   sig_peptide     362853..362936
FT                   /locus_tag="Sfri_0335"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.884) with cleavage site probability 0.381 at
FT                   residue 28"
FT   gene            363475..364977
FT                   /locus_tag="Sfri_0336"
FT   CDS_pept        363475..364977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0336"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   pha:PSHAb0277 putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70199"
FT                   /db_xref="GOA:Q088W6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W6"
FT                   /protein_id="ABI70199.1"
FT                   /translation="MNDAQTVTLLKKHDLYIYRLLMLQAPLLVVSGFFGAQMLTFSITA
FT                   AIAILVIVQLSYSLLKGTELFAIVGAVIMMTVSGLLIQSQMGMIEMHFHIFATMGVFLI
FT                   YLRWQPLLAALLTVAIHHILMTYIQLQDIEVLGTQLMIFAGNCNWTIMLVHALFAATET
FT                   FILIRIALFMRTDSLANQRIAGAIEQISANKDLSMRLASADTHAEISFNLMLEELSQLF
FT                   NDYRDIAVKMASTSDNLMSLSDQTQQAVQQQNDQARMIAESTQDVIDNFQQMAHDTQIS
FT                   ADQAKVGAASSLGDSQSALSIMKDMQALETNMIDVAESMTDLTTDISAITTLLQAIRSI
FT                   SDQTNLLALNAAIEAARAGESGRGFAVVADEVRTLAKRTSQSTDGIEKVLSRLNISMLK
FT                   TVESMDQGKQRTTQNVFHTSGIAKGLEQRSAQIGQVATLSHNVANGTQQQADRLTQIGS
FT                   EILDNAQAVVLLSAQVQKLAGGAVEMKQITQDYQTKAAAYKV"
FT   gene            complement(365049..366275)
FT                   /locus_tag="Sfri_0337"
FT   CDS_pept        complement(365049..366275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0337"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: son:SO4383
FT                   3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70200"
FT                   /db_xref="GOA:Q088W5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W5"
FT                   /protein_id="ABI70200.1"
FT                   /translation="MKRVVVTGMGGISALGQDWQQIKASLLAKHNCVIRMDEWDRYPGL
FT                   NTRLAAPVTDFTLPAHYSRKKIRSMGRVSMMATRASELALEDAGLLNDPILNSGQAGVA
FT                   YGSSTGSTDPIMGFGDMLKTGEMSGLTATSYIRMMAHTTAVNIGVFFGLQGRIHTTSSA
FT                   CTSASQGIGYAYEAIKYGMQTIMLAGGGEELCPTEAVVFDTLYATSTKNDTPELTPRPF
FT                   DKNRDGLVIGEGACTLILEELEHAQARGANIYAELVGFGTNSDGQHVTQPNANTMEVAI
FT                   RLALKDAQLSAQDIGYISAHGTATDRGDIAETAATHAVFGAETPISSLKSYTGHTLGAC
FT                   GSLEAWSSINMMNEGWFAPTLNLNDVDPECAPLDYIKDDIRHIDTDYIMSNNFAFGGIN
FT                   TSLIFKRWR"
FT   gene            complement(366272..366997)
FT                   /locus_tag="Sfri_0338"
FT   CDS_pept        complement(366272..366997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0338"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative; PFAM: short-chain dehydrogenase/reductase SDR;
FT                   KEGG: son:SO4382 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70201"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W4"
FT                   /protein_id="ABI70201.1"
FT                   /translation="MNNRVLVTGSSRGIGKAIAIKLAENGFDIALHFHSNHAAAAQVQK
FT                   TLLDLGVQVSLLQFDIADRQAVKLAIETDIAENGAYYGVILNAGINRDTAFPAMTEDEW
FT                   DSVIHTNLDGFYNVIHPTVMPMVQARKGGRIITLASVSGIAGNRGQVNYSASKAGIIGA
FT                   TKALSLELAKRKITVNCIAPGLIETDMVTDISTDIVNQIVPMKRMGKPSEIAGLANFLL
FT                   SDDAAYITRQVISVNGGMI"
FT   gene            complement(367061..367552)
FT                   /locus_tag="Sfri_0339"
FT   CDS_pept        complement(367061..367552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0339"
FT                   /product="Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ"
FT                   /note="PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ; KEGG: son:SO4381 thioester
FT                   dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70202"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W3"
FT                   /protein_id="ABI70202.1"
FT                   /translation="MSIATATPAMLAQDISTFIPHRAPMILIDNVLEHRPDCLITATHI
FT                   SPNSAYFDAQLNGVPNYVGIEYMAQSIAALAGVEALLRDDDIRVGFLLGTRKLQMHIDT
FT                   FTLGESYRTQVTRLYQEESGLAVFDCQIYHHEILVAAANVNVFQPQDTQAYIDESQADG
FT                   "
FT   gene            complement(367557..368759)
FT                   /locus_tag="Sfri_0340"
FT   CDS_pept        complement(367557..368759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0340"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: son:SO4380
FT                   3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70203"
FT                   /db_xref="GOA:Q088W2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W2"
FT                   /protein_id="ABI70203.1"
FT                   /translation="MNSRIAITHIGLCTPLGNSPEEVLPRLISGDISAMQWRDNLLFDA
FT                   PTLVGCVDDKRLIEIADRLSLFACRNNRLLNTAAQQLVPAIEQAKKRLGADRIGVILGT
FT                   STSGISKGEAALKYQLEHGHFPPSYHYSQQELGSPSDYLKQLFELSGPCYTVSTACSSS
FT                   AKVFASAQRLLNANMCDMVIVGGVDSLCQLTVNGFAALESVSKGHCNPFSRHRDGINIG
FT                   EGAALFTLERGQSDVMLAGIGESADAHHISAPHPQGLGAIAAMQQALTEANITAKQIDY
FT                   LNLHGTATPKNDAMESRAVTAVFGHSLPACSSTKPLTGHTLGAAGAIEAAFCYLLLSPL
FT                   NHDKRLPPHIWDGQQDANDPNIALVSANNNSGLNQLNFIMSNSFAFGGSNASLIFCRKD
FT                   A"
FT   gene            complement(368838..369458)
FT                   /locus_tag="Sfri_0341"
FT   CDS_pept        complement(368838..369458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70204"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W1"
FT                   /protein_id="ABI70204.1"
FT                   /translation="MLLNLLGLSAKRILLRVVALLLLSLLSACSQQIERQTCVPLASEA
FT                   QYCLSSASAVLTTSPQQDISLSQMVSFTHGQENHELLTQLELNSQQMTLVGLAPLGQAL
FT                   FTLVYDGQTLQSQQSMLLGEQFKAEYLMAIMQLIYWPTEQVNQHLTGGELVTMACDMPL
FT                   CKQLIDASGTLITITYSDIDPWLAQVNVDIDAADIHMQINPID"
FT   sig_peptide     complement(369366..369458)
FT                   /locus_tag="Sfri_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.467 at
FT                   residue 31"
FT   gene            complement(369448..370716)
FT                   /locus_tag="Sfri_0342"
FT   CDS_pept        complement(369448..370716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0342"
FT                   /product="tryptophan halogenase"
FT                   /note="PFAM: monooxygenase, FAD-binding; FAD dependent
FT                   oxidoreductase; tryptophan halogenase; KEGG: son:SO4378
FT                   FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70205"
FT                   /db_xref="GOA:Q088W0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q088W0"
FT                   /protein_id="ABI70205.1"
FT                   /translation="MPFSHSHTVSNMDVDVAIIGAGPSGAIAASLLRQQGHQVVVIEKQ
FT                   HFPRFSIGESLLPCCMQFLEQAGMLDAVNQAGFQFKNGAAFQHQGRYTTFDFTDKFTPG
FT                   PGTTFQVQRADFDKLLADTAISQGVEIRFGHQVDAIDLTHNPRLTVTNDQGAQYQVNAK
FT                   FVLDASGFGRVLPRLLNLEQPSNLPPRSAIFTHIEDNIRDPHFDRNKILISVHPQHKDI
FT                   WYWLIPFSNNRCSIGVVAEPHLLEHLSGSLEQQLLAVINEEPELKKLLSNANIVQPCAT
FT                   LKGYSANVTTLATNKFALLGNAGEFLDPVFSSGVTIAMQSASMAVACLHKQLNGQTVDW
FT                   DSEYSAPLMQGVNTFRTYVQAWYDGRFQDVIFYQQADNKIKQMICSILAGYAWDMSNPF
FT                   VKESERRLNTIVELCQEPKPNVA"
FT   gene            complement(370706..373114)
FT                   /locus_tag="Sfri_0343"
FT   CDS_pept        complement(370706..373114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70206"
FT                   /db_xref="GOA:Q088V9"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V9"
FT                   /protein_id="ABI70206.1"
FT                   /translation="MQPISLTELLSPIGRFVLWVLLLLTMLASGLIQWQQGAHIQTDIL
FT                   AMLPHLQQDKLTETALNRVEQQLANQVYIAVKANNDNQAISAAQQLMDALDKQPQPPFI
FT                   HIRSGADDHLQDLAKLYFEHRFTLLTAEQAKAIETDNWRQLLNAAQNQLYSAFGFANSQ
FT                   LLSNDPLLMFPANLLALSPNSALRSQQGILLTDTTEGVAAIVMAKGRDSAFSPTAQQQQ
FT                   IQALKSAFSQVTQHYPDVSFLKAGALFHAIAATESAKQEISRIGLISMLGIILLVWLAF
FT                   RSIMPLFAALLTLTTGVVFAFVATLSIFGELHLLTLVFGTSLIGVAIDYSFHFYCEKQA
FT                   HPNNNATDTLKQIFPALTLALATSASAFIAIGFTPFPGMQQVAVFCAAGLIGAYLTLLL
FT                   VFPLLGNHALKPTPGLTLAQGYLALLQRIFTPNQLWQKIAIAALLIGLATILFFGLSQT
FT                   DSNDDIRQLQQSPAAITTEENQLRQLLSGGTDNQFIVVSGPNEQALLQTLEQLTPVLDK
FT                   AVTDGELDQAISLSRFMPSIAKQQQHYQLQQQLYGQHLDEIINEMGLDDSISTSMIAQL
FT                   NHAESQWLTPTMVLAKANDDLQTLWLGAIPTTDKPQQFGAIVLLGGIHSLASLEQRLTE
FT                   HKWPLGQVRLIDKVGDISHLMGKYRQLTLQLLMWVFALASLIFSIKYGIKLAFAIVAVP
FT                   ALSVLLTLACLGLVGSNISLFHALALILVLGIGIDYSLFFAEAKHTSRGVMMAIFMSAC
FT                   STLLAFGLLALSQTHAIHFFGLTLLFGISFSFLLAPFISFITRKTVNAI"
FT   gene            complement(373114..373929)
FT                   /locus_tag="Sfri_0344"
FT   CDS_pept        complement(373114..373929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70207"
FT                   /db_xref="GOA:Q088V8"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V8"
FT                   /protein_id="ABI70207.1"
FT                   /translation="MSARSRVFVSLFTSIFISVLARVSSIIMLCCLCIAATSASEHPPA
FT                   SNNEPLTQAQLADIQALYTQPASTEALNALAQQLNLQLDTRGQFVQLRYLQVLKKPLLS
FT                   QGQFIFSPTQGLVWQQQRPFNTLMVLKDQQLIQQNSQGKIQHFSAGANGNPIAQQLPRL
FT                   LQAIMAGDIDALSADFSLFMLATQSINKPETQPADKSWQLGLQAKDPQVQSSMGNITLS
FT                   GDTLIRSLIMTSNQANVRDYTQIQFTQTQQGPLSEAELALFSLGNESAK"
FT   sig_peptide     complement(373804..373929)
FT                   /locus_tag="Sfri_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.642 at
FT                   residue 42"
FT   gene            complement(373929..374360)
FT                   /locus_tag="Sfri_0345"
FT   CDS_pept        complement(373929..374360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0345"
FT                   /product="conserved hypothetical 4-hydroxybenzoyl-CoA
FT                   thioesterase"
FT                   /note="KEGG: son:SO4375 hypothetical 4-hydroxybenzoyl-CoA
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70208"
FT                   /db_xref="GOA:Q088V7"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V7"
FT                   /protein_id="ABI70208.1"
FT                   /translation="MKGLLLTEMEMVIPFHDVDSMGITWHGNYLRYFEVVRCQLLDKLG
FT                   YNYRTMLESGYAWPIVDVQIKYVKSSTFDQKIKVIAAIVEWENRLRINYQIVDVDTNAR
FT                   ITKGYTIQAAVEIATQELCFVTPEIFQQKIHPLLDASQV"
FT   gene            complement(374361..375923)
FT                   /locus_tag="Sfri_0346"
FT   CDS_pept        complement(374361..375923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0346"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   son:SO4374 histidine ammonia-lyase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70209"
FT                   /db_xref="GOA:Q088V6"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V6"
FT                   /protein_id="ABI70209.1"
FT                   /translation="MSNTSSPSSSAEKTVHLGQSYLSLEQVVAVAKGATVKLADAADYV
FT                   EYIQKGARFIDSLLHEEGVVYGVTTGYGDSCTVNVSLDLVHELPLHLTRFHGCGLGDVF
FT                   SPMQARAIMACRLNSLAVGKSGVSYLLLQRIEWLLNNDITPVIPQEGSVGASGDLTPLS
FT                   YLAAVLVGEREVIYQGKRQATKDVYLKFGMMPLTLRPKEGLALMNGTAVMTALACLAYD
FT                   RSQYLTRLSSRITAMASLTLKGNANHFDEILFAAKPHPGQNQIASWIREDLNHHAHPRN
FT                   SDRLQDRYSIRCAPHIIGVLQDALPFMRQFIETELNSANDNPIVDAEGEHILHGGHFYG
FT                   GHIAFAMDAMKNAVANIADLIDRQMALVMDPKFNNGLPANLSAAEGERRAINHGFKAVQ
FT                   IGVSAWTAEALKNTMPASVFSRSTECHNQDKVSMGTIAARDCMRILQLTEQVAAAALLA
FT                   MSQGIQLRVIQKELDPNSLTPSLANTLAQVSEDFELLTEDRPLEAVLRQTVDKIQLGLW
FT                   EVC"
FT   gene            complement(375928..377748)
FT                   /locus_tag="Sfri_0347"
FT   CDS_pept        complement(375928..377748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0347"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; lipid A
FT                   biosynthesis acyltransferase; KEGG: son:SO4373 glycosyl
FT                   transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70210"
FT                   /db_xref="GOA:Q088V5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V5"
FT                   /protein_id="ABI70210.1"
FT                   /translation="MKLTLVIPNYNHHIAIEQTLTDLAKFNLPCYLVDDGSQDETRYIL
FT                   QAMAEKFSWVTLINHPFNRGKGAAVTSGLRQAYRDGFSHVLQVDADGQHNLDDIPLMIS
FT                   TAEQQPQALISGQPIYDDSVPKGRLYGRYITHFWVWVETLSLDIQDSMCGFRVYPLEAT
FT                   EQLLSQQALGERMDFDIEIMVKLHWQGTPVVHVPTKVIYPEDGISHFQGLQDNVRISWM
FT                   HTKLFFGMLTRLPQILNKNTPHQHWSSMGERGSYWGIKLLAECYRLGGHWLCRAIMYPV
FT                   IGYFFLTGASARQASMNFLARVQQQVPDHPDLHQPTQWRDSLNHFIAFGNAALDRIDAW
FT                   CDRIKLNQVDFNDRHILANQVASGRGAVLIVSHLGNLELCRAISIHQQKVKVNVMVLTQ
FT                   HAENFNKVLQQLNPQSSLNLIHVNELDPSTSMLLQQKIDMGEIVVIAADRTSSNSQGRV
FT                   VYLPFLGHEAPFPQGPFILASLLNCPVYTMFCIRQQGRYKVHVEHLSDSLKGPRAGRIA
FT                   RLTDAMKLYSQRLEYFAKQAPLQWFNFYDFWHKDELIDRPLSRPATAVNTVTAPNTSSA
FT                   PNTGSALNTSAASNTNTAPANSTTSPSQDN"
FT   gene            complement(377745..378137)
FT                   /locus_tag="Sfri_0348"
FT   CDS_pept        complement(377745..378137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0348"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: son:SO4372 thioester dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70211"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V4"
FT                   /protein_id="ABI70211.1"
FT                   /translation="MIKSELPHIVSHEGDNNLYQWRLFVSADLAFFDGHFPQQAVLPGV
FT                   TQLDWAVKLGCEAFGYSAQVATLEVLKFQQLILPDTYVDLIIEHQPQKAKLIFSYRDQD
FT                   KRFASGRIALKPAVVTTAPIANEIAS"
FT   gene            complement(378130..379497)
FT                   /locus_tag="Sfri_0349"
FT   CDS_pept        complement(378130..379497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70212"
FT                   /db_xref="GOA:Q088V3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V3"
FT                   /protein_id="ABI70212.1"
FT                   /translation="MNKLLLNWLSTGPASQQLISFDHHDIMTGSLFCAQVAHLHAQLIQ
FT                   SDAQRWLLAAKHSDLFAAGLCATLLAGKQVILPANTQRGTLSELNHEFDAIIADTPLCE
FT                   VREYIALKKELSLPAATWPKTKLLGELVLFTSGSSGQPKAIKKTLQQLDAEVSILEQTF
FT                   AEHLPHCSVVSTVSHQHIYGLLFKILWPLAASRAFLSEQIDFPETLSYYLAIMPNLCLI
FT                   SSPAQLTRLPDALENQKQQRIPSLIFSSGGPLNFDAAQAVKQCFNQLPIEIFGSTETGG
FT                   IGYRRQQQPMQPWQAFTQVNVDMDPQDGALMLQSVYLDNPTQWLKCDDKIELLTDGKFR
FT                   LLHRLDRIVKIEEKRLSLAQVEHLLQTHPFVSEAAVTVLEQPRTMLGAAVCLSELGQQT
FT                   LKAEGKLAVNNALKNHLLSQFERITLPRRWRYPAHLPLNSQGKRTQSEIVALFSHD"
FT   gene            complement(379490..380041)
FT                   /locus_tag="Sfri_0350"
FT   CDS_pept        complement(379490..380041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70213"
FT                   /db_xref="GOA:Q088V2"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V2"
FT                   /protein_id="ABI70213.1"
FT                   /translation="MRLILQIMTTLVIIAYPVAVYFGLQYLPPGTIALLLCLLLLLRFM
FT                   VTKQQVKSMTLPILVGIGLTAASFITQRNDWLLFYPVVINLSMLGLFSYSLMNGPSMIE
FT                   RLARLKEPDLPDSAIPYLQTVTKLWCGLFIVNGAVATYTAIATSIEIWTLYNGLIAYLF
FT                   MGLLLSGEWIYRRFWLKKHE"
FT   gene            complement(380041..380289)
FT                   /locus_tag="Sfri_0351"
FT   CDS_pept        complement(380041..380289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0351"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: son:SO4369
FT                   acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70214"
FT                   /db_xref="GOA:Q088V1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V1"
FT                   /protein_id="ABI70214.1"
FT                   /translation="MQNREQILEMLSGILIDEFEIEAVDITLEASLYEDLDLDSIDAVD
FT                   LVIKLQQLTGKKIQPEAFKTVRTVNDVVNAIEGLIKS"
FT   gene            complement(380298..380552)
FT                   /locus_tag="Sfri_0352"
FT   CDS_pept        complement(380298..380552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO4368 acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70215"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q088V0"
FT                   /protein_id="ABI70215.1"
FT                   /translation="MNLHNQIKQLIIDCLDLEDVTVDDIETDAALFGDGLGLDSIDALE
FT                   LGLAIKKEFDVKIEANSDATKAHFFSVASLASFIESQRV"
FT   gene            complement(380581..381435)
FT                   /locus_tag="Sfri_0353"
FT   CDS_pept        complement(380581..381435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0353"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   son:SO4367 acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70216"
FT                   /db_xref="GOA:Q088U9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U9"
FT                   /protein_id="ABI70216.1"
FT                   /translation="MPNQHHTRQHTDAIVQKKATAPKLSGLRYIPRWVGGVCCYIAFGL
FT                   GGLLSSLTILPLLRFWPGEKTVRVARAQKAVSWMFKAFVAMLSFAGVIAVSTKNIEALQ
FT                   QTKGKVVIANHPTLVDVVVLISLMPNAGCIVKQSLWRNPFIRGVLASAGYIPNRGADWL
FT                   LHDCQQVLRTDTNLIIFPEGTRTLTGNLVNPFARGAANIALRTQTDILPVVLRTDVAGL
FT                   TKQQSWYQIPRQTINMSVEIGTSMSYLLYDAKRGNEAKMARQLTRDLQQFYLDTLKQPI
FT                   KSH"
FT   gene            complement(381428..382207)
FT                   /locus_tag="Sfri_0354"
FT   CDS_pept        complement(381428..382207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70217"
FT                   /db_xref="GOA:Q088U8"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U8"
FT                   /protein_id="ABI70217.1"
FT                   /translation="MHLEFELLSWGAWSPDFQTPESWLQWQQPNGNLAPKPDSPPLAHI
FT                   PAMQRRRFSRLTKMMLTAAYQCQPENNCRSIFSSRHGELTRTLGLLKDITQQQALSPMA
FT                   FSQSVHNTASGIFGIVNNNTASSTSIAAGEQTLTQALIEAYAQLAQSPQPVLVVFGDDP
FT                   VPPVYSEFTHEVELPLALGLYLAPFNSSAPQAKNQLADTTLQHDSAQRMTLSVSDHPPE
FT                   HHSQNNICMSELIHHIASAKHIQGKLCHWYWSLEHHA"
FT   gene            complement(382456..383343)
FT                   /locus_tag="Sfri_0355"
FT   CDS_pept        complement(382456..383343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70218"
FT                   /db_xref="GOA:Q088U7"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U7"
FT                   /protein_id="ABI70218.1"
FT                   /translation="MQVNEEDRITPQAAEKPGSNMLLIAIAVIALLGASSYFYFTSDDA
FT                   EEFEPVVITPVELPESVPETPIEQTPIEEPQNVTTTDDVVPTGESETATEAVVAEPLPA
FT                   LAESDDFVEAKTLAIANGMKIAPMILKKDIARQFVVFVDNLAQGDIVRKASPLKGPDTQ
FT                   FTVSEITNKTYLNPDGYHRYDLYANFIAGLSDKDLVATYTELKPLFAEAFTELGYSDID
FT                   FDKRMQQAFSMVASAPIIEDPIELSSISVNYKYVDPNLEALPNAQKLLIRMGPDNTRKI
FT                   KEAVKKLQQSFANK"
FT   gene            complement(383480..385597)
FT                   /locus_tag="Sfri_0356"
FT   CDS_pept        complement(383480..385597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0356"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   helicase domain protein; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   KEGG: son:SO4364 ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70219"
FT                   /db_xref="GOA:Q088U6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U6"
FT                   /protein_id="ABI70219.1"
FT                   /translation="MVFTSLTINLGEHNLLRLDLVPITDLKGVAKKVAEKLAKLGIKTV
FT                   QDVLFHLPLRYEDRTQIHPIAALPPGSFGTIEAEIQSTQIMQGRRRMLVCNVHDHSGMM
FT                   SLRFFNFSMAQRNAMENGASIRAYGEIRRGNHHKEIVHPEYQIIHPGESVTLSDTLTPI
FT                   YPTTEGVKQASWIKLTEQALAMLDQGGLPELLPSALQPNNISLRDALHILHRPHSSVSP
FT                   FELEQGQHPAQQRLIQEELLAHNLSMLQLRQRSNQDAAVPMPATGQLLSPFLAQLPFKP
FT                   TGAQQRVVAEINQDLQHPTPMMRLVQGDVGSGKTLVAALAALQAIENGYQVAMMAPTEL
FT                   LAEQHAANFATWFEPLGLKVGWLAGKLKGKARIQSLEDIASGAAQMVIGTHAIFQQAVV
FT                   FNKLALIIIDEQHRFGVHQRLGLREKGVSQGFHPHQLIMTATPIPRTLAMTAYADLDTS
FT                   VIDELPPGRTPVTTVAIADTRREQVIERVKQAALHDNRQAYWVCTLIEESEVLECQAAE
FT                   DTAAELTIALPELKIGLIHGRMKSAEKQTIMAQFKAGELNLLVATTVIEVGVDVPNASL
FT                   MIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKAPLSQTATKRLGVLRNSNDGFVIA
FT                   QKDLEIRGPGEVLGTKQTGLADLKIADLIRDQHLIAPTQKLASHVYQQVPQNVDAIIQR
FT                   WIGDRQQYVQA"
FT   gene            complement(385696..386304)
FT                   /locus_tag="Sfri_0357"
FT   CDS_pept        complement(385696..386304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0357"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Bacterio-opsin activator, HTH domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70, region 4 type
FT                   2; KEGG: son:SO0351 DNA-binding response regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70220"
FT                   /db_xref="GOA:Q088U5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U5"
FT                   /protein_id="ABI70220.1"
FT                   /translation="MKILLAEDQAMVRGALAALLTLACDSLNEIEIVEVEDGDKAMQQL
FT                   KTDSFDLLLTDIEMPGKSGLELSQWLQQQRSQTKVIILTTFGRAGYIKRALEYGVGGFL
FT                   LKDAPSEDLINAIKQVMAGKRVIDPELAFTAIGEIDPLNDKERRALRLASEGLSTSDIA
FT                   SQLFIAEGTVRNYLSEAISKLNASNRIDAARIAKQKGWL"
FT   gene            complement(386301..387395)
FT                   /locus_tag="Sfri_0358"
FT   CDS_pept        complement(386301..387395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0358"
FT                   /product="histidine kinase, dimerisation and
FT                   phosphoacceptor region"
FT                   /note="PFAM: histidine kinase, dimerisation and
FT                   phosphoacceptor region; KEGG: son:SO0352 sensor histidine
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70221"
FT                   /db_xref="GOA:Q088U4"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U4"
FT                   /protein_id="ABI70221.1"
FT                   /translation="MTSCLSSNNEKSYEQRTAWVYLINLGFYFIPLYFMAGQWLKISIA
FT                   IGLLVPFIIGYFWAYNSSKEQALKPIGLMFLSAIASSFVTSGAISLFSFCCFFIGFFYS
FT                   LRTAILSFIGLSILLLVIDISMGYTGYFFTFYGMGICLGVGVFGVIEQNRQRIKRQQQQ
FT                   SKDEVANLATALERERIGRDLHDVMGHHLAAIALKAELADKLIASGKIDQAQQQIHQVS
FT                   VITRDCLSQIRHTVSGYKHQGLTQTLNTLANTLRDNAIAVSIEGTFPKLSELMESQISL
FT                   LLTELINNTIKHSQATHCTLCIETSQDWLKLNFIENVPVKTITKGNGLTGIQERVTLLH
FT                   GTIDYQLIPHYKVSIKLPLSESVR"
FT   gene            complement(387473..388165)
FT                   /locus_tag="Sfri_0359"
FT   CDS_pept        complement(387473..388165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0359"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: son:SO0353 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70222"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U3"
FT                   /protein_id="ABI70222.1"
FT                   /translation="MEIAMKTLLLITSLTLVSHTSFANISDIDAAANTMNITELSQYSE
FT                   QAIDYEKAYADYRLAITANIIGQRQLATDSLNNAQHTLESLLVQDPSADQQALLAAVYG
FT                   MQISFDNSKGTVLGMKTAQLLQQANDLEPNNPRVSLVRAINAFYTPSVFGGGLDKSQTL
FT                   ATQAINQFEQPCNEICWGHAEAYTWRGLAKQEQGDLKGALQDWQTAIEVDPQYGWATYL
FT                   LNQQTVKQ"
FT   sig_peptide     complement(388094..388165)
FT                   /locus_tag="Sfri_0359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(388373..389302)
FT                   /locus_tag="Sfri_0360"
FT   CDS_pept        complement(388373..389302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0360"
FT                   /product="Na+/Ca+ antiporter, CaCA family protein"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: son:SO0354
FT                   sodium/calcium exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70223"
FT                   /db_xref="GOA:Q088U2"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U2"
FT                   /protein_id="ABI70223.1"
FT                   /translation="MFIALSIIGGFIILTIGAEALVRGASAVALRLGIAPLIIGLTIVA
FT                   FGTSAPELAVSVKSALAGNPGIALGNVVGSNIVNIGLILAITALIRPITVQSQMVKRDI
FT                   PIMIAASVLMWFLLLDGEVSFIDGAILFSALVGYLVFSYVSAKNNPEDLDVDATPQHPG
FT                   LSIALIIAGIAMLVGGGILFVDGAVDLAKQFGISEVIIGLTIVAIGTSMPELVTSVMAA
FT                   LKGQSDIAIGNVVGSNIFNVLGILGATALIHPVSAAGFNEIDFIAMLIFAFMVLPFAWS
FT                   GLRIGRREGSVLLAGYLGYTSYLVMQVV"
FT   gene            complement(389443..391170)
FT                   /locus_tag="Sfri_0361"
FT   CDS_pept        complement(389443..391170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0361"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   son:SO0355 AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70224"
FT                   /db_xref="GOA:Q088U1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U1"
FT                   /protein_id="ABI70224.1"
FT                   /translation="MAILSLRNTIGIRPTITIKNMEASMENLIKTPVEMLSHWVDTQGD
FT                   KVYLRQPIGGKYVDFTWREVQQKMQQIAGSLRHLGLERGDKIAVLSKNCAEWFIVDLAL
FT                   MYGGYISVPVYPTANAETIRYVLEHSGAKAIFTGKLDHWAEQEAAVGGEILRLAMPYET
FT                   MPAQYHWEQLLKLGQPLVDEQFPTADQVMTLIYTSGSTGKPKGAIQTFTSYGWACEAVV
FT                   RDLQTNTTDRLLSYLPLAHITERVAIEGSSFYSGATVSFVESLDSFVDDIQRCRPTVFF
FT                   SVPRLWTVFQLNIINKIGEKKLKTLLKLPIISTIVKRKIKSGLGLDQSRLNGSGSAPIP
FT                   PSLIQWYNNIGIDICEAWGMTENCAYSIINYPFNAKKIGTVGRPVEGCLVRQTEAGELL
FT                   VKSPGLMSGYYLQDEATAAAFTEDGFFHTGDLCEIDADGYIDITGRVKDNFKTSKGKYV
FT                   APVPIERKLAQDTHVDLICVIGSGLPHPIALVQLSEGSKLQPREEVRTSLKETLDGVNP
FT                   HLESHEHVDAIIVVNDEWTIENDVLTPTLKIKRHVLEKAFTAKVDGVRGAKVRWEDEL"
FT   gene            complement(391345..391728)
FT                   /locus_tag="Sfri_0362"
FT   CDS_pept        complement(391345..391728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0362"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: son:SO0358 endoribonuclease
FT                   L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70225"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q088U0"
FT                   /protein_id="ABI70225.1"
FT                   /translation="MAEKIIIATDKAPQAIGTYSQAVKVGSTVYLSGQIPLDPKTMTMV
FT                   SDDFAEQVVQVFENLTAVCEAAGGRMSDIVKLNIFLTDLSHFATVNEIMSRYFQQPYPA
FT                   RAAIGVKELPKGSLVEMDGIMEI"
FT   gene            complement(391759..393867)
FT                   /locus_tag="Sfri_0363"
FT   CDS_pept        complement(391759..393867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0363"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /note="KEGG: son:SO0359 guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase; TIGRFAM: RelA/SpoT family protein;
FT                   PFAM: amino acid-binding ACT domain protein; TGS domain
FT                   protein; metal-dependent phosphohydrolase, HD sub domain;
FT                   RelA/SpoT domain protein; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70226"
FT                   /db_xref="GOA:Q088T9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q088T9"
FT                   /protein_id="ABI70226.1"
FT                   /translation="MYLFEGLKESASSYLEPDQVELLKQAYLVARDAHEGQMRTSGEPY
FT                   ITHPVAVSRILADMRLDHESLMAALLHDTIEDTPVTKEELTELFGVAVAELVEGVSKLD
FT                   KIKFRDRKEAQAENFRKMMMAMTQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYAPIANRLGIHNIKIELEDLGFQAYYPMRHRVIRDVVKAARGNRKELINSIEVAIET
FT                   RLEEAGIPTKVKGREKNLYSIYRKMRSKELQFQEVMDIYAFRVIVDSIDTCYRVLGAMH
FT                   GLYKPRPGRFKDYIAIPKANGYQSLHTSLFGPHAVPVEVQIRTEEMDQMADKGVAAHWM
FT                   YKNNTDTAQQSTSQVRAHKWMQSLLELQQSASSSFEFVENVKTELFPEEIYVFTPEGRI
FT                   LELPVNATAVDFAYEVHTDVGNTCVGARVNRQAYPLSQPLISGQTVEIITAKGARPNAA
FT                   WLNFVVTGKARGKIRQVLKSLKGDNAIALGKRLLNHALGDTKLETIPAELLEKVIKETK
FT                   HTSLDSLLADIGLGNAMSIVIAQRLVGEQFDSQDSNKEKPQMPIRGAEGMLVTYANCCR
FT                   PIPGDAVIAHVSPGKGLVVHMESCANIRGYQGEPDKYISVHWDNVEGAEYQANLRVEIV
FT                   NHQGALAKITSIIASAGSNIHNLSTEERDGRVYLINLRISVKDRVHLANVMRRIRVLPE
FT                   VLRTSRNR"
FT   gene            complement(393881..394159)
FT                   /locus_tag="Sfri_0364"
FT   CDS_pept        complement(393881..394159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0364"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: son:SO0360 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70227"
FT                   /db_xref="GOA:Q088T8"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088T8"
FT                   /protein_id="ABI70227.1"
FT                   /translation="MARVTVEDAVNKIGNRFDMILVAARRARQIAVQGKEPMVDEMNDK
FT                   PTVVALREIELGLVTSNTLDADERQTVREREAAEIAAVAAIAEGRVL"
FT   gene            complement(394220..394843)
FT                   /locus_tag="Sfri_0365"
FT   CDS_pept        complement(394220..394843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0365"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: son:SO0361 guanylate kinase; PFAM: guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70228"
FT                   /db_xref="GOA:Q088T7"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088T7"
FT                   /protein_id="ABI70228.1"
FT                   /translation="MSTRGNLFIVSAPSGAGKSSLISTLLKDKPSDKQVSVSHTTRKPR
FT                   PGEVDGQHYHFITVEQFKALIAQNAFIEWAEVFGNFYGTSKLVIEQTLDKGIDVFLDID
FT                   WQGAEQVKKLMETAIGVFILPPSKAELERRLTGRGQDSQQVIDSRMAQAVSEMSHYAQY
FT                   EFIIVNDDFDNALADLSAIIRSQRLTCASQQHAQNDMIVDLLAD"
FT   gene            395217..396506
FT                   /locus_tag="Sfri_0366"
FT   CDS_pept        395217..396506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70229"
FT                   /db_xref="GOA:Q088T6"
FT                   /db_xref="UniProtKB/TrEMBL:Q088T6"
FT                   /protein_id="ABI70229.1"
FT                   /translation="MSVKTLLCRDGRDTGLRLMGIILAAFLLLIVAAVVFPASVINWIV
FT                   TLAVMPAVGLSAVRRLNDANKSIKLAAICVVPVLIFGILSYFMAPFGALAGVFLFGLAC
FT                   GGYLAFLPAKNSINYVQGYYGPSMVPISISGSVYHRQEPVMKGQVMPVHDQPESTFPSI
FT                   ESADEVVFTGSTHSNSAERHKQQFNDDVEPQTSFEQAGTHMEQEFDTATEYDPVNSFST
FT                   SSERSHQPLYVDQDALQSGSITELAKSWLNVAKLHQTKLILIGKITAAIIAVGIVVYLV
FT                   FALISVFSGDGTEQTEHVDDMSNQQQASIRQMVKLPDGFWLALEGEILIVRWLGESGDK
FT                   QNLWRLATAIGDKTCANLEFNDGSRYRPITVDLLDDGASEARFTPLDKNAIVNHVALRG
FT                   NFKLCGYEFSLKGSQATLMQNPQFEMILSQ"
FT   gene            396582..397652
FT                   /locus_tag="Sfri_0367"
FT   CDS_pept        396582..397652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0367"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   son:SO0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70230"
FT                   /db_xref="GOA:Q088T5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q088T5"
FT                   /protein_id="ABI70230.1"
FT                   /translation="MVNFIRKNVLPQFGFSREHSTLYPLGNGHINQTFLVSDKSKSLVL
FT                   QRINTQIFTDPKVVIQNAANISQHLLIKRQQLHYPLQVVSPIATVAGALYLDLGEQGFW
FT                   RAIDYLPHSTTIEVVDTLNQAKLAAEAFGHFAEALSDLNPSCIADVIPNFLNLPQRIAQ
FT                   LREAKAGDTHNRFSHCIDWVGLCLSQTDLLATLVQYEAELPIRICHNDTKINNMLFDNR
FT                   DMSSMAIIDLDTCMKGYLMYDFGDMVRAFCSPETEDSTNLTNVYARPEIVIAAATSYME
FT                   SLGGIITPLEKRSLWLGTKVMSLMLGVRFLTDYLNGDTYFGVKYQTHNLDRAINQLTIY
FT                   QSLLQQEAQLMPLFNS"
FT   gene            397787..398488
FT                   /locus_tag="Sfri_0368"
FT   CDS_pept        397787..398488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0368"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: yps:YPTB2218 haloacid dehalogenase-like
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70231"
FT                   /db_xref="GOA:Q088T4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q088T4"
FT                   /protein_id="ABI70231.1"
FT                   /translation="MSNLLNKYKWILFDADETLFHFDAFSGLKLMFSRFEVDFNIDDFT
FT                   VYQQVNKPLWIEYQNGLISATHLQHTRFHHWANKLSVTPQHLNSQFLAAMADICLPLPG
FT                   ARELIDSLSGKVNLGIITNGFTELQNIRLSRTGFQDAFNPVVISEQLGKAKPDVAIFHH
FT                   AFSLMGEPERHQVLMVGDNLHSDILGGINAGIDTCWLNHHGEPISDDISPSYQVGNLTE
FT                   LHQLLMPNTVV"
FT   gene            complement(398568..401225)
FT                   /locus_tag="Sfri_0369"
FT   CDS_pept        complement(398568..401225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0369"
FT                   /product="penicillin-binding protein, 1A family protein"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase; KEGG: son:SO0280
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70232"
FT                   /db_xref="GOA:Q088T3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q088T3"
FT                   /protein_id="ABI70232.1"
FT                   /translation="MFYFTKNSPAYILPLLFVIFWNYRVKWFKRLLIAFFSLSLLGIAA
FT                   IAAAYFYVLPDLPDVNSLKTVQLQTPLRIYSRDGKLISQFGEKRRIPVEYEEVPAQLIN
FT                   AVLDTEDARFFEHNGIDPIGIIRAALILVTTGKKSQGASTITQQVARGFFLSNEKTYIR
FT                   KVKEIFLALKIEKALSKKEILALYLNRSFLGNRAYGVGAAAQVYYGKELSQLTLPEMAM
FT                   IAGLPQAPSAANPIRNQSRAIARRNWVLSRMLEKRNITQAEYQEAISSPSTAKYHGAEI
FT                   DLYAPYVSEMARDYMIQKYGEEAAYTNGYNVYTTISSDLQLMAQESLRDNVFAYDQRHG
FT                   FRGPVAELWTDTPLEHDEIIAILKRTSSMQGIMPAAVISVKDQQAQVIDDKGELITLEW
FT                   KGLKWARKFISDKRQSLPPKQASDILTAGQQVWIRHNGKHWQLSQIPQVSSATVSLEPH
FT                   DGAIKTLVGGFSFSQSQFNRVTQAKRQLGSNIKPFIYAAALEKDYTLATLINNAPINKP
FT                   DTRQGTAWRPKNSPDIYGGPTRLRVGLAQSINVMSVRAMRHTGLDDTIKKLIQFGFDPN
FT                   DLPRNESLALGSPSVTPLQVATAFNSFANGGYLVEPYFIDHVTDSYDNTIEQTIPAIAC
FT                   SKPAPSVEDDVVIEDPFAAMAEEFSQQTPEASVDTLDGEVEATSITAEQNICSNPQARF
FT                   AKRVVSEQTAFLITEALKSVIWGGGDWSKGTGWNGTAWRASKLIKRHDIAGKTGTTNES
FT                   RDTWFSGFNPTLTATFWVGFDDHGRQLGRSSWRANGEPDQISGAEAGAKTAGPGWNDYM
FT                   NKALSGTPEASVIPPKGIVSARIDLATGKLTRKTDHTTEFEYFVEGTEPKEYVTETQQS
FT                   GDIFIDNVAEDLFQ"
FT   sig_peptide     complement(401082..401225)
FT                   /locus_tag="Sfri_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.466 at
FT                   residue 48"
FT   gene            401339..402418
FT                   /locus_tag="Sfri_0370"
FT   CDS_pept        401339..402418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0370"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   son:SO0281 type IV pilus biogenesis protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70233"
FT                   /db_xref="GOA:Q088T2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q088T2"
FT                   /protein_id="ABI70233.1"
FT                   /translation="MLSKLWKRQAPQMVGIDIGSHEIKAILLSKTADGYKIQNHASVPV
FT                   RKGAVVDHDIRDTEAVIESLRQIRRGLPKSLKFAAVAVSGSAVMTKVIYMDAALNEEEM
FT                   EAQIEIEADNLIPYSLDEVSIDFERLNPNITDPTKVNVLLSACRTENIDSRVDSLDAIE
FT                   LDVKVVDVEAYALGRSAELIYAQLPDGAKAKSIAMVDIGANMTTFSVVENGDTTFIREQ
FT                   AFGGELFTQSIVSFYGMPHDEAERAKISGQLPRNYMFEVLSPFQMQLLQQIKRTLQIYC
FT                   TASGREKVDYIVLCGGTAKLEGMVELLTNELGTHTIVADPFQGCLHADDVMKGQLQPNI
FT                   SKYMVACGLALRSYAQWRT"
FT   gene            402406..402990
FT                   /locus_tag="Sfri_0371"
FT   CDS_pept        402406..402990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0371"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   son:SO0282 type IV pilus biogenesis protein PilN"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70234"
FT                   /db_xref="GOA:Q088T1"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q088T1"
FT                   /protein_id="ABI70234.1"
FT                   /translation="MANINLLPWREEAREKQKRDFIGILALVFLVTSLVVYLFLGFLEV
FT                   VTDDQRERNAYLVSEITLLDTQIAEIRKITERKKDIERRTEIILNLQQSRNLPTHVLDE
FT                   LVRIVPPGIYLSSIEKKGSVLLIEGRSESNNNVANMMRKVKTSSYLNDPSMQSIVTQNE
FT                   ELRQLQRFKLRVTIRDDSQVTNVDPNQGARK"
FT   gene            402987..403604
FT                   /locus_tag="Sfri_0372"
FT   CDS_pept        402987..403604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0372"
FT                   /product="Pilus assembly protein, PilO"
FT                   /note="PFAM: Pilus assembly protein, PilO; KEGG: son:SO0283
FT                   type IV pilus biogenesis protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70235"
FT                   /db_xref="GOA:Q088T0"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q088T0"
FT                   /protein_id="ABI70235.1"
FT                   /translation="MNLDLDQFNDIDFENIGGWPKLVKIVFAVFLSLCVIGASYYLFIS
FT                   DSIDQMEAEQHKEIQLREDFETKYRLAANLKLYREQLDVMEVQFAELLKMLPSENEMPG
FT                   LLDDLTFVATDAGLRINSLDWDDEIERDFYIEFPIKMSVVGDYHQMGNMVSGVAKLPRI
FT                   VSLHDFSIKQNDAGGLSMDILAKTYRFKEGAELTQQANKGQK"
FT   gene            403604..404122
FT                   /locus_tag="Sfri_0373"
FT   CDS_pept        403604..404122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0373"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /note="PFAM: Pilus assembly protein, PilQ; KEGG: son:SO0284
FT                   type IV pilus biogenesis protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70236"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q088S9"
FT                   /protein_id="ABI70236.1"
FT                   /translation="MKFLPLLLSMVFLLSGCIGERSDLELFVTTTKAQHVARIPPLKQT
FT                   PKFEHFAYQAELMRSPFVPPSRELTEEVVDTSRDCLQPDLKRRKGRLETYALDNLRMRG
FT                   TLSEDSTIWALVESSDANVYRMGVGEYLGLYHGRIAKVTPQFIEIIELIPDGSGCWAER
FT                   SSNLELSGK"
FT   gene            404144..406192
FT                   /locus_tag="Sfri_0374"
FT   CDS_pept        404144..406192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0374"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB, short N-terminal domain protein; KEGG:
FT                   son:SO0285 type IV pilus biogenesis protein PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70237"
FT                   /db_xref="GOA:Q088S8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q088S8"
FT                   /protein_id="ABI70237.1"
FT                   /translation="MESSAAIKKAITKLLFFRAFLGAVLLMGLIPSAIAANRLMDVKYH
FT                   SMVDHQLELELIFESSIMSPSVDLSADPAEIMLNFSDTISNLSKSKIPVNAVGVKELTT
FT                   QQQGGDLQIIVAMTKVKPYQGKIVGNSYRLTINDDVSGPVEANNPFVNGISSIDFRRNK
FT                   TGGGEILFNLSNRSVAANVEQVGSKLEIKLYNTDIGNDLLYVMDVQDFATPVNSFETFK
FT                   DDLTARILVDVDGNYDYNYRQDGNVFKVSVDKVERVSVAKEAKKYNGRSLSLNFQNISV
FT                   RTVLQIIADYNNFNLVTSDTVEGEITLRLDDVPWDQALDLILQTKGLDKRIEGNILMVA
FT                   PSEELAIRESNDLKNRQEVKELAPLYSEYLQINYAKAIDIAELLKTTDSTLLSSRGSVA
FT                   VDERTNTLLVKDTAEILENVHRLIEVLDIPIKQVLIEARMVTVKDDVSEDLGIRWGITD
FT                   QQGSKGTSGTIGGATSIANGTIPSIDDRLNVNLPAAASSATSIAFHVAKLADGTVLDLE
FT                   LSALEQENKGEIIASPRITTSNQKSAYIEQGVEIPYVESASSGATTVTFKKAVLSLRVT
FT                   PQITPDDRVILDLEITQDSQGTTVATATGEAVAIDTQRIGTQVLVDNGETIVLGGIYQQ
FT                   NLISRVSKVPVLGDIPLVGFLFRNSTDTNERQELLIFVTPKIVADKR"
FT   sig_peptide     404144..404251
FT                   /locus_tag="Sfri_0374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.978 at
FT                   residue 36"
FT   gene            406639..407154
FT                   /locus_tag="Sfri_0375"
FT   CDS_pept        406639..407154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0375"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: son:SO0286 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70238"
FT                   /db_xref="GOA:Q088S7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088S7"
FT                   /protein_id="ABI70238.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLDFHDSDHEIEQRTGA
FT                   DIAWVFDVEGEEGFRRREAQVIGDLSERQGIVLATGGGSVQSKDIRNYLSARGIVVYLE
FT                   TTIDKQVARTQRDKRRPLLQVDDPREVLESLAEIRNPLYEEIADVIVKTDEQSAKIVAN
FT                   QIIEQLGF"
FT   gene            407163..408239
FT                   /locus_tag="Sfri_0376"
FT   CDS_pept        407163..408239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0376"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: son:SO0287
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70239"
FT                   /db_xref="GOA:Q088S6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088S6"
FT                   /protein_id="ABI70239.1"
FT                   /translation="MQQIQVQLGDRSYPIYIGQDLMNDSELFARYLTNKKALIVSNDTI
FT                   APLYLQQIQQAMSACARIETVILPDGEKFKDLQHLDYIFTELLEHNFARDSVLVALGGG
FT                   VVGDMTGFAAACYQRGIEFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKSVI
FT                   IDTFCLQTLPANEFAAGMAEVIKYGIIWDADFFQWLEANVDALKSLQTDALNYAIAKCC
FT                   QIKADVVAQDETEQGVRALLNLGHTFGHAIEAEMGYGVWLHGEAVSAGTVLAAQTAYKL
FT                   NLLDEQSVERICRLMQAFDLPITAPESMGFEQFIKHMRRDKKVLGGKIRLVLPTEIGKA
FT                   DVFSDVSEDLLKQVISCV"
FT   gene            408290..409693
FT                   /locus_tag="Sfri_0377"
FT   CDS_pept        408290..409693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0377"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: son:SO0288
FT                   DamX domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70240"
FT                   /db_xref="GOA:Q088S5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q088S5"
FT                   /protein_id="ABI70240.1"
FT                   /translation="MTTPGLLLLPTQEALIQRLQHIASYSEQLLVICGDNGSGKSTLTA
FT                   ALASELDDYNSALVICPQHADSAEIRRKILVQLISAPIFDDERPLMDTVLRIQSSLKKP
FT                   LHIIIDDADLLPKDIWAECILLSQIHCAGKPVAVTVTVTPSFWHTLVAELTDETRARLL
FT                   PVTIEPLSVPERDGLYQSLLLRSQQTPFIPREIIHKQLEKQRGTPAEVVQLLALALEEP
FT                   QTVRSSWSASIKMMIASVTILAGVAMWWGISTQLPPPISASLSPVLTAEQSAVRVKAAQ
FT                   YVIDYADSSLSAYFAHRQLVLAKSSANEQAHFIIEQQMTADSSLVEQGETNLIEEVPAD
FT                   NHIDVVVNSSLKGLSFRGKLPKAQVNTVNKPNDIVERDNTPNLKVKGFTLQLASVNDKD
FT                   SLTPILVKLAQEPQVYIMKYKQRHVILLGDFDTASAASSKAKSLQKKYSLAAPWVRKWA
FT                   DLSDYKRQD"
FT   gene            409826..410662
FT                   /locus_tag="Sfri_0378"
FT   CDS_pept        409826..410662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0378"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: son:SO0289 DNA adenine methylase; TIGRFAM: DNA
FT                   adenine methylase; PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70241"
FT                   /db_xref="GOA:Q088S4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q088S4"
FT                   /protein_id="ABI70241.1"
FT                   /translation="MIKKHRAFLKWAGGKYKLVDELAKHLPAGNRLIEPFVGAGSVFLN
FT                   TQFDDYLLCDINQDLINLYQIVQQQPDKYIKAAKAMFVDEMNDKDAYYRVRAEFNLCSD
FT                   PFIRSVYFLYMNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEAEIRYFSLKAQKATFKC
FT                   ISYEQAFDMANSGDVIYCDPPYAPLSTTASFTTYAGPGFSLDDQALLARHSRLIAHERN
FT                   IPVLISNHDIPLTRELYRGASCSTISVQRNISPKGGSRNKVDEIMALYDHHYREEE"
FT   gene            complement(410695..410874)
FT                   /locus_tag="Sfri_0379"
FT   CDS_pept        complement(410695..410874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70242"
FT                   /db_xref="GOA:Q088S3"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:Q088S3"
FT                   /protein_id="ABI70242.1"
FT                   /translation="MSIWRVFSSTVAAFFGVQTEQNRQKDFQTQSPLPFIIMGIILAIA
FT                   LVISLMLIVNQVLS"
FT   gene            complement(410874..411269)
FT                   /locus_tag="Sfri_0380"
FT   CDS_pept        complement(410874..411269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70243"
FT                   /db_xref="UniProtKB/TrEMBL:Q088S2"
FT                   /protein_id="ABI70243.1"
FT                   /translation="MDRAHFMVKHLLRKLSGRDGKLLSAPVFAVFATSALALLLSQVLM
FT                   ATESNSANSKACVCNSTTNYNASLPSSHPTNRCAEQSNDVSWGNWITGNSRSSQFHFID
FT                   LLELIHGHKDKPLNDMPTSGNPTQISR"
FT   sig_peptide     complement(411129..411269)
FT                   /locus_tag="Sfri_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.815 at
FT                   residue 47"
FT   gene            411523..412194
FT                   /locus_tag="Sfri_0381"
FT   CDS_pept        411523..412194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0381"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   son:SO0292 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70244"
FT                   /db_xref="GOA:Q088S1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q088S1"
FT                   /protein_id="ABI70244.1"
FT                   /translation="MRPFLIAPSILSADFARLGDDVKAVLDAGSDVVHFDVMDNHYVPN
FT                   LTIGPMVCTALRNYGITADIDVHLMVKPVDRIIPDFAKAGASIITFHPEASEHIDRTLQ
FT                   LIKESGCKAGLVFNPGTPLHYLDHVMDKLDVILLMSVNPGFGGQSFIPHTLEKLRQVRA
FT                   IIDASGFDIRLQVDGGVKVDNIAEIAAAGADMFVAGSAIFNQPDYKVVIDQMRAELASI
FT                   S"
FT   gene            412225..412914
FT                   /locus_tag="Sfri_0382"
FT   CDS_pept        412225..412914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0382"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   son:SO0293 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70245"
FT                   /db_xref="GOA:Q088S0"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q088S0"
FT                   /protein_id="ABI70245.1"
FT                   /translation="MMQWSNIRAIAFDLDGTLIDSVPDLAAATNATLAQNQYQPVTEAL
FT                   VRSWVGNGAQVLMQRALSYVSAMPEDAPELQVMLEQIMPQFMHHYGEHLQKHSRLYPGV
FT                   VDTLQLLKQAGFKLAIVTNKPYRFTVPLLTAFGLDDLFSEVLGGDSLAKMKPDPMPLQH
FT                   LLKQWQLDESQLLMIGDSKNDILAAKAANVMSIGLTYGYNYGEDIGLSLPHAICENFAD
FT                   IEQYLLS"
FT   gene            412955..413953
FT                   /locus_tag="Sfri_0383"
FT   CDS_pept        412955..413953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0383"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: son:SO0294 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70246"
FT                   /db_xref="GOA:Q088R9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q088R9"
FT                   /protein_id="ABI70246.1"
FT                   /translation="MTKPIVLSGAQPSGELTIGNYMGALRQWVAMQDSHDCLYCVVDLH
FT                   AITVRQDPKALREACLDTLALYLACGVDPKKSTVFIQSQVPQHTQLGWVLNCYTQMGEL
FT                   NRMTQFKDKSLKHANNINVGLYGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATR
FT                   FNNAYGDTFTIPEPFIPEHGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAILKKVKK
FT                   AMTDSEEPPVVRFDMEQKPGVSNLLSLMSGCTGQSIASLEAEFEGKMYGHLKVATGEAV
FT                   VGMLEPLQARFKEYRADHAYLSQVMAEGAEKAQARAEVTIKKVYEKIGLIV"
FT   gene            complement(413999..414868)
FT                   /locus_tag="Sfri_0384"
FT   CDS_pept        complement(413999..414868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0384"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0295 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70247"
FT                   /db_xref="GOA:Q088R8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q088R8"
FT                   /protein_id="ABI70247.1"
FT                   /translation="MRKLPPLRALQIFEAAARHAHFSRAATELCITQSAVSHQVRLLEA
FT                   HFGERLFIREGRQLCLTSKGNVLYHELERIFNELNDLSMQITGDCNDQLRLAVYSSFAI
FT                   KWLIPRLSDFHRLHPQIKIRLDMITDDPQMSDSVADMFITGQSGQPGYVHRMLHQERLI
FT                   PVICPGLLNTDHSALSVLRQHALLTVDEGPIGFDWERWLKVNSISIAATQQQHVFSHVL
FT                   LAIEAAIAGQGIALASDFMVERDISKGALVALDLPAMLTGFEFNFSCKQRRLKEPAIAA
FT                   FVQWLTKK"
FT   gene            415010..415885
FT                   /locus_tag="Sfri_0385"
FT   CDS_pept        415010..415885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0385"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: son:SO0296 integral membrane domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70248"
FT                   /db_xref="GOA:Q088R7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q088R7"
FT                   /protein_id="ABI70248.1"
FT                   /translation="MKSTIAIGMMLLVVGNLFSAMYDVSIKWLPDGSSAATFLLIRQLT
FT                   SVLMLLPLWFATKKPISRHIKVHLVRANTGAIGAVCLIMGLIALPIATVSSLFYSAPLM
FT                   IVLMGFLFLKESVTATHWLAAILGFLGIIILLRPSEINWFGIAVLISAFMFAINQLALR
FT                   KLPSTESPVVTLMLYNLLSIPLVLVMALVQGIEAISWSLVAIAVSSNVFLLAYQWFCAL
FT                   AYRQAQASQIVVAEYTGLLFCVFFGWLFFDEWLDGLSWVGAGFIVLPSLIIPWVQAKRS
FT                   QKKFIEQNAG"
FT   sig_peptide     415010..415069
FT                   /locus_tag="Sfri_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.980 at
FT                   residue 20"
FT   gene            complement(415922..416491)
FT                   /locus_tag="Sfri_0386"
FT   CDS_pept        complement(415922..416491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0386"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; KEGG: son:SO0297
FT                   lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70249"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q088R6"
FT                   /protein_id="ABI70249.1"
FT                   /translation="MIRRLLIISVLAMLQGCAGAVMVGAVSGAKMVNDERSMSTQISDT
FT                   NADFVIASALSKHDDLNNQTNIAAVVMNNNVLMIGQAPNSMLRDKAIKVVQDLQIGGKI
FT                   HNQIRIGTPTSFTTRSNDTWVTTKVKGRMLNEKSLDITRVKVITENGEVFLLGLIDRKQ
FT                   ADLAVDIARNTAGVRKVIKVFEYTES"
FT   sig_peptide     complement(416429..416491)
FT                   /locus_tag="Sfri_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.289 at
FT                   residue 21"
FT   gene            complement(416488..417081)
FT                   /locus_tag="Sfri_0387"
FT   CDS_pept        complement(416488..417081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0387"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG: son:SO0298
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70250"
FT                   /db_xref="GOA:Q088R5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088R5"
FT                   /protein_id="ABI70250.1"
FT                   /translation="MLERIRDSFTESIQTKIDAAEALPESIEKAAEMMVQCLLGGNKIL
FT                   SCGNGGSAGDAQHFSAELLNRYEIERPPLPAIALSCDTSTITAIANDYSYDEIFSKQIF
FT                   ALGQPGDILLAISTSGNSGNIIKAMEAALSRDMTIVALTGKDGGAMAGLMSAGDVEIRV
FT                   PSNVTARIQEVHLLVIHCLCDNIDRTLFPQDEQA"
FT   gene            complement(417211..417537)
FT                   /locus_tag="Sfri_0388"
FT   CDS_pept        complement(417211..417537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0388"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   son:SO0299 predicted endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70251"
FT                   /db_xref="GOA:Q088R4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088R4"
FT                   /protein_id="ABI70251.1"
FT                   /translation="MNSGQLAEQHARTYLEQQGLTFVDANVRYPFGEIDLIMRQQDVWV
FT                   FVEVKFRSSNQFGGALNALTSKQITRIRLAAEHYLQRQKLNPPCRFDVIAMNIDEINWL
FT                   QGCF"
FT   gene            complement(417534..419357)
FT                   /locus_tag="Sfri_0389"
FT   CDS_pept        complement(417534..419357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0389"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG: son:SO0300
FT                   lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70252"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q088R3"
FT                   /protein_id="ABI70252.1"
FT                   /translation="MLKRLNTTKFVCALIFSVLVVGCATKKQQDNVDASASLVAAEHPA
FT                   KIYLAEATNSSLPEKRDRYLLLAAHAYINDGNFNSAVNVLTSMQKSMVNVPSLQAEHIY
FT                   LRARIAEKTNSSQAALDILQYPPHWQLPRWQMASYHQFKAKLYKNTQQPIDQVKQLSLL
FT                   SNYLPKSETTAINNVIWKLLQPLHEETVQSFMRDQSNPIFAGWLQLTFIAKHYAVEPTQ
FT                   LVRYLGEWQRNNPYHPGAVKLPADLEKALNAKPFRPQNIAVLLPLSGPRAVVAEPIRQG
FT                   LMSSYLSDYDANVSINFYDTQQGVAAAYQQAVAKGAEFIIGPLLPNEVEELQKINDKQK
FT                   TTVPQLYLNQTDTFTPQPNLFYFSLSPAQEASDAAHKLYSDGVKLPLLLASNDPIGKRM
FT                   ADSFKQTWLTLTSNDAEVYFYDAGDQMKVTVQEALGVKDSQARISRMRDLLGSRLESDF
FT                   RSRQDIDAIYMISGSQDLALLKPFLDVNFSVFSEPVTLYTTSRSRLESESAQSAQELNN
FT                   LIISDVPWLMQSNSETQLVSELWSGWNNSQKRLYAMGYDALELVNRLAQMRAFPGYQFI
FT                   GRSGALSVKPNGVIDRQLSWGKYNQGQLTPL"
FT   sig_peptide     complement(419277..419357)
FT                   /locus_tag="Sfri_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.704 at
FT                   residue 27"
FT   gene            419447..420289
FT                   /locus_tag="Sfri_0390"
FT   CDS_pept        419447..420289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0390"
FT                   /product="Protein of unknown function UPF0011"
FT                   /note="TIGRFAM: Protein of unknown function UPF0011; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: son:SO0301 hypothetical
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70253"
FT                   /db_xref="GOA:Q088R2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q088R2"
FT                   /protein_id="ABI70253.1"
FT                   /translation="MDQMVALYIVPTPIGNFGDISARAIEVLQQVDLIACEDTRHSGRL
FT                   LSHFGIETRKTALHDHNERDRAQWIVEQLNEGKSIALISDAGTPLISDPGYHLVNHVRQ
FT                   AGHRVVPLPGACAAITALSASGLPSDRFSFEGFLPSKEKARIDKLEFLKEDPRTLIFYE
FT                   SPHRILYSLAAIVDVLGADRQVVMAREVTKTFETFLSGTAAEVLALVEADDNQQKGEMV
FT                   IMCHGFTLSDEEGIPAVAVATLKLLCEELPLKKAAAIAGQIHGLKKNALYKYGLELDL"
FT   gene            420382..420681
FT                   /gene="rnpB"
FT                   /locus_tag="Sfri_R0017"
FT   misc_RNA        420382..420681
FT                   /gene="rnpB"
FT                   /locus_tag="Sfri_R0017"
FT                   /product="RNA component of RNaseP"
FT   gene            421132..423270
FT                   /locus_tag="Sfri_0391"
FT   CDS_pept        421132..423270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0391"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: xcb:XC_2846 iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70254"
FT                   /db_xref="GOA:Q088R1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q088R1"
FT                   /protein_id="ABI70254.1"
FT                   /translation="MHLNVINLGILSLLLPVLSVSANEKAADVDLTESIEKITVMGRAQ
FT                   TFYRESSTSVGAKVETDIMDLPQSVQVLNEQLIVDQAAREITDLYRSIAGVSIYSYSGV
FT                   TFRGFRDDSNVFYDGVRGDPFSGFGVPQLFNIERVEVLKGPAAALYGGGEPGGMINYVS
FT                   KKPSFVQNTEVTLTTGDNDRMGGSIDSKGGLTDSIAYRLGGFYEQKDSFRNNADSENTE
FT                   LTGGLLFQLGDDTTLTTTIDYIKQDLGGNRLRGVPVDDDGNFLVDPSYNANEKSDYQNL
FT                   EATVLQAELKHFFNDDLSVNTTVRYLDNEREQAYHESRSWADVNGDGVANIDDKTIKRE
FT                   YRKQYRANKEISATSDFVYRLSSGSIDQTLLFGADYHHVDSDYDYWFARYEADGIKNLN
FT                   IFDLNYGETDPSTYSLTDQNRDGAKTERLGLYAQDQIALTEQWLLMVGLRYDHFDDFDK
FT                   ETGFEYNDNHVSPRAGIVYKFSPDQSFYINYAESFNPTSIGDQDTASADGGLLPEVGKQ
FT                   IELGVKSQWFDGSVMTTVAVYQIDKKDVAMNNPNYTDGSNGAPALVSLGQVESNGAEFT
FT                   LTGDITENWTVMANYAYNDTRVTEGDVGDTYADGSKFINAPRHQAGLWTRYDIDSLNSA
FT                   IAFGADYVSEQMSGGAQRVKPFTVFDMSWTTTWQETQFQLNVKNLFDKEYAVSGFSERN
FT                   GHFPGAPREMVLQVSHHF"
FT   sig_peptide     421132..421200
FT                   /locus_tag="Sfri_0391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.650 at
FT                   residue 23"
FT   gene            complement(423365..425518)
FT                   /locus_tag="Sfri_0392"
FT   CDS_pept        complement(423365..425518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0392"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: sde:Sde_2885 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70255"
FT                   /db_xref="GOA:Q088R0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q088R0"
FT                   /protein_id="ABI70255.1"
FT                   /translation="MLFKPSQLAIATHCALFLLVLPVTHANAESSTQATENQTSMERMI
FT                   ITGSRSAERIEEVPSSVTLIEQQTLAQDMLMTSQLQNLLAFRVPGLAPSTGTSSNSGQN
FT                   LRGRAALVMIDGVPQSTPLRNGKLGISSIDAGVIERIEVIKGATSIYGNGASGGIINYI
FT                   TKRASEDKARVKVGASSKFSAVKLQDSAGYRVDTSIDGTVDNFSYVFSAITEKTGVERD
FT                   SEGDAIGLVYGLSETKSNNYFTKLGYQLDDDKSIQLTYNYYEAQQESDYIDVVGNANTG
FT                   EKTYSIDNTTGIVKLGVPQGPRGNHNLMLKYVDQDIFTNTQLTVDGYLQKIENMFFFST
FT                   ALANLSEGYEGGQSFIKSEKKGLRVNFATQVDWDNVESTFIYGIDALQDISSQPLEDGR
FT                   IWVPEMDMRNLAVYLQTKFVIADDWVIKAGIRQDSVDLTVDDYQTLKLCRTPSTCSVPF
FT                   DVTGGELTYNSTTYNIGLRYNMNEFFNPFMSFSQGADISDIGRLLRTATVDDIALIRTE
FT                   SSIVDNYEIGFSGQLGDLNYEIAAYRSKSELGTSNSFDATTGIYLPVRAPQKIWGYEAQ
FT                   VDYRVLDNLNTGLSYSWVEGKDTETDTYIDGGTISPPKLTAYISWQPVEEASIGINYMY
FT                   VGDRDRFEPVDGAYIGSQGPIENYNVVNLTSSYQLNNWQLSLGVENLLNEDYFSARSQA
FT                   STNASYYTQALGTTINVGIKASF"
FT   sig_peptide     complement(425432..425518)
FT                   /locus_tag="Sfri_0392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.887 at
FT                   residue 29"
FT   gene            complement(426017..427696)
FT                   /locus_tag="Sfri_0393"
FT   CDS_pept        complement(426017..427696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70256"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q9"
FT                   /protein_id="ABI70256.1"
FT                   /translation="MPIIFMAVFFFVILLSSPAVQATIANSAAQLKANDDSVTTPSSPS
FT                   TINKHDVEKVANIVIVSHPIFDESAPDAIFLHRWANYLHINTKESTILNSLSFEKGEKI
FT                   TQKDLEEAQRLLRYEPYIRDADINIARKDPLADDNVEDVVLVETWDNWSLLPTVSLSKN
FT                   GGDTKYSFGMKEDNLLGLGVKTKIKYQSSADRTGYKFAFDAPVRWIKHGNVSVDFYDNS
FT                   DGQASAIAFNKPFYTLDTQNMYALSWLTDTRIDTIRQNGQDINEFEHVIDYANVGFGWL
FT                   VDKTPDQLHRISLGITQDQHQFNNIDDYPISPLPFDREFVYPWISYEYLQDQYTVLNNI
FT                   HLINNNEDFNLGWHHTVSLGLETNDVADSAAVGYHVTASSSRGWQEDNQLLLMTLNART
FT                   DIQTGQQDFYNVGLAAEFFHQISPKWTAYSKARIATSHNNYLDQTFALGDETGVRGYPN
FT                   DYQHGDNQWLLTSEIRYYPNINLYQLAELGWAVFADIGQASGGPDEQNEVDGPIGSIGI
FT                   GARIYSSKSSYGNVAHVDIAVPITTGNDINAWEFRFQVKDHF"
FT   sig_peptide     complement(427628..427696)
FT                   /locus_tag="Sfri_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.792 at
FT                   residue 23"
FT   gene            complement(427952..429172)
FT                   /locus_tag="Sfri_0394"
FT   CDS_pept        complement(427952..429172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0394"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   son:SO0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70257"
FT                   /db_xref="GOA:Q088Q8"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q8"
FT                   /protein_id="ABI70257.1"
FT                   /translation="MDNQDFLEKRRFIIKLGKYLHKFGTPAYRLESHLQTVCNTLGIEG
FT                   YFLISPTSMTFVLQHDTEQEYNHVARVKPGDLDLGSLARTFELVEELSSGQRTLQEALE
FT                   RLEEIANKPNPYGHKLTLLAFGSSAGAFAMLMGTGWHDVFWSAIFGLLVYSLVFWAERS
FT                   KRIAEMLEPMAAVVCAILASGIAQLDPSINLPVTILSGIIIFVPGLALTLGLAELAARD
FT                   LISGTARIMDAVMQLFKLYFGAVLGMTIGKAIFGETIYVEPIPLPRWAIWSAVPLLSMS
FT                   LVIIFKARLKDSPWGIFAGIVAFFSAMLGGIYLGESIGIFVGALAVGIYSNLYARWMKA
FT                   PVSIALLQGIVILVPGSKTYIGLNALISGETMLNQAHLGSQIFLIFMSLIAGLIFANVI
FT                   VPPRRSL"
FT   gene            429336..429731
FT                   /locus_tag="Sfri_0395"
FT   CDS_pept        429336..429731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70258"
FT                   /db_xref="GOA:Q088Q7"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q7"
FT                   /protein_id="ABI70258.1"
FT                   /translation="MTLMVSGLYAGLTALLVLALSYKVVKFRRANKIGIGDGGHQGLSI
FT                   AIRAHGNLIENAPIALILLALAELNGMPVYLIHSLGTAWIVARLLHAIGLNQGQGGHHF
FT                   GRFWGVLTTWIVLLVLAVANIGFFLGL"
FT   sig_peptide     429336..429395
FT                   /locus_tag="Sfri_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.748) with cleavage site probability 0.697 at
FT                   residue 20"
FT   gene            429934..432255
FT                   /locus_tag="Sfri_0396"
FT   CDS_pept        429934..432255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0396"
FT                   /product="Radical SAM N-terminal domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM
FT                   N-terminal domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: son:SO0311 hypothetical Fe-S
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70259"
FT                   /db_xref="GOA:Q088Q6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q6"
FT                   /protein_id="ABI70259.1"
FT                   /translation="MQVESTLFNYPKFWAECYGTAPFLPMSRKEMDILGWDSCDIIVVT
FT                   GDAYVDHPSFGMAVIGRMLEAQGYRVGIISQPDWSNKEDFMQLGRPNLFFGVTAGNMDS
FT                   MINRYTADRKLRHDDAYTAGDIGGKRPDRAVTVYTQRCKEAFKDVPVVIGGIEASLRRI
FT                   AHYDYWSDKVRRSVIFDAKADILIYGNAERPLMEVARRIAAGEAIGDIDDVRGTATMRK
FT                   EPMPGWRGMDSRKIDQLHKIEPLPSPYGADDVGCSNLSGPTDEKIFDNEAPKAISVQPP
FT                   RPKPWEKTYVLLPAYNKVSEDKYLYAHASRILHQEQNPGCARALFQPHDANRGVWVNPP
FT                   AWPLNTDEMDAVFDLPYQRIPHPMYGKEKIPAYDMIKTSINIMRGCFGGCSFCSITEHE
FT                   GRIIQSRSQESIIKEIKDIQEKVPGFTGVISDLGGPTANMYRLGCTSEKAEKTCRRLSC
FT                   VFPSICGHLGTDHKHTIDLYKAAREVPGIKKVLIASGVRYDLAIENPEYIRELAKHHVG
FT                   GYLKIAPEHTEEGPLSKMMKPGMGTYDKFKELFDKFSKEAGKEQFLIPYFISAHPGTTD
FT                   EDMVNLALWLKGQKFKLDQVQNFYPSPMANATTIYHTELNSLKNIKHDSEQVTVPKKGR
FT                   QRKLHKFLLRYHDPMGWPMIREALVAMGKESLIGNGPNHLVPPETRNEQTKVKWGQKPS
FT                   AKAKEQSGQKAMTRFSADQFEDRKGNAKADKGSAKPVGQKTKSPAKASGQVAKGQAPKS
FT                   QGAKRPAKATTWATKSKYAK"
FT   gene            432456..433058
FT                   /locus_tag="Sfri_0397"
FT   CDS_pept        432456..433058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70260"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q5"
FT                   /protein_id="ABI70260.1"
FT                   /translation="MPTLIRLSAYLSGVLLCGSTLLVNPAYAANSVQQQQFFEAISALC
FT                   GKAFAGKITAGGSEGDGFSGKPLVMHVRDCTNHQLRIPFHVGDDHSRTWVITQTDTGLR
FT                   LKHDHRHKDGTDDKVTMYGGETRDTGTANLQTFPVDDESIANFKQHGLTQSVTNEWQMM
FT                   IEAHTFTYRLTRENRDFKVEFDLSQPVALPPAPWGYK"
FT   sig_peptide     432456..432542
FT                   /locus_tag="Sfri_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            complement(433086..433346)
FT                   /pseudo
FT                   /locus_tag="Sfri_0398"
FT   gene            complement(433762..434805)
FT                   /locus_tag="Sfri_0399"
FT   CDS_pept        complement(433762..434805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0399"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: son:SO4548 transposase, IS110 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70261"
FT                   /db_xref="GOA:Q07WL7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q07WL7"
FT                   /protein_id="ABI70261.1"
FT                   /translation="MKVTTISIDLAKNVFQVLGMDCHAKQVFNKRLNRTQLTEFMLQQP
FT                   NCDVVFEACYSSHYWGRKFLAMGHNVKLIPAQHVTPFVRGSKNDNNDTMAIYEASFRPN
FT                   IRFVPVKTEEQQEILMLHRIRERLVKEKTACTNQIRGVLVDFGICFAQGYKAFEVAIWD
FT                   IINDASQRPIIKLMANDFWGEYQSVNTRLDRINTLIKKLIERDPNGKILLSIPGVGPII
FT                   ASAFVASIGRGQAFNTAKELGVWLGLTPKQFASGHRSVNGSITKRGNGYLRKQLIHGAR
FT                   AVVSHASKKQDDLNLWIMQLRSRKSICSTVVATAHRLARLIWILLQKQVPYVPQYAANQ
FT                   GVNHGTC"
FT   gene            435379..436218
FT                   /locus_tag="Sfri_0400"
FT   CDS_pept        435379..436218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70262"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q3"
FT                   /protein_id="ABI70262.1"
FT                   /translation="MQVRTLTMPPLKASMSETTYLKVFLDDIGHSVHCMNTIAVSLSQL
FT                   TPETTPPKELNISWKPGNVTSSSINARRFAIKSSIVYSVESLFEYLSKISKDNFWSGTG
FT                   KNFNESSKQNISKADRVADFLTGIPDIKKEWIIFTELLCHWRNKVVHANSSNACISKLS
FT                   KQYLVENSQRIFDDFYHFDVNLALDNFGNNKFTLKDVTTLITMLIKCARAVDAYFISTV
FT                   KSQSDDAIYEVILNNHSFQTIMKQQESDKRFRQAIKWAELNYGFLGMGTITRVIKTT"
FT   gene            436304..437137
FT                   /locus_tag="Sfri_0401"
FT   CDS_pept        436304..437137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpn:lpg2572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70263"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q2"
FT                   /protein_id="ABI70263.1"
FT                   /translation="MKYKTKPRIQSELELSFLAEVKKYDDVLNATKLISLNQHGIMTTG
FT                   RGLRATRIFTRQTVLGVSLEKILPRPTKKKPLDFCHWDVVSLASFARNILEGYLSFHYF
FT                   GIEDISNEEAELRFFILQQHRNTEWFEIQKLNNEDNLDEFEKGIPEQKERVKKHPFLSS
FT                   LSKYQQGLALKGLEMYKTKQNFEESLPICKNLRRDYRLLSNLVHPLPIAIERIDNEKGR
FT                   GIGSDADISFSLLCLIIARQYLAASTVGMADFFHEKFSDKKYSSSIAAIRSFVSE"
FT   gene            complement(437982..438563)
FT                   /locus_tag="Sfri_0402"
FT   CDS_pept        complement(437982..438563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70264"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q1"
FT                   /protein_id="ABI70264.1"
FT                   /translation="MKRSISLVVSSLLVLLSFAFSAPSFADEDAYNDAITNFKKANESR
FT                   HLFDTAYGYAVFPTVAKGGIGIGAAYGNGRVYQSDAYMGDSTLTQLSIGFQLGGQAYSE
FT                   IIFFKDAKAYNEFTSGSFEFSAQASAVAINVGANAQVGTTGNSAGAGQAGSNHAAAAAY
FT                   INGMAIFTAAKGGLMFEAALAGQSFTFDGK"
FT   sig_peptide     complement(438483..438563)
FT                   /locus_tag="Sfri_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(438728..439666)
FT                   /locus_tag="Sfri_0403"
FT   CDS_pept        complement(438728..439666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70265"
FT                   /db_xref="GOA:Q088Q0"
FT                   /db_xref="UniProtKB/TrEMBL:Q088Q0"
FT                   /protein_id="ABI70265.1"
FT                   /translation="MNQFNDLFIQTYWWLSLLGGIHCLGVGLYVHYIYQSATRSHSLLA
FT                   GIFLLIGCYFLTGLLTPETTPIPIHLTLTLFIPIYFLLMPMLYLYCKSSLTAQDYQPLL
FT                   IKHFGFAIIIALVTSSTILFHIGIDPKNSNNSIGTLGEISSINLLAMVLPILLMLQTFG
FT                   YFWAIYRLLSRYRPQYLANRQPNLQVIRFRWLSVLTIGILINWVLRIVLVYLPFYLGDS
FT                   VLLLTQAVTRLSLLLTVYVFALYGIQQVTRSAYLRGSLNATSQATPPTKEPHTDPLLDE
FT                   EEITYLHHLMGDEDESDPNDNSVIDRDKKKD"
FT   gene            complement(439731..440123)
FT                   /locus_tag="Sfri_0404"
FT   CDS_pept        complement(439731..440123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70266"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:Q088P9"
FT                   /protein_id="ABI70266.1"
FT                   /translation="MADTELLSGKLLYEFRTMQAMVEIYCKAHHPLKPSQGVCLQCSEF
FT                   LSYANTRLDRCPYGQDKPTCNKCPVHCYKPHMKQRAREIMMYAGPRMLLPHPIFAIKHL
FT                   LAERKPAPGLPPERVSNRHLRKLKQS"
FT   gene            440484..441431
FT                   /locus_tag="Sfri_0405"
FT   CDS_pept        440484..441431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70267"
FT                   /db_xref="GOA:Q088P8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q088P8"
FT                   /protein_id="ABI70267.1"
FT                   /translation="MKVILTVILIAIALYLYRRTQAVAKQERDKTDRNATSHSSSEVAQ
FT                   PSTAADDTTMAESEHVGMDKSAADEVLTEATLKTDELVSVDVDLVDPVNESSEKSKTPA
FT                   EQVSEPVDVVEIAPEAILESESKVTDVVSEPEVVPKDVAAVADVSKASVSKADVEPKVS
FT                   ITTAVDAPSDQGLSLNLNRVEGDWASESFLQQIDAANNANDLQSQHNGLASVINHCYKM
FT                   RKQADYCQYGAALQLTYLDLYRSLHQQYVSQKSTDEIKSPAFMQLSTLLNDVGQFDEAI
FT                   KVCEQALEYQLTDGTVTGFEGRIKRIEKAKAKAN"
FT   gene            441539..441871
FT                   /locus_tag="Sfri_0406"
FT   CDS_pept        441539..441871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70268"
FT                   /db_xref="UniProtKB/TrEMBL:Q088P7"
FT                   /protein_id="ABI70268.1"
FT                   /translation="MTLMTRTLPKILLFTATAVLLAGCIRTPEWTLFYVADRTPIPTTI
FT                   VLQDHISGYYDSLEQCQAKGAGMLRLQASSVPAEQAFVCGELCQIDEKQQLQCKTQVVG
FT                   IKHNAV"
FT   gene            441861..443342
FT                   /locus_tag="Sfri_0407"
FT   CDS_pept        441861..443342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0407"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   son:SO0330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70269"
FT                   /db_xref="GOA:Q088P6"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088P6"
FT                   /protein_id="ABI70269.1"
FT                   /translation="MQFKQDFFEQLEGFYSQVYPLPISNPHWLGWSDDAAQLIGLEKPN
FT                   AELLMQLSANYAAPGASYYAQVYSGHQFGGYTPRLGDGRSIILGEAIGPNGAWDVALKG
FT                   GGPTPYSRQGDGRAVMRSAVREFLVSEALAALNVPTSRALAVIGSDLPVWRESQETAAI
FT                   TVRLAKSHIRFGHFEYFFHSEQGDAAKLTQLVNFTIQQHFPHLSTDAAGYKQWFYEVVQ
FT                   STAKMIAHWQSVGFAHGVMNTDNMSILGDTFDFGPFAFLDTFKEGFICNHSDHEGRYAF
FT                   GQQPGIGLWNLKRLAQTLTPIIESDDLIAALNTYQFELVQQYLLLMRAKLGFSQPNQSP
FT                   NAINAEEQADLGNKDLQLVGQLTGLLETNQLDYTNSLRRFGQLDPSSAHSSLRDDMVDL
FT                   AGFDTWYQAYQSRVGEVADVNAWQCERNSANPKYILRNYLAQEAIIAIEENGDNSKLLQ
FT                   LQQLLQRPFDEQSEMEDFAKRPPQWGQGLIMSCSS"
FT   gene            443368..443670
FT                   /locus_tag="Sfri_0408"
FT   CDS_pept        443368..443670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70270"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:Q088P5"
FT                   /protein_id="ABI70270.1"
FT                   /translation="MKLLSAKLDPAALSIVIQAEVDFEQFEQFAEPLAAALDCDIRERQ
FT                   WGADRHQWLLNFEGSPLWLHYEFYGDICWISTDSANELDVLAFLLTLLAPHIQTA"
FT   gene            443681..444682
FT                   /locus_tag="Sfri_0409"
FT   CDS_pept        443681..444682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0409"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   son:SO0332 hypothetical kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70271"
FT                   /db_xref="GOA:Q088P4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q088P4"
FT                   /protein_id="ABI70271.1"
FT                   /translation="MDNGTGAEFHFQALRPDLILDAIESIGVFPETGLLALNSYENRVY
FT                   QFRCDQGIRYVVKFYRPHRWSNEQIQEEHDYALALAAEDIPIAVPMVIEGKTLFEYQGY
FT                   RFGLFPSIGGRAFEVDNLEQLESVGRFIGRIHQYGAMQPFKYRESLTPAILGDESYRYL
FT                   RESGIVASSMQTAFFTVVEQVLDKAKQIWQQHNFTSIRLHGDLHPSNILWTPDGPGFVD
FT                   LDDARQGPAVQDLWMMLTGDRQQQLLQIDILLEGYQEFCDFDAKQLALIEPLRAFRMVH
FT                   YNAWLAKRWDDPAFPMNFPWFGDIKYWEQQTLAFKEQLSALNEPPLSLPSFN"
FT   gene            444814..445431
FT                   /locus_tag="Sfri_0410"
FT   CDS_pept        444814..445431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0410"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: son:SO0333
FT                   thiol:disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70272"
FT                   /db_xref="GOA:Q088P3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q088P3"
FT                   /protein_id="ABI70272.1"
FT                   /translation="MKKALLMAAALLLAPMAAMAADYKEGVHYTVINDGPETAKPEITE
FT                   FFSFYCPHCFNFSKTVVPKIEANLPEGVAFNQSHVEFIGRDMGVEMSRAFAVAQQLNVE
FT                   KKMDAALFTAIHDKRQQFTRPDDIRAIFIANGVDGKAYDAAASSFMVNAQMSKMKRDTE
FT                   NAKISGVPTLVVNGKYRVETSSIKSYDELIDIAFYLTSMNKK"
FT   sig_peptide     444814..444876
FT                   /locus_tag="Sfri_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            445936..446139
FT                   /locus_tag="Sfri_0411"
FT   CDS_pept        445936..446139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0411"
FT                   /product="protein of unknown function DUF1107"
FT                   /note="PFAM: protein of unknown function DUF1107; KEGG:
FT                   son:SO0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70273"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:Q088P2"
FT                   /protein_id="ABI70273.1"
FT                   /translation="MRMFPVYAPKLIVKHARIFLSGVIWVKDLGLIEFDKGRFLQTKKS
FT                   LPEVKQAISELNALIEIQSKQH"
FT   gene            complement(446145..446366)
FT                   /locus_tag="Sfri_0412"
FT   CDS_pept        complement(446145..446366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0412"
FT                   /product="protein of unknown function DUF904"
FT                   /note="PFAM: protein of unknown function DUF904; KEGG:
FT                   son:SO0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70274"
FT                   /db_xref="GOA:Q088P1"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088P1"
FT                   /protein_id="ABI70274.1"
FT                   /translation="MSLELLSQLETKIQATLENIELLKMELDEEKQKNEALLSQQQELT
FT                   QKNQQLQQDLNSWSDKVNGLVGLLNNEI"
FT   gene            446539..446892
FT                   /locus_tag="Sfri_0413"
FT   CDS_pept        446539..446892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0413"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: son:SO0337
FT                   hypothetical translation initiation inhibitor, YjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70275"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q088P0"
FT                   /protein_id="ABI70275.1"
FT                   /translation="MTITRLDVNTRMSSIVIHNNTVYLCGQVAKDKFTDINTQTITMLE
FT                   EVESLLAQSGSRRDHILSATIYLKDMADYDAMNQVWDSWLPKGHAPARACVQAAIAEPE
FT                   YLVEISVIAAVVS"
FT   gene            447128..448219
FT                   /locus_tag="Sfri_0414"
FT   CDS_pept        447128..448219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0414"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="KEGG: son:SO0340 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70276"
FT                   /db_xref="GOA:Q088N9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N9"
FT                   /protein_id="ABI70276.1"
FT                   /translation="MDIKYNLKSASERRTEPFKPEGDVGFGKLRTDHMFLMDYRDGQWC
FT                   DPRIVPYGPFEMAPGAMSLHYGQSIFEGAKAFMHEDGEIYTFRLNKNAERMNRSADIVC
FT                   IPNIDESMQVKAINALIDVDRLWFPQQQGACLYIRPFIFATEDRLSVSPSQQYTFCVML
FT                   SPSGAYYASGVNNGIRLLISTKYHRAVSGGTGASKAAGNYAASLRAGKAAVEYGASQVL
FT                   YLDSTNTQIEEAGAMNHFHILKDGTVIIPTFTDTILKSITSQSIMELGDMLGCEVRQET
FT                   VMLDKFIADIEAGEIIEAGGFGTAAVVSPVSSYIFEDGRILTVGDGKVGPNIQRIYKLF
FT                   TDLQKGNVAAPQGWVKRVERVAP"
FT   gene            complement(448276..452736)
FT                   /locus_tag="Sfri_0415"
FT   CDS_pept        complement(448276..452736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0415"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: son:SO0341 sensory box protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; Two component
FT                   regulator propeller; Two component regulator three Y domain
FT                   protein; PAS fold-3 domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70277"
FT                   /db_xref="GOA:Q088N8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N8"
FT                   /protein_id="ABI70277.1"
FT                   /translation="MSVSAQKNDPYDSLTEVKFDHFSTEGDLNQNSITRLFMDSSGMLW
FT                   IGTQDGLHSYNGVEFDLYLKQSKNINSISGNFITDILQSPDGDLWIGTFNNGLNRLNLT
FT                   TGEFTAFKQPQGLTELQVTHLAVIGDTLWVGTRSGLYILSLKTEKIIPVSLGNNITPNI
FT                   TSIANIDDKYIVIGTQSHGTFAIDSNTIIRLDIPVNMTVNQIKSSSVYSVWLAIDNQIW
FT                   RYNLDTHKKELIWSHDNGLGNNRKIIDFVVVNANQIFAIGNNTGLFKLDFIDGKWRSTL
FT                   YKHNPQKLNTISANTLQNLMLDQNGTLWIGTGYSGIDKLNLSHQYFSHFYDYQTNAPGM
FT                   ANMIRVILRDTQQRLWIGTDGAGLKYLAPNDNQYHYINDLFAKKLAIPTEQLSLIVHDI
FT                   KQDKQGVLWFATNVGLFTLDKSNTLQQIKPANGQFHTDTQIRSLAFDDKDRLWIASSQG
FT                   LYFISEYTNRMMAYNFGFQADFSPFKYQIIRLYFSQGYLWLGTMGGVVRLSVEERKLDF
FT                   LSHDSENPYSLSDNRVRDFLQAENGDFWVATHGGIDKLTVEYGTFKFERMDVNADNSSN
FT                   TVYAILEDDKHDLWLSTNSGVSRFTPSTRSFISYNKFEGLQANEFNGAAKFKELNGTLW
FT                   FGGIRGLNQFNPSTIPSQRAENKLALTKYTIGETQHPIRDLSHAPRIIMPYEQQLISFE
FT                   IGSLNFSYPGLSRFSYFLDGYDNDWRELSHGNEITYTNLPPGEYKLAVRHALGTNRYSE
FT                   YTLNVNVSVVPPMYMTSTAYILYVTVGLLIIIWFFYARQKKVAKQREFDNSIRASEERL
FT                   KLALWASGDGMWDWNIKDDKVYRTNMVEPMSFSLKDQLLIKNIDPEDRPRVQKLLNDHL
FT                   NGESEFFEAEYRVETKPGQWAWVLDRGQIVERDSNNIPVRMAGTHKDITSRKITENELK
FT                   LSSQVLFSMNEAVVVGELDYQIRSINPAFSRITGFKHRDVVGKHFLFLTMGKQSREFYN
FT                   SVETQLLRHKHWAGEIHIRTRNRRGILAWLEINQVIDNKGETSHFVAVFTDITARKKAE
FT                   EDLRVLANFDPLTGLPNRTLFQDRLNQAVTKAHRANSIVALLFLDLDRFKHINDSMGHH
FT                   IGDLLLKAVAHRLQNAVRDGDTVARLGGDEFTIILEGVAKTKAATIIAEKVLHAFQTPF
FT                   LLDDKILTISPSIGISLYPEDADDTTSLIKYADTAMYHAKSLGRNNFQFYTEQLNQYAT
FT                   RHVQLEAGLKKAIQDNELYLVYQPKYDVKTEKIIGLEALMRWESPELGFISPVEFIPLA
FT                   EETGIINQIGHWAIQQACNQLAQWHQQGFEHISIAVNLSARQLKADIISTIEVALAVSG
FT                   LPASALELELTESMIMGNPQDSVTVLSQLKALGLTIAIDDFGTGYSSLSYLKRFPIDTL
FT                   KIDREFVRDITEDPDDAAITSAIITLAHSLELNVVAEGVETQAQLNFLREGGCDQVQGF
FT                   LLSKPLSAVDCLALLTQDKSEVSHS"
FT   gene            complement(453023..453928)
FT                   /locus_tag="Sfri_0416"
FT   CDS_pept        complement(453023..453928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0416"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   son:SO0347 acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70278"
FT                   /db_xref="GOA:Q088N7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N7"
FT                   /protein_id="ABI70278.1"
FT                   /translation="MLAFLPGPILFIISLSLLIINTVVWSTLLTIGGVAKLLLPFLPAR
FT                   QLLTRIMNRFMWSWATCNGGILYLISNIEWDVKGLEKLDPNGWYLLISNHVSGFDIAAQ
FT                   TYLLRNHIPMLKFFLKKELLYVPIMGLGCWALDMPFMDRTSAAKLKKNPKLKGKDLQTT
FT                   RKACERFKHMPTSIINYVEGSRFTEEKRLRQNSPYRHLLRPKASGIAFTLSAMGEQFTG
FT                   LLNITLVYPETSEKVLTNVMHGRTKKVVVRIETLPVPKVDSEVYFSSPETRVEFQRWLN
FT                   QLWVEKDQQIDDIIKAYQQQ"
FT   gene            complement(453935..454831)
FT                   /locus_tag="Sfri_0417"
FT   CDS_pept        complement(453935..454831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0417"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   son:SO0348 acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70279"
FT                   /db_xref="GOA:Q088N6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N6"
FT                   /protein_id="ABI70279.1"
FT                   /translation="MSLLSKIKGSIAFLCYLFNTIFWTIPILAFSIVKLIPIGICQKIC
FT                   SYILDNCATAWISVNTIVESIFHPMRIHVTGDQSFSEQEWYMVIANHQSWVDILILQRV
FT                   FNRKIPFLKFFLKQELIFVPVLGLAWWALDFPFMRRYSTSQLRKNPKLKGKDIEITRKA
FT                   CEKFKTKPVSIMNFVEGTRFTEAKHDKQGSPFQHLLKPKAGGMAFALSAMGEHINKLVN
FT                   VTIYYPDTVPTYWHYICGGLSEVRVDIKITDIPQRMRGDYLKDREFKIEFQEQLNQIWL
FT                   EKDLQLQNFASQAKQED"
FT   gene            complement(454911..456434)
FT                   /locus_tag="Sfri_0418"
FT   CDS_pept        complement(454911..456434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0418"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: son:SO0349 magnesium chelatase family protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70280"
FT                   /db_xref="GOA:Q088N5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N5"
FT                   /protein_id="ABI70280.1"
FT                   /translation="MAIACVFTRASCGVEAPRVTVEVHLSNGLPAFNLVGLPETSVKEA
FT                   KERVRSALINAGFEFPQKRITVNLAPADLPKQGGRYDLPIAVGILAASNQVPAKALHQC
FT                   EFVGELALSGQIRPCSGLLPAIIAARNDQHHFFMPIENRHEAELVGYKHSYFVAHLQNL
FT                   AAFLHGQAQLPLLDTLPEWIEEEIQAQSSLCMSDVIGQYQAKHGLEIAAAGGHNMLFIG
FT                   PPGTGKSMLANRIIPLLPKLTYDEAIEVAAIHSVAGLHVKPQNFLNRPFRSPHHTSSSI
FT                   ALIGGGSHPKPGEISLAHRGILFLDEIAEFPRKVLDCLREPLETGQVEISRAAAKLTFL
FT                   SRFQLIAAMNPSPCGDTERARSTPDQIQRYLSRLSGPFLDRFDLTVDVPKLPAGTLTQQ
FT                   HQPSESSVEIAKRVKQARDLQLSRSGVLNSELTPKQLKQDGAITQPDLAFLEQSVVSLG
FT                   LSVRSFHRIQRVSRTIADLQQSPTTERSHIAQALGYRAMDRLLAKLNQQ"
FT   gene            456801..458108
FT                   /locus_tag="Sfri_0419"
FT   CDS_pept        456801..458108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0419"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: son:SO4351 CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70281"
FT                   /db_xref="GOA:Q088N4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N4"
FT                   /protein_id="ABI70281.1"
FT                   /translation="MSLSDNLLIILCLIGISCFFSMSEIALAASRKMRLQLMADEGDLR
FT                   AAKVLKLQAHPGSFFTVVQIGLNAVAIMGGIVGESAFRPHFEQLLLPLLGNEWGLQLSF
FT                   VCSFVTVTSLFILFADLMPKRIAMVIPEQVAVTFVMPIILCIKVLKPFVWIFNGLANAI
FT                   FKLLQVPTARNDQVTHDDIYAMMTAGTEAGVMDKGEQQMMENVFEMQSVSVTSAMTARE
FT                   SLVYFLLQDSEDDIKQKIAKNPHNKFLVCDGQLDMIKGFVDAKELLIRVINGENITLKG
FT                   STLVHNCLIIPDTLTLSESMEYFKNNRSDFAVVMNEYALVVGIVTTNDLQSAVMGAWSL
FT                   HESEEQIVARDGNSWLVDGVTPITDVMRAFNIEVFPHNQNYETIAGFMMYMLRKIPKRT
FT                   DFVNYAGYKFEVVDIDSYKVDQLLVTRLDIETPPLP"
FT   sig_peptide     456801..456887
FT                   /locus_tag="Sfri_0419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            complement(458141..459013)
FT                   /locus_tag="Sfri_0420"
FT   CDS_pept        complement(458141..459013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0420"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO4350 transcriptional
FT                   regulator ilvY"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70282"
FT                   /db_xref="GOA:Q088N3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N3"
FT                   /protein_id="ABI70282.1"
FT                   /translation="MDIRSLKMYLHLCDSLHFAKTAEQSHVSPSTLSRALQRLEDEVGS
FT                   KLFDRDNRSVTITHAGVEFKRFAEQTLSEWTQLRSRIDPSQQFLRGNLNLYCSVTAAYS
FT                   HLPALLDRFRREHPHVDINLNTGDPANAVNQIQKNRADIAIIALPEAFPSSLHFTPIDK
FT                   VPISVIAPTIQCQVQQWVSQAKIDWAKLPYIVPDHGPGRKRIDLWFKQMGIKPNIYAQV
FT                   SGQEAIVSMVALGCGVGISPEAVIHNSPVRDRIQTLASPIPIPPFELGCCCKEKRTNDP
FT                   IIRAFLDII"
FT   gene            459222..460703
FT                   /locus_tag="Sfri_0421"
FT   CDS_pept        459222..460703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0421"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: son:SO4349 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase,
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70283"
FT                   /db_xref="GOA:Q088N2"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N2"
FT                   /protein_id="ABI70283.1"
FT                   /translation="MANYFNSLNLRQQLAQLAQCRFMDRTEFSDGCQYIKDWNIVILGC
FT                   GAQGLNQGLNMRDSGLNISFALRPQAIAEKRASWQKATDNGFKVGTFEELIPAADLVLN
FT                   LTPDKQHTNVVNAVMPLMKQGATLSYSHGFNIVEEGMQVRPDITVVMVAPKCPATEVRE
FT                   EYKRGFGVPTLIAVHPENDPNSDGLAIAKAYASATGGDRAGVLMSSFVAEVKSDLMGEQ
FT                   TILCGMLQTGAILGYEKMVADGVEPGYAGKLIQQGWETVTEALKHGGITNMMDRLSNPA
FT                   KIKAFDMAEELKVILKPLFEKHMDDIISGEFSRTMMEDWANDDTNLLRWRAETNETAFE
FT                   NAPVSSEHIDEQTYFDKGIFLVAMIKAGVELAFDTMVAAGIVEESAYYESLHETPLIAN
FT                   TIARKRLYEMNVVISDTAEYGCYLFNHAAVPMLRDYVNAMSSEYLGAGLKDQATGVDNL
FT                   RLIDVNDQIRNTEVEFIGAELRGYMTDMKSIVEAS"
FT   gene            461286..462953
FT                   /locus_tag="Sfri_0422"
FT   CDS_pept        461286..462953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0422"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding; thiamine pyrophosphate enzyme,
FT                   central region; thiamine pyrophosphate enzyme TPP binding
FT                   domain protein; KEGG: son:SO4347 acetolactate synthase
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70284"
FT                   /db_xref="GOA:Q088N1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N1"
FT                   /protein_id="ABI70284.1"
FT                   /translation="MRGADAVIKVLAAHGVTTVFGYPGGAIMPIYDALYGGPVEHLLSR
FT                   HEQGAAFAAVGYARASGKTGVCFATSGPGATNLITSLADALLDSVPLVAITGQVSTSVI
FT                   GTDAFQEIDVLGMSLSCTKHSFMVTDINELIPTLYRAFEIAAEGRPGPVLVDIPKDIQL
FT                   AALEYKTPLQSVADELQPQVNDLDAAAELIKHAKKPMLYVGGGVGMAGAVAHLRQFIDT
FT                   TGIPSVATLKGLGSIAHGTKGYLGMLGMHGGKGANLAVQECDLLMVVGARFDDRVTGRL
FT                   ASFASNAKVLHLDIDAAEIGKLRQADVAIAAELSIVLPALTAAVADTLDIAQWQADVEE
FT                   LSRKHQWNYQHPGDLIYAPAMLRRLANKLPEDSVVACDVGQHQMWVAQHMWFRRPEDHL
FT                   SSAGLGTMGFGLPAAIGAQVARPDATVVTVSGDGSFMMNVQELTTIKRRKLPVKILLID
FT                   NQKLGMVKQWQQLFFEERYSETDLSDNPNFVLMASAFDIPGRTITRADQVEQGLDDMLN
FT                   SSGPFMLHVSIDDAFNVWPLVPPGASNSEMMDQMEKQT"
FT   gene            462950..463207
FT                   /locus_tag="Sfri_0423"
FT   CDS_pept        462950..463207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0423"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="KEGG: son:SO4346 acetolactate synthase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70285"
FT                   /db_xref="GOA:Q088N0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q088N0"
FT                   /protein_id="ABI70285.1"
FT                   /translation="MMHALEITVQQRPEVLERVLRVTRHRGFKVTQMQVRINEDASMAV
FT                   DLWVEAERAIELLSNQLDKLIDVTHCKVLSAAPLNQVANG"
FT   gene            463340..465199
FT                   /locus_tag="Sfri_0424"
FT   CDS_pept        463340..465199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0424"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: son:SO4345 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70286"
FT                   /db_xref="GOA:Q088M9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088M9"
FT                   /protein_id="ABI70286.1"
FT                   /translation="MPKLRSATSTEGRNMAGARALWRATGVKENDFGKPIIAIANSFTQ
FT                   FVPGHVHLKNMGSLVAGAIEEAGGIAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLSDQIIKLD
FT                   LVDAMIAGADSNVSDEDSKQIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSML
FT                   ATHEDRRELFLEAGRRVMMLAERYYKHDDETALPRNIASFKSFENAMVLDVAMGGSSNT
FT                   VLHLVAAAQEAEIDFTMADIDRISRLVPHLCKVAPSTPKYHMEDVHRAGGVMGILGELD
FT                   RAGLIHNDVPHVAADNGGDLKSVLAKYDIKQTNDPDVIRFFSAGPAGIPTTKAFSQNCR
FT                   WDSVDDDRENGCIRSREFAFSQEGGLAVLSGNVAVDGCIVKTAGVDESNLTFVGSARVY
FT                   ESQDDAVAGILGGEVVEGDVVVIRYEGPKGGPGMQEMLYPTTYLKSRGLGAKCALITDG
FT                   RFSGGTSGLSIGHVSPEAASGGTIALIENGDQIAIDIPKRSIQLNVSEAELTQRRTAMD
FT                   AKGPLGWKPVSRERYVSLALKAYALLATSADKGAVRDRTKLEG"
FT   gene            465201..466772
FT                   /locus_tag="Sfri_0425"
FT   CDS_pept        465201..466772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0425"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: son:SO4344 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70287"
FT                   /db_xref="GOA:Q088M8"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M8"
FT                   /protein_id="ABI70287.1"
FT                   /translation="MLALASQTQLDLAHYYLQKILLSSVYDVAKVTPLSSMNKLSARFG
FT                   CQVYLKREDMQPVHSFKLRGAYNRIAALTQDECNKGVVCASAGNHAQGVAMSAASRGID
FT                   AIIVMPSTTPDIKIDAVKRLGGTVVLHGQAFDQANDYAKNLSATEGRVYIAPFDDEAVI
FT                   AGQGTIAQEMVQQQRDIEIVFVPVGGGGLIAGIAAYYKAVMPQVRIIGVEPEDAACLKA
FT                   ALEADEPVTLAQVGLFADGVAVKRIGTEPFRLAREYVDEVITVTSDEICAAVKDIFEDT
FT                   RAIAEPAGALSIAGLKKYMAQQGDSIDAPKKVAAILSGANVNFHSLRYVSERCELAEQK
FT                   EAVLAVKIPEKPGSFLRFCELLDKRVMTEFNYRFSSRDIAVVFAGIRLTGGQAELSEII
FT                   AKLESEGFEVQDLSQDETAKLHVRYMVGGHPLEPLEERLFSFEFPEHPGALLKFLTTLQ
FT                   SKWNISLFHYRNHGAAFGRVLTGFEVPAKDDVAFAQFLTELGFVYQEETHSPAYKLFLN
FT                   STKAKS"
FT   gene            467208..468350
FT                   /locus_tag="Sfri_0426"
FT   CDS_pept        467208..468350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0426"
FT                   /product="alanine-glyoxylate aminotransferase"
FT                   /EC_number="2.6.1.44"
FT                   /note="PFAM: aminotransferase, class V; KEGG: son:SO4343
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70288"
FT                   /db_xref="GOA:Q088M7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M7"
FT                   /protein_id="ABI70288.1"
FT                   /translation="MLPVPTIQAFMPPRRILMGPGPSDVYPEVLAAQSRPTIGHLDPLF
FT                   VGMMDELKSLIQYAFQTKNEMTLAVSAPGSAGMETCFVNLVEPGEKVIVCRNGVFGERM
FT                   RQNVERVGGVAVVVDNEWGEPVCPDKVEAALVAHPDAKFLAFVHAETSTGALSDAKTLC
FT                   TLAQLHDCISIVDAVTSLGGVELLVDEWGIDAIYSGSQKCLSCVPGLSPVSFSPKAVAK
FT                   LKARTTQVQSWFLDQTLVMGYWGNGNGAKRSYHHTAPVNALYALHESLRLLANEGLENA
FT                   WARHRKMHLLLRDGLTKLGLKFVVEEASRLPQLNTVYIPDGVDDAAVRKHLLEEYNLEI
FT                   GAGLGALAGKAWRIGLMGYGARRENVSLCLHALEESLNQN"
FT   gene            complement(468469..468720)
FT                   /locus_tag="Sfri_0427"
FT   CDS_pept        complement(468469..468720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0427"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   son:SO4329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70289"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M6"
FT                   /protein_id="ABI70289.1"
FT                   /translation="MINPKKIEELAKQLSDNLPSGVKQFAGEFEERSKQILQNQLMKLD
FT                   VVSREEFEVQQHVLLKTREKLEALQAQVNELEKSLLSN"
FT   gene            468864..470876
FT                   /locus_tag="Sfri_0428"
FT   CDS_pept        468864..470876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0428"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: son:SO4325 ATP-dependent DNA
FT                   helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70290"
FT                   /db_xref="GOA:Q088M5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M5"
FT                   /protein_id="ABI70290.1"
FT                   /translation="MKLNPGQNEAVHYVSGPCLVLAGAGSGKTRVIINKIAYLVEKCGY
FT                   KARNIAAVTFTNKAAREMKERVAQSMGRKEARGLWISTFHTLGLEIIKREHKVLGLKAG
FT                   FSLFDDQDTFALLKELTEDELDDDKDLIKSLASAISNWKGGLVIPQQAKSMAKDEQSQL
FT                   FAMLYARYAQHMKSYNALDFDDLILIPTLLLRMNEEVRTRWQTKIQYLLVDEYQDTNTS
FT                   QYELVKLLVGERARFTVVGDDDQSIYSWRGAKPQNLVLLGTDFPRLKLIKLEQNYRSSQ
FT                   RILRAANILIANNPHVYDKALFSELAYGEPLRVLIAANEEQEAERVVAEIIRHKFVGRT
FT                   KFGDYAILYRGNHQSRLLERSLMTNRIPYKLSGGTSFFSRAEIKDIMGYLRLVVNPDDD
FT                   NAFLRVVNLPKRGIGPASLERLGNFANQKHISLFEAIFDVELNHHLAPAAVNSLYQFGK
FT                   FIVDTGEVASRGEPVEAIKQLIRKINYEDYLYETSTSAKAAEMRMKNISELYRWVTEML
FT                   EGDELDEPMTLPEVVTRLTLRDMMERNSEDEGGDQVQLMTLHASKGLEYPFVFMVGVEE
FT                   RILPHQSSIDEDNVDEERRLAYVGITRAQRELWFVICRERRQFGETMRCEPSRFLLELP
FT                   QDDLIWENRKPVQTEEQRVETSKSHIANIRDMFKK"
FT   gene            complement(470901..473525)
FT                   /locus_tag="Sfri_0429"
FT   CDS_pept        complement(470901..473525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0429"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   KEGG: son:SO4324 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70291"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M4"
FT                   /protein_id="ABI70291.1"
FT                   /translation="MDTAISHSIASPRVEHLQKRIARLKRLAKKYKRSEIIQNALLGIS
FT                   NIATQVTSLDDFYQRVHLHLQQLIPAENFFIASQDPKTGLTSLPFFADQQDSHPTELYP
FT                   DQEISALLNSGLTGYVLRNGTPLLCDDIKFNELIASGDIKSLGSPSHQWLGVPIKNQEI
FT                   VSGVLVVQSYNEANTYGELELELMGFICHHISGVMERLEHHEQLEQAIVERTKELSQAY
FT                   EKVKKEITERVKAEKLQKALFEIADLSASNVLQQDFYLRLHTIMSQLIPADNCFISLIN
FT                   DNNMLSFPFYVSQMTTEYPASRPMQDGLTEYILEHKLPRLLSSKDIADMVANGEIYAKS
FT                   PELNKTDRMHQWIGIPLIINGDIAGALTIYSLDDAHIYQFKDLELLTFVSQHMANAIER
FT                   KLATESLKNSHEQLEDKVVKRTKALAELNNNLQQEINQRRKIENQLLHDAQHDGLTGLP
FT                   NRSYLMERLSQALKHLRRHGLDQFALLFIDLDRFKVINDSFGHLEGDRFLIETAQRIKS
FT                   CVRENDTLARMGGDEFVILLDSINATEDAIEVSDRILQALSMPYQLAKQEFISGASIGI
FT                   AFSGRNKLVTSESLLRDADAAMYQAKANGKGCYVIFDDKLSAQSKLQHELEIDFKKALD
FT                   QQEFKINYVEVVDFTTGEIIAIEPHIEWHHPEQGLIEHGKMKQLAAQYQLTLNIDGYIF
FT                   SNLNEQYQFLKSKHGPSVYLHLSISSQHIKNKFVLRNLKQTIKSSHINLEKLILFFNEK
FT                   ALVQDTENHINGFELISQLGVQIGIDGYGTGYSSLSCLSFLPIKALKLDDDISKHLLND
FT                   KQLQLVKAYQLTAQTLNFDMYATTVDTQQQVRQFLELGYVRGQGRAISKLFNEKKKPHK
FT                   ACA"
FT   gene            473790..473866
FT                   /locus_tag="Sfri_R0018"
FT                   /note="tRNA-Arg2"
FT   tRNA            473790..473866
FT                   /locus_tag="Sfri_R0018"
FT                   /product="tRNA-Arg"
FT   gene            473918..473993
FT                   /locus_tag="Sfri_R0019"
FT                   /note="tRNA-His2"
FT   tRNA            473918..473993
FT                   /locus_tag="Sfri_R0019"
FT                   /product="tRNA-His"
FT   gene            474015..474091
FT                   /locus_tag="Sfri_R0020"
FT                   /note="tRNA-Pro2"
FT   tRNA            474015..474091
FT                   /locus_tag="Sfri_R0020"
FT                   /product="tRNA-Pro"
FT   gene            474157..474233
FT                   /locus_tag="Sfri_R0021"
FT                   /note="tRNA-Pro3"
FT   tRNA            474157..474233
FT                   /locus_tag="Sfri_R0021"
FT                   /product="tRNA-Pro"
FT   gene            474297..474373
FT                   /locus_tag="Sfri_R0022"
FT                   /note="tRNA-Pro4"
FT   tRNA            474297..474373
FT                   /locus_tag="Sfri_R0022"
FT                   /product="tRNA-Pro"
FT   gene            complement(474956..476878)
FT                   /locus_tag="Sfri_0430"
FT   CDS_pept        complement(474956..476878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0430"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; histidine kinase, HAMP region domain protein;
FT                   KEGG: son:SO4323 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70292"
FT                   /db_xref="GOA:Q088M3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M3"
FT                   /protein_id="ABI70292.1"
FT                   /translation="MTLFRQIYALLFGLFLLTIASVAYVQFSETQGFLSKQMESDLNNA
FT                   SNSLGLMLTPVLEAGDDAGAETLVNVIFEGGYYQQIKLTWLVDGKQQVWNNSVKVDNIP
FT                   QWFINLNLFKTIKKQTTITSGWLQLATLEITAHPGFGYQELWRIISDIIILFSILFLIA
FT                   IIFARVGLSWILKPLNTLSLHAKQIAAQQFGPDMPTPKTRELKELVNAFNSMSAQLKQV
FT                   FNSLDEEVSALRKKNLVDQVSGLPNRQYMVSRVNGWLSEPSTGALYLVKMDWLEDVHSK
FT                   YGFQVRDETIRILAEKLQHHQDEIASSVIARIAAYEFAFLVEDCEHDQLAKYLQSLIRT
FT                   VNKEISKAGCKPNEQFYIGVAERLGQMTVSDMLAQADNALQQSIKDDKVFHWFENTQKQ
FT                   LFTREEWRNNLSHAIKNKKFQFRWQSIQLCAKDEICQRELYCQLQIGDTILHAGQFVPY
FT                   IELLSLGTMFDRCLIETVNEHRLLERNYERVAINLTYQSISDVDFHLWLKQFLRANKYA
FT                   ERICFEIPEASVYSDLESCENLCKVIRDSGAQFGIDHFGRQFGSMAYLQSLRPNYVKLD
FT                   QSFAYIEENQHNSELCRALVNVAKGLDIQVIVTGIQEAKQLTRFTELRVDAYQGFIVPP
FT                   VNVKL"
FT   sig_peptide     complement(476807..476878)
FT                   /locus_tag="Sfri_0430"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.518 at
FT                   residue 24"
FT   gene            complement(476886..477536)
FT                   /locus_tag="Sfri_0431"
FT   CDS_pept        complement(476886..477536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70293"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M2"
FT                   /protein_id="ABI70293.1"
FT                   /translation="MTSALLVSCLYAAPTQELNQQKTVSALSKRYGDRAGLRANAWFKI
FT                   VNDSQQLAEIDKLEKVNQFFNLFRFIDDQTLWGDSNYWASPMEFIGVNGGDCEDFSIAK
FT                   YFTLLQLGIPEDKLRITMVKATSLNQYHMVLAYYEKPNSIPLVLDNLDKTIKLATKRKD
FT                   LLPVYSFNGKQLWLNKERGRGVLAGSSSRLEKWTDLKLRLGVDRLRQPKLNME"
FT   gene            complement(477619..478221)
FT                   /locus_tag="Sfri_0432"
FT   CDS_pept        complement(477619..478221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0432"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: son:SO4321
FT                   OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70294"
FT                   /db_xref="GOA:Q088M1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M1"
FT                   /protein_id="ABI70294.1"
FT                   /translation="MKYLIILLALITTGCSVNDIVESNASTQQNFDLADSDRDGVIMAR
FT                   ERCASTLIGAAVDNYGCGSIKDINERQDLKILFSNNSVVIEPQYYNQIERVANVMTTYP
FT                   TTKVTIEGHTSKRGSYELNLALSQKRAKAVIEVLENTFGIDPSRLNATGYSFDRPIDNS
FT                   GTPEAEERNRRVVAEVTADDTIPEMRWNIYTVDEQID"
FT   gene            complement(478221..479630)
FT                   /locus_tag="Sfri_0433"
FT   CDS_pept        complement(478221..479630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0433"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family protein"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   son:SO4320 agglutination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70295"
FT                   /db_xref="GOA:Q088M0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q088M0"
FT                   /protein_id="ABI70295.1"
FT                   /translation="MTTIINQQIKLSAVALALLMLVSPTASSQTLEQAVAHTLDTNPDL
FT                   RIAFNRFKAREEQVNQAVAGYMPTVDISAGYGWEQTDSPSTRRKVGQGDVDNDGMIDLE
FT                   RGEAGFSIKQMLFDGFYTSSEVDRYSFEASADQWALFAAAEDMALDVAKVYLNYIRSEQ
FT                   VLLLSEKNLASHKEIYDQIKQRTDSGLGSIADLSQITGRLARANANVISAQNNLEDARA
FT                   AYIRIVEAKPDDLILPVPDADMLPKSLDKGLMAAKSKHPVLKSAESDINAAKKERSSAQ
FT                   ANYFPQLSLELNGNWNNDTDGEDGYSAINSQNVNGYNNDLVAMVRVKYNLFSGGKDVSK
FT                   DRETAYKVNEAKEIQQRAYRQVVEGVSLAWNAYEMLAPQKQFIREHVVAAKQTQVAYVQ
FT                   QFNLGQRTLLDLLDTENELFEARKDYLQTEYDEIAARYRVLNATGDLLDSLRVTRPGEW
FT                   RGEREYEGGVK"
FT   sig_peptide     complement(479544..479630)
FT                   /locus_tag="Sfri_0433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.970 at
FT                   residue 29"
FT   gene            complement(479653..481035)
FT                   /locus_tag="Sfri_0434"
FT   CDS_pept        complement(479653..481035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0434"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family protein"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: son:SO4319 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70296"
FT                   /db_xref="GOA:Q088L9"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L9"
FT                   /protein_id="ABI70296.1"
FT                   /translation="MSKHLTVADLEMVDDVYGAMMTDAPSGHRLIIWSLAAMMVCFFIW
FT                   AYFSELDQVTSGTGKVIPSSQIQIIQSLDGGILQEIYVQEGGIVTKGQPLARIDDTRFR
FT                   SDFDQQEQEVFGLQTNIIRMRTELDSIIISDMSSDWRQQVKITKQNLVFPQTIIDEEPE
FT                   LVKRQQEEYSIRLDNLSNQLEILVRQIQQRQQEIEELASRISTLTTSYQLVSRELELTR
FT                   PLARKGIVPEVELLKLERTVNDIQGELQSVRLLRPKVKASMDEAILKRREAVFVYATDL
FT                   RAQLNEMQTKLSRMNQAQKGAFDKVSKAVIASPVIGTIKKINFNTLGGVVQPGEEIMEI
FT                   VPSEDKLLIETKITPKDIAFLHPGLPAIVKVTAYDFTRYGGLKGTVEHISADTSQDEEG
FT                   NSFYIVKVRTQESSLMKDDGTEMPIIPGMLTSVDVITGKKSILEYILNPILRAKDTALR
FT                   ER"
FT   gene            complement(481032..483209)
FT                   /locus_tag="Sfri_0435"
FT   CDS_pept        complement(481032..483209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0435"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; peptidase C39, bacteriocin processing;
FT                   SMART: AAA ATPase; KEGG: son:SO4318 toxin secretion
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70297"
FT                   /db_xref="GOA:Q088L8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L8"
FT                   /protein_id="ABI70297.1"
FT                   /translation="MPITASNKSEQWTISASQRVTVDPLLDCLVLLTEHFGSPCSIDSL
FT                   AAGLPLSGAVITPDLIPQAAARAGLSAKLSRKDLNQISDILLPCILLLKDKKACILRKI
FT                   DLEQDQAVIQLPETGGEETLTIEGLETLYVGYLFLVKQDYRGDKSFDVHLHDSSTHWLL
FT                   QSIKDSAPIYRDALIASVLVNLFALVSPLFIMNVYDKVVPNLAFESLWVLAIGASIAYI
FT                   FDFIMRQLRSYLIDIAGKKVDIIVSSKLFAKAIGIPLSKRSPSVGGMARQLGEFDSIRE
FT                   FLTSATITALVDLPFALLFVIIIYIVAGDLAIIPVIGSLVIIAVTFYLQPKLKQAIEES
FT                   NRFASLKHGHLIESLTALESIKANGAEGLVQKSWQQMIGHTANWQLKTKKLSNYVSHIA
FT                   NFMVQLTVVLVVILGVYRLAENEISMGGIIAAVMLSSRAISPMAQLAGLITRGNHTISS
FT                   LRQLDAIMEQEDEFEDKGNLASKERFMGKIEADNISFSFPSSEKPSLHPLSIQINPGER
FT                   IAIIGRNGSGKSTLAKLLLGLYKPTQGSLRYDGLDAGQIHPSDLRRNFGYLPQDVTLFH
FT                   GTIRDNILFGSRQVTEHQLIRAIQLSGVSMFTNLESEGLDQQVGEGGLSLSRGQRQTVA
FT                   LARATLNDPSILLMDEPTASLDARAEKQFIRSMQLVSRDRTLLLITHKMHLLNLVDRII
FT                   VLERGHIVADGPKDEVLAKLNAGTIAGAQNS"
FT   gene            complement(483293..500656)
FT                   /locus_tag="Sfri_0436"
FT   CDS_pept        complement(483293..500656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0436"
FT                   /product="putative outer membrane adhesin like protein"
FT                   /note="TIGRFAM: putative outer membrane adhesin like
FT                   protein; PFAM: Hemolysin-type calcium-binding region; von
FT                   Willebrand factor, type A; Cadherin; KEGG: pfo:Pfl_0133 von
FT                   Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70298"
FT                   /db_xref="GOA:Q088L7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L7"
FT                   /protein_id="ABI70298.1"
FT                   /translation="MGSITTSKNGILSASESSVTITINNETKELQLGQVVPAGAIVASS
FT                   NNLGFVITFDDGTIFNSANIPNDESINTLADNLDDTIVAQVADQQALDEIEALQALIAS
FT                   GEDPTTDLPETAAGTPTANQGDFGYVAVTRDGDETLANSGYDTTGQAAAPTAVTQEEAL
FT                   TENDSPSVLVNDAITVGEDQVASGNVLVNDTDADSDLSVVTFEVDGQTYPAGTEVTLEG
FT                   GILIINEDGSYTFTPYENWNGTVPVITYTTNTGVTATLTIEVTPVDDVSVLVNDSNTVA
FT                   EDTVATGNVLDNDGDVDSDLSVVTFEVDGQTYPASTEVTLEGGVLIINEDGSYTFTPNE
FT                   NWNGTVPVITYTTNTGVTATLTIEVTPVDDVSVLVNDSNTVAEDTVATGNVLDNDGDVD
FT                   SDLSVVTFEVDGQTYPASTEVTLEGGVLIINEDGSYTFTPNENWNGTVPVITYTTNTGV
FT                   TATLTIEITPVEDPTVTVNDVVTVSEDTPASGNVLDNDSDPDSDLSVVTFEVDGQTYPA
FT                   GTEVTLEGGVLIINEDGSYTFTPNENWNGTVPVITYTTNTGVTATLTIEVTPTNDAPTI
FT                   DVVANDFTENSAVDGDVAATYTTFDEDGDALTVDFTPGSNDDGYYALVNGEVVLTQAGA
FT                   DLVNNGGTLPAVDLTVSDGSLTGQDSDTPGIAGQNDAPTIDVVANDFTENSAVDGDVAA
FT                   TYTTFDEDGDALTVDFTPGSNTDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLTVSDG
FT                   NLTGQDSDTPVITPTNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDALTVDFTPG
FT                   SNDDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPGIAGQNDAP
FT                   TIDVVANDFTENSAVDGDVAATYTTFDEDGDLLTVDFTPGSNTDGYYALVNGEVVLTQA
FT                   GADLVNNGGTLPPVDLTVSDGSLTGQDSDTPVITPTNDAPTIDVVANDFTENSAVDGDV
FT                   AATYTTFDEDGDALTVDFTPGSNTDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLTVS
FT                   DGSLTGQDSDTPGIAGQNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDALTVDFT
FT                   PGSNTDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLTVSDGNLTGQDSDTPVITPTND
FT                   APTIDVVANDFTENSAVDGDVAATYTTFDEDGDALTVDFTPGSNTDGYYALVNGEVVLT
FT                   QAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPGIAGQNDAPTIDVVANDFTENSAVDG
FT                   DVAATYTTFDEDGDALTVDFTPGSNTDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLT
FT                   VSDGSLTGQDSDTPVITPTNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDLLTVD
FT                   FTPGSNTDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPVITPT
FT                   NDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDALTVDFTPGSNDDGYYALVNGEVV
FT                   LTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPGIAGQNDAPTIDVVANDFTENSAV
FT                   DGDVAATYTTFDEDGDALTVDFTPGSNTDGYYALVNGEVVLTQAGADLVNNGGTLPPVD
FT                   LTVSDGNLTGQDSDTPVITPTNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDALT
FT                   VDFTPGSNTDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPVIT
FT                   PTNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDALTVDFTPGSNTDGYYALVNGE
FT                   VVLTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPGIAGQNDAPTIDVVANDFTENS
FT                   AVDGDVAATYTTFDEDGDALTVDFTPGSNDDGYYALVNGEVVLTQAGADLVNNGGTLPP
FT                   VDLTVSDGSLTGQDSDTPGIAGQNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDA
FT                   LTVDFTPGSNTDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPV
FT                   ITPTNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDLLTVDFTPGSNDDGYYALVN
FT                   GEVVLTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPGIAGQNDAPTIDVVANDFTE
FT                   NSAVDGDVAATYTTFDEDGDALTVDFTPGSNTDGYYALVNGEVVLTQAGADLVNNGGTL
FT                   PPVDLTVSDGSLTGQDSDTPVITPTNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDG
FT                   DLLTVDFTPGSNDDGYYALVNGEVVLTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDT
FT                   PGIAGQNDAPTIDVVANDFTENSAVDGDVAATYTTFDEDGDALTVDFTPGSNTDGYYAL
FT                   VNGEVVLTQAGADLVNNGGTLPPVDLTVSDGSLTGQDSDTPGIAGQNDAPTIDVVANDF
FT                   TENSAVDGDVAATYTTFDEDGDALTVDFTPGSNDDGYYALVNGEVVLTQAGADLVNNGG
FT                   TLPPVDLTVSDGSLTGQDSDTPVIAPTNDAPTIDVVANDFTENSAVDGDVAATYTTFDE
FT                   DGDALTVDFTPGSNDDGYYALVNGEVVLTQAGADLVNNEGTLPPVDLTVSDGNLTGQDS
FT                   DTPVITPINDTPVSDSYSFNYLENSTDSTVIGTVAATDPEGTPVTYSIVSGDSNGWFEI
FT                   DPVTGVISLTPAGVAAVANDFEALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEFT
FT                   PPAGETSYSFNYLENSSDSTVIGTVVATDPEGKDVSYSIVSGDSNGWFEIDPVTGVISL
FT                   TPAGVAAVANDFEALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEFTPPAGETSYS
FT                   FNYLENSSDSTVIGTVVATDPEGKDVSYSIVSGDSNGWFEIDPVTGVISLTPAGVAAVA
FT                   NDFEALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEFNPPAGETSYSFNYLENSSD
FT                   STVIGTVAATDPEGKDVSYSIVSGDSNGWFEIDPVTGVISLTPAGVAAVANDFEALANV
FT                   HNLVVGASDGVNTTNINVTLTELDVNEGPEFTPPAGETSYSFNYLENSTDSTVIGTVAA
FT                   TDPEGKDVSYSIVSGDSNGWFEIDPVTGVISLTPAGVAAVANDFEALANVHNLVVGASD
FT                   GVNTTNINVTLTELDVNEGPEFTPPAGETSYSFNYLENSSDSTVIGTVVATDPEGKDVS
FT                   YSIVSGDSNGWFEIDPVTGVISLTPAGVAAVANDFEALANVHNLVVGASDGVNTTNINV
FT                   TLTELDVNEGPEFNPPAGETSYSFNYLENSSDSTVIGTVAATDPEGKDVSYSIVSGDTN
FT                   GWFEIDPVTGIISLTPAGVAAVANDFEALANVHNLVVGASDGVNTTNINVTLTELDVNE
FT                   GPEFTPPAGETSYSFNYLENSTDSTVIGTVAATDPEGKDVSYSIVSGDSNGWFEIDPVT
FT                   GVISLTPAGVAAVANDFEALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEFTPPAG
FT                   ETSYSFNYLENSSDSTVIGTVVATDPEGKDVSYSIVSGDSNGWFEIDPVTGVISLTPAG
FT                   VAAVANDFEALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEFNPPAGETSYSFNYL
FT                   ENSSDSTVIGTVAATDPEGKDVSYSIVSGDTNGWFEIDPVTGIISLTPAGVAAVANDFE
FT                   ALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEFTPPAGETSYSFNYLENSTDSTVI
FT                   GTVAATDPEGKDVSYSIVSGDSNGWFEIDPVTGVISLTPAGVAAVANDFEALANVHNLV
FT                   VGASDGVNTTNINVTLTELDVNEGPEFTPPAGETSYSFNYLENSSDSTVIGTVAATDPE
FT                   GKDVSYSIVSGDSNGWFEIDPVTGVISLTPAGVAAVANDFEALANVHNLVVGASDGVNT
FT                   TNINVTLTELDVNEGPEFTPPAGETSYSFNYLENSSDSTVIGTVAATDPEGKDVSYSIV
FT                   SGDSNGWFEIDPVTGVISLTPAGVAAVANDFEALANVHNLVVGASDGVNTTNINVTLTE
FT                   LDVNEGPEFTPPAGETSYSFNYLENSSDSTVIGTVAATDPEGKDVSYSIVSGDTNGWFE
FT                   IDPVTGVISLTPAGVAAVANDFEALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEF
FT                   TPPAGETSYSFNYLENSSDSTVIGTVAATDPEGKDVSYSIVSGDSNGWFEIDPVTGVIS
FT                   LTPAGVAAVANDFEALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEFNPPAGETSY
FT                   SFNYLENSSDSTVIGTVAATDPEGKDVSYSIVSGDTNGWFEIDPVTGIISLTPAGVAAV
FT                   ANDFEALANVHNLVVGASDGVNTTNINVTLTELDVNEGPEFTPPAGETSYSFNYLENSS
FT                   DSTVIGTVVATDPEGKDVSYSIVSGDSNGWFEIDPVTGVISLTPAGVAAVANDFEALAN
FT                   VHNLVVGASDGVNTTNINVTLTELDVNEGPEFTPPAGETSYSFTYLENSSDSTVIGTVA
FT                   ATDPEGKDVSYSIVSGDSNGWFEIDPVTGVISLTPAGVAAVANDFEALANVHNLVVGAS
FT                   DGVNTTNINVTLTELDVNEGPEFNPPAGETSYSFNYLENSSDSTVIGTVAATDPEGKDV
FT                   SYSIVSGDTNGWFEIDPVTGIISLTPAGVAAVANDFEALANVHNLVVGASDGVNTTNIN
FT                   VTLTELDVNEGPEFTPPAGETSYSFNYLENSSDSTVIGTVVATDPEGKDVSYSIVSGDS
FT                   NGWFEIDPVTGVISLTPAGVAAVANDFEALANVHNLVVGASDGVNTTNINVTLTELDVN
FT                   EAPVIVDYRSTINDSIANGTDVYNVNEANTGNDTDIDGDTLSYSFVLANGSNSLISEDG
FT                   AFIINAQTGVISVNDTTKIDYDNGSQINLNVETSDGSLTDTAIVTFDLNNVDANDDLPG
FT                   TSFSVTAGATNAWTIPQSNGESLMKISARTADGSMGVVNIESGSNKLGVAGSPRTSGQI
FT                   AGQIEYDSATGTSESIVIDFNGLVNQATFSVSNMFSNENNGEQGVWKAYYNGQLVASDT
FT                   FKTTSGDAGTFSIDTGNIVFDQLVFEATKTISEANGGAALVDSSDYFLTNVTASGPAIM
FT                   GTYLVSEDGVLTISSTSQGLLNNDSDAQTNTFALTGVNGAIVTDGQVVILPSGALLTIH
FT                   SDGTYSYDTNDSFEALTAGQLATDTFTYTVTDQYGATDTATVTINIVGEADASSTYVSY
FT                   NGNPGNDVIKGTPNNDIIVSDQQGLQIVAGENYNIAFILDTSGSMSNLIASAKLQLESV
FT                   FNSLADSATGSHSGVVNVLLTNFATGSNISISVNMDDPNAVQSLVSKLNSLSANGWTNY
FT                   EAGFDAAINWFSSSTVQQNVGHNLSFFITDGTVNRSTIETDITKILIGYDVNASQYVSL
FT                   SSLMGSNYSKGTILKFDGKLVVDANGNVYSIYTGKTLGKMTFTSNGKFASYSDTDSTST
FT                   TNTQNEALHAFNLLAAVSEVEAISLKAADGSTPVGEANLKLYDTDGNVRASIDVSDLSS
FT                   IITGSETLQSQGDDNTVGNQGDDIIFGDLVRFSGSSEQGYVALQTYVADKTGQNVGDVD
FT                   VRAVHDYIRDHVNEFNINNQNDGNDILDGGIGDDILFGQGGNDVIYGGEGNDVLIGGLG
FT                   NDTLIGGLGNDTFVWSKGDTGTDTIKDFEVNNDSLHISDLLQNEQNGDLDNYLDFSFNN
FT                   GSTTISIDADHNGSIDQVIVLDGVDLSQEYGSTTDGVIINGLLNDGALIVDTATVNPAP
FT                   SPGTSHADLFDQHNGNIIP"
FT   gene            complement(501023..502192)
FT                   /locus_tag="Sfri_0437"
FT   CDS_pept        complement(501023..502192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0437"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: son:SO4316 HemY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70299"
FT                   /db_xref="GOA:Q088L6"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L6"
FT                   /protein_id="ABI70299.1"
FT                   /translation="MIKTLVYVVLILIGLCISPLIIGQSGYIYIAIGEYQIETSLVTGI
FT                   VGLIVFYFALQLLEWLIILLLNIVLSSRYLPEQWRRKAAKKHTLIGALALAEEDWPAAE
FT                   KAMAKGAEKGEIPVLNLFAAARAAHYQGDITARDHYLTQAEKNPIAKTAVYTSRTRYLM
FT                   KQGELVKARAILDKLNPTSKSSSPVLKLAQELYLQQQDWQALKLLLPILKKRQLLAETE
FT                   FNQLNTKTNSILMINAAKISEAELTKCWHWLNKSERKEDELILAYARGLIQYGHKDQAL
FT                   KLINKQLNASPSAALFTAIPDLITAQDQDIRKLLSKLETTHENDADYQMCLAKLAIQSR
FT                   ETKQAKTHWQNVCRIAPTHQSWLALAQTQEQLGENSTAAHSYRNAANIL"
FT   gene            complement(502189..503439)
FT                   /locus_tag="Sfri_0438"
FT   CDS_pept        complement(502189..503439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0438"
FT                   /product="protein of unknown function DUF513, hemX"
FT                   /note="PFAM: protein of unknown function DUF513, hemX;
FT                   KEGG: son:SO4315 hemX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70300"
FT                   /db_xref="GOA:Q088L5"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L5"
FT                   /protein_id="ABI70300.1"
FT                   /translation="MENNKKDPNPPAHKDEKVISPAPSPVEKPTQTKKGNATSQKSADS
FT                   KTHNNQANSSANSPVNNSRRKAKPSSWWIRLGVLFSLLVAIVAIAACYWLYLQLDQQSN
FT                   GQTQLGQNISEQVTQNKSLKYELQQTAMATNKRIGTLEQQQLNDTKAYAKLAQLQQSNK
FT                   QLQERVAVIAQRSPNHWMASEAEYLVRMAGRKLWLENDPQTAIGLLQSADERISAMKDP
FT                   ALTVLRKALADDITKVKALKTTDITNTIFDLDTLIDGFTQLPLNRVDENFADNKSTQQV
FT                   TDSIDDWQQNLARTWHDLTDGFITIRKRTTDLEPLLSPEQQWYLVENIRNKLLQAQLAL
FT                   YRFDQVNYQQSISLADKWLQQYFDLRDPKTKSMIESLDKLTKVNIEKISLNKFQASPLL
FT                   QQLVIYGEIMPTQEPAQ"
FT   gene            complement(503525..504244)
FT                   /locus_tag="Sfri_0439"
FT   CDS_pept        complement(503525..504244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0439"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   son:SO4314 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70301"
FT                   /db_xref="GOA:Q088L4"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L4"
FT                   /protein_id="ABI70301.1"
FT                   /translation="MKVLLTRPQGRNQAMEEQLSLRDVAYLVTPLLSVVETTEQLNPTH
FT                   LNNTDNLLFISSNAVDFAAQKLQQQFPTHCRYFAVGQATADSLAQYNINAFTSPEHSQD
FT                   SEGLLSLAQLQDVDKQSFIIVRGLGGRETLAEQLQLRGANVNYWQVYQRAIPNLDGKAI
FT                   TQQWKSFGIDTIVVTSGEILSNLVELVPKELFAWLRACHIIVPSNRVELQAKAMGLSHI
FT                   SNANGANTQAILASLAL"
FT   gene            complement(504270..505199)
FT                   /locus_tag="Sfri_0440"
FT   CDS_pept        complement(504270..505199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0440"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: son:SO4313 porphobilinogen deaminase; TIGRFAM:
FT                   porphobilinogen deaminase; PFAM: Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70302"
FT                   /db_xref="GOA:Q088L3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088L3"
FT                   /protein_id="ABI70302.1"
FT                   /translation="MSENIIRIATRKSPLAMWQAEFVKAELERIHPGLTVELLPMSTKG
FT                   DVILDTPLAKIGGKGLFVKELEVAMLENRADIAVHSMKDLPVEFPEGLGLQVICEREDP
FT                   RDAFVSNNYKSISELPQGAVVGTSSLRRQCQIRAARPDLVIKDLRGNVGTRLAKLDSGD
FT                   YDAIILAAAGLIRLKLNERIANFISAEESLPANGQGAVGIECRTDDARVKALLAPLEHL
FT                   ETRYRVLAERAMNTRLEGGCQVPIGAFAEINGDNLTLRGLVGNPDGSQIIIGTVSGSKT
FT                   DAVALGESLAEDLLSRGAKTILDAVYAS"
FT   gene            505474..507933
FT                   /locus_tag="Sfri_0441"
FT   CDS_pept        505474..507933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0441"
FT                   /product="adenylate cyclase"
FT                   /note="KEGG: son:SO4312 adenylate cyclase CyaA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70303"
FT                   /db_xref="GOA:Q088L2"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L2"
FT                   /protein_id="ABI70303.1"
FT                   /translation="MTDKTAYYQKDLAEKLNGIRLARVLNVLPESQLHLFHLIPFLIHH
FT                   NQINVPGIIDPDTPCGIHGFTLSDAIVSACDALSLSIPEMIQPSDCVFEGIYAMGSTAS
FT                   FGQNPQSDVDIWLVYNSKLTDDQLKLIEYKNKLISDWFAGFEFEVNFYLVHPMQFRECS
FT                   AFDNCQPVGLEHSGSSQHWLLLEEFYRSHIRLAGKVVAWWPDANSQNTEFDASLLYLGD
FT                   INSLPAAEYFGASLWQLYKGLNKPHKALLKVLLLETYASEYPSTTLITQQIWQYCEQQD
FT                   FSVDNDAYLLLYQRIETYLIAQGDDNRLEIVRRCFYLKSGVTLSCLSPNSAADWRVEKI
FT                   QNLVKQWAWSHELVATLDNSPYWHAGQLKWFNQQLSELLLVSYKNLLQFASKQTLSERM
FT                   RVEELGLLARKLHTYFSEDTHLLQPLNRLWSLSTAEKSLTIFHCRQASRFYLYRQAYLD
FT                   KDPSQAVDNDPAHEFDDHSIHEADNICNLVAWSVLNGLATADTQWFQVGRGKRRTDKLS
FT                   YLTRKLIPIMHNVPTVYKRDLCEPWCYQKIVLITNMDRDPTTQLSEQELILEHVNANIL
FT                   SFGQTKISMVSSVAIVCLNSWGEWQSHRFNGKTALLEAISFIILGLKRSNEQVDLSIIS
FT                   CSAKLKQPIFNQLKTLLLRCYGLMKKVNQTNTLMHPITIGEQHYSMHFNSLGMMYRKVD
FT                   LITGTGNFNSSVLPYADLAEDPYLNSPSVIQKFIVMGAKQYFLRERHQTLDVFIADDNN
FT                   QLEHLQYQHTSINDFVAKESHLYVFDEQKQRSPVFNMPQFFQLVDIEGKLTVIPFGLSV
FT                   DEMGSAF"
FT   gene            complement(508004..508339)
FT                   /locus_tag="Sfri_0442"
FT   CDS_pept        complement(508004..508339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0442"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein; KEGG: son:SO4311 CyaY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70304"
FT                   /db_xref="GOA:Q088L1"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L1"
FT                   /protein_id="ABI70304.1"
FT                   /translation="MAITDTEFHRLADEMFGEIENAVEKAIDEQDADVDINASGNVLQL
FT                   AFEDSSQIVINKQEPLHEIWLATKSGGYHFNYNDGKWLDTRNGLEFMSFVIDAINKQSG
FT                   ILLEISA"
FT   gene            508407..508601
FT                   /locus_tag="Sfri_0443"
FT   CDS_pept        508407..508601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70305"
FT                   /db_xref="UniProtKB/TrEMBL:Q088L0"
FT                   /protein_id="ABI70305.1"
FT                   /translation="MLRKMRLLLFIMLASLLVTACGQKGVLYKTPEPVANKVAPKPAST
FT                   DVPKQTEELDSQPSTSQQE"
FT   sig_peptide     508407..508469
FT                   /locus_tag="Sfri_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.808 at
FT                   residue 21"
FT   gene            508622..509866
FT                   /locus_tag="Sfri_0444"
FT   CDS_pept        508622..509866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0444"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: son:SO4309
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70306"
FT                   /db_xref="GOA:Q088K9"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q088K9"
FT                   /protein_id="ABI70306.1"
FT                   /translation="MDYFSYQNNSLFAEDCDVAKLAKTHGTPLYIYSRATLERHWHAFN
FT                   NAVADHPHLICYAVKANSNLAVLNVLARLGSGFDIVSGGELSRVLQAGGDPKKVVFSGV
FT                   GKTVAEMEQALNIGIYCFNVESSAELEQLNEVASRLGKVAPVSLRINPDVDAGTHPYIS
FT                   TGLKENKFGIAMEEAEVVFARAAELAHLHVKGVDCHIGSQLTEIKPFLDAMDRMLALID
FT                   RLGEQGIQIEHFDVGGGLGVTYNSETPPHPDAYAAALLERLNGRKLKLIFEPGRAIAAN
FT                   AGIFVTQVLYLKENSDKRFAIVDGAMNDLIRPSLYSAWQNIIPVQQNDAPTFAYDIVGP
FT                   VCETGDFLGKDRQLAVKSGDLLAIRSSGAYGFAMASNYNSRPRVAEIMVDGGNDFVVRQ
FT                   RETLEQLWQGEHLLP"
FT   gene            509907..510734
FT                   /locus_tag="Sfri_0445"
FT   CDS_pept        509907..510734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0445"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: son:SO4308
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70307"
FT                   /db_xref="GOA:Q088K8"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088K8"
FT                   /protein_id="ABI70307.1"
FT                   /translation="MIHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQ
FT                   LLLVEPPYDPDLDFHYRIFNADGSEVEQCGNGARCFARFVRNKGLTQKNKIRVSTNSGK
FT                   ITLRIERDGNVTVNMGVPVIEPSQIPFKAKKSEKTYLLQTPMQTYLCGAISMGNPHCVI
FT                   QVEDVQTVNVDEIGSSLTRHERFPKGVNVGFMQVINPGHIKLRVYERGAAETLACGTGA
FT                   CAAAAVGQLQDKLDKQVRVDLPGGSLIINWEGEGKPLWMTGPAEHVYDGQIQL"
FT   gene            510731..511471
FT                   /locus_tag="Sfri_0446"
FT   CDS_pept        510731..511471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0446"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   son:SO4307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70308"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q088K7"
FT                   /protein_id="ABI70308.1"
FT                   /translation="MSDITSKVSLTNVAADNTVSSEQAKDINSIGQDLGIDMMASLQQA
FT                   PFDEMLIREYLLDNPDFFNRYPELLVAMRVPHAERGAVSLVERRQELLRQRVSQLEEEI
FT                   TSLMNIATHNEKIFKFNTELSFKMLASQDLGELRLVLSEGLKNEFGFSHVRLITVHDID
FT                   SELAKIWRHRVQSGYYFGRLTQSESKRLFGSEVGSVALTKLSDENGQVIFAIASNDPTH
FT                   FHPDMDSLLFSQLRRLLDHMLPKM"
FT   gene            511565..512464
FT                   /locus_tag="Sfri_0447"
FT   CDS_pept        511565..512464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0447"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein; KEGG: son:SO4306 integrase/recombinase
FT                   XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70309"
FT                   /db_xref="GOA:Q088K6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q088K6"
FT                   /protein_id="ABI70309.1"
FT                   /translation="MKPTDWQTIFSQHLSSERQLSAYTVRNYLFELRRVEDMLAESTQL
FT                   IEVSRDQLQSVMATLHRKGLSPRSLSLCLSALKQFFDFLLREGAVTVSPAQTLSAPKQN
FT                   KPLPKNMDVDAVSHLLSIEGDDPLSLRDKAIMELFYSSGLRLAELASLDCVDIKFDQSE
FT                   VKVMGKGSKQRVVPIGQVALTAIKTWLNCRNQLSCVEAGDALFVSSQGKRLSHRSIQAR
FT                   MAKWGQEQAMAVKVHPHKLRHSFATHMLESSQDLRAVQELLGHANLSTTQIYTSLDFQH
FT                   LAKVYDNAHPRAKKDRGK"
FT   gene            512464..513204
FT                   /locus_tag="Sfri_0448"
FT   CDS_pept        512464..513204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0448"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: son:SO4305 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70310"
FT                   /db_xref="GOA:Q088K5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q088K5"
FT                   /protein_id="ABI70310.1"
FT                   /translation="MTLQLPKASMIQYQRLQPFSAISFDLDDTLYNNLPYVIHASEQLF
FT                   SLINQIYPATTTWDAAQWQQLKHALFKLHPELAHDTSAARYAMLHQGLLHFGYSETEAS
FT                   QGAQDGMTCFHHHRSNFTVDESVLELLERLSQRYQLIGITNGNVDTQRIGLDKVMQFVL
FT                   HPGHGVKMKPAADMFSLACRQLDIKPSALLHVGDHPLSDIAGAKMAGCQSAWLNPCMQQ
FT                   RHKKAQPVLPHIEINQLDLLLQLL"
FT   gene            complement(513184..513699)
FT                   /locus_tag="Sfri_0449"
FT   CDS_pept        complement(513184..513699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0449"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: son:SO4303
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70311"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:Q088K4"
FT                   /protein_id="ABI70311.1"
FT                   /translation="MSPHHYPTFALDDIANLHESAQVEFKLAGGRDGNGMLPEGMWESY
FT                   SAFANTLGGEIILGVKEQQGDFTIEGIINPMPMLSEIWAILHDPKKISHNILAPTDVQI
FT                   IEIMAKKLIRIHVPCVDVKLRPIYVGTDPYSGTYFRVGDADMHASREQVEQMSLKAGID
FT                   LKLKQLKQ"
FT   gene            complement(513820..514353)
FT                   /locus_tag="Sfri_0450"
FT   CDS_pept        complement(513820..514353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0450"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: son:SO4302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70312"
FT                   /db_xref="GOA:Q088K3"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:Q088K3"
FT                   /protein_id="ABI70312.1"
FT                   /translation="MCTFGIAMLTEQAAPALQHLSLIDLIDHIEATHHQYIRETAPLLV
FT                   EYTDKMVRAHGDDHSEIKPLAHAVNELIAELMPHLMKEERILFPAIKSISLGKTVDGCF
FT                   GHISNPINMMLHEHDNADHMLQTIRNLTNNYTPPAGVCHTWQTCYRTLAEFDADLQTHI
FT                   EIENTLLFPKALAL"
FT   gene            complement(514448..515704)
FT                   /locus_tag="Sfri_0451"
FT   CDS_pept        complement(514448..515704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0451"
FT                   /product="Kelch repeat protein"
FT                   /note="PFAM: Kelch repeat-containing protein; Kelch repeat
FT                   protein; KEGG: cps:CPS_3966 kelch motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70313"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q088K2"
FT                   /protein_id="ABI70313.1"
FT                   /translation="MHNASLPPMMTSMLSSLKGTSSVIQSLVLIGALCITTVDAAPLQN
FT                   TSIATIPQPVSNNAIALVHSNNKSYLLSFMGLAPEKNHLAVHNHAWALSLTEKNSQWKS
FT                   IADVPHIAPLAGRLASIAIGINDKAYVFGGYTVSENHDEISTIDNYQYSIKTNQYTRIV
FT                   DMPVAVDDTTATTYQQRYIYLFGGWHNDGNVNLVQVYDTQTNTWAQASPIPAPAVFGQA
FT                   VGMVGNQLVLCDGVKVQANINARRSYQASPVCLYGEVNPDNHLRIDWQLLPHYSVAANI
FT                   NVSKSTITESNVNQAIANTAKSNTAATATAHYRMAATGIKTTTGGQIVFLGGSDNPYNY
FT                   SGIGYNGEPSEASSYGYRFDLATKQWLTPQTLSQPSMDHRGLVCWQGSLLRVGGMLQQQ
FT                   KVSSKVLLSTLAQGESCTQ"
FT   sig_peptide     complement(515582..515704)
FT                   /locus_tag="Sfri_0451"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.850) with cleavage site probability 0.832 at
FT                   residue 41"
FT   gene            516325..519312
FT                   /locus_tag="Sfri_0452"
FT   CDS_pept        516325..519312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0452"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; DNA topoisomerase, type IA,
FT                   zn finger domain protein; KEGG: cps:CPS_2454 helicase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70314"
FT                   /db_xref="GOA:Q088K1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q088K1"
FT                   /protein_id="ABI70314.1"
FT                   /translation="MSSENSVSFIPHSWFGHLYQRDVNAIKLTQEGITFIPGHGQFLAR
FT                   FRHNNKQLIIGQLSWQQLDHPPLFSASLLGNLLSFNAAGTHYQIPFLSYFAKSHFKQQV
FT                   ELLWALSHQKSLCDLILRVEKATSSRYLRQSLVDKMRARIEREYFRWFPWSEGAELPAN
FT                   IRTALTQLHDFYHWNKADIERLRESYIQSQLLAFAGFFDHVESNPLTNKQRRACIIDDD
FT                   SNLLLAGAGTGKTSVMVGRAGYLVNSGQAQANDILLLAYGKKAAMEMDLRIKHKLGSDD
FT                   IKASTFHSLGLKIIADVEGVKPSLSAWVNDEPAKDKWVHDRLEVLIKNESYRKQLFDYF
FT                   SRYYYVEKSPFEFSTQGEYFEYLNDNDIRSLKGERVKSFGELHIANWLFTNGIEYQYEA
FT                   KYEFDVSTVDFRQYQADFYLPEYEVYIEYYGIDEANNTVPFIDQAAYLTSMEWKRQLHH
FT                   QRQTNCIELFYYQHKKSQLINKLEQALTVFKVNYSPLPDEAILATLYELGRVTELAKLF
FT                   SQLIGLYKAACIDEAGLEKVFANATQTRKAFELLQPILQQYQQYLSAHGDIDFEDMIAK
FT                   ALAYLQSGQYVSPWQYIMVDEFQDISEPRARLVRALRDSRTKKGNSDTSLFCVGDDWQA
FT                   IYRFSGADVRLTTQFKRYFGHASETYLDLTFRFNNRIGEVASAFVSKNPHQLNKDIHSL
FT                   VQVAKPAVSILRRGTNEGATKDEPSNNALEQVLNALSVRVTQAVDKLKAKPTVYLLARF
FT                   WFQLPDKDMLRQLTAKYPMFVIECLSFHASKGKEADYVVIMGMTQGIHGFPSKKITPPL
FT                   LDAFLPKAENFEFAEERRLFYVALTRAKHRVYVIADMTNVSPFIVELIQQDYAVEQQEF
FT                   STSLVQSLFEQINCVRCTTGILKPRVGKFTSFFSCSHFPLCDHKEAGCDECGSPMTRKR
FT                   FVGFKVCLNDSCAHMAPICNVCGSEMSLRESARGAFWGCKNYRGNNVPSCSNTINTAKI
FT                   SPQQVQ"
FT   gene            complement(519454..519759)
FT                   /locus_tag="Sfri_0453"
FT   CDS_pept        complement(519454..519759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0453"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /note="PFAM: helix-turn-helix, Fis-type; KEGG: son:SO0393
FT                   DNA-binding protein Fis"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70315"
FT                   /db_xref="GOA:Q088K0"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088K0"
FT                   /protein_id="ABI70315.1"
FT                   /translation="MFDQTTNTEVHQLTVGKIETANGTIKPQLLRDAVKRAVTNFFSQL
FT                   DGQEASEVYEMVLCEVEAPLLDIIMQHTRGNQTRAANMLGINRGTLRKKLKKYGMN"
FT   gene            complement(519783..520745)
FT                   /locus_tag="Sfri_0454"
FT   CDS_pept        complement(519783..520745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0454"
FT                   /product="putative TIM-barrel protein, nifR3 family
FT                   protein"
FT                   /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   PFAM: dihydrouridine synthase, DuS; dihydroorotate
FT                   dehydrogenase; KEGG: son:SO0394 tRNA-dihydrouridine
FT                   synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70316"
FT                   /db_xref="GOA:Q088J9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q088J9"
FT                   /protein_id="ABI70316.1"
FT                   /translation="MQIGPYQLSNQLIVAPMAGVTDQAFRNLCLRYGAALAVSEMLSSN
FT                   PDVWDSDKSRQRMMHSGEEGIRSVQIAGADPDLMANAAKFNVEQGAHIIDINMGCPAKK
FT                   VNKKFAGSALMQSPSLVKEILQAVVAAVDVPVTLKIRTGWEPEHRNGVEIAQIAEDCGI
FT                   VSLAVHGRTRQCMYKGFAEYDTIKAIKQNVSIPVVANGDIDTPEKAKFVLDYTGADALM
FT                   IGRGAQGRPWIFKEILHYLETGKKLAPIKAEEQRSVMLEHLKKLYDLYGEYKGVRFARK
FT                   HVGWYLNHEEQRQFRADFNRLETAAQQHSLVECYFDELV"
FT   gene            complement(521043..521924)
FT                   /locus_tag="Sfri_0455"
FT   CDS_pept        complement(521043..521924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0455"
FT                   /product="LSU ribosomal protein L11P methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: son:SO0395 ribosomal
FT                   protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70317"
FT                   /db_xref="GOA:Q088J8"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088J8"
FT                   /protein_id="ABI70317.1"
FT                   /translation="MAWIQLRIHTHRDNADLLGDLLMDQGSLSITYEDGQDEPIFEPKL
FT                   GETPLWQDTVMIALFDAGTDLAPTIEFLESMPFLGKGFNHKIEQVEDKDWIREWMDSFH
FT                   PIQFGSRLWICPSWREIPDPTAVNVILDPGLAFGTGTHPTTALCLEWLDSLDLSNQEVI
FT                   DFGCGSGILAIAAIKLGAKKVTGVDIDYQAIDASKANAERNDVVDKLALYLPEDQPANL
FT                   QADVLVANILAGPLKELAPLIAEKVKIGGKLALSGLLQEQAQEVSDFYSQWFIMDPVSN
FT                   KEDWSRLTGIRK"
FT   gene            522446..523189
FT                   /locus_tag="Sfri_0456"
FT   CDS_pept        522446..523189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0456"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: son:SO0396 fumarate reductase cytochrome B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70318"
FT                   /db_xref="GOA:Q088J7"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q088J7"
FT                   /protein_id="ABI70318.1"
FT                   /translation="MAANSLQTKVDRAVNTDKGFAHPLWAARADKLQSLSGVLLGLFLV
FT                   MHLHFESSILFGKEAFYQVAQFLEGGIFSETGHGYPLVTKIFSCFMLLILLIHAVFALR
FT                   RFPTQLGQWRALRNQMRFLPHEDTKIWFWQMITGFLLFFLVPTHLFTMITNPEIGPHLS
FT                   AERVYHLNAWALYILLLPVVAVHAVFGLYRVVVKWGLVEQRFAMLKFAKVLLVYLMVLG
FT                   VASLLTYIFIGRSLALPVVPYVSML"
FT   gene            523199..525199
FT                   /locus_tag="Sfri_0457"
FT   CDS_pept        523199..525199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0457"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: son:SO0398 fumarate reductase flavoprotein
FT                   subunit; TIGRFAM: succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70319"
FT                   /db_xref="GOA:Q088J6"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q088J6"
FT                   /protein_id="ABI70319.1"
FT                   /translation="MKIIYTDTLVVGAGLAGLRVAIASKERGLDTLVLSLVPAKRSHSV
FT                   AAQGGMQASLANTIKGEGDDEDIHFQDTVKGSDWGCDQDVARMFAHCAPKAVRELAQWG
FT                   VPWTRVTKGDRQVIVNAEKVTITEAEAAHGLINARDFGGTKKWRTCYTADGAGHSLLYA
FT                   VDNKAISLGIPVHERMEALSLIHDGERCHGVIARCLITGELRAYIAKSTTIATGGYGRI
FT                   YSVSTNAVICEGIGQALALDTGIATLGNMEAVQFHPTAIVPVGILTTEGCRGDGGVLRD
FT                   KDGYRFMPDYEPEKKELASRDVVSRRMTEHMRKGKGVNSPYGPHLWLDITLLGQKHIDT
FT                   NLREVKEICENFLGIDPVKDWIPVRPTQHYSMGGIRTKANGESPQLSGLFSVGEAACWD
FT                   MHGFNRLGGNSLAETVVGGMIIGKYVADFGEQTSLVVDTDLIAQFGKQLQTEVDQLIEG
FT                   EGTEDPFKLKASMQKIMMDYVGIFRNGPELEVAVNQLTELLERSKNLGLKCKKRHANPE
FT                   LVEALRVKRMLKVALTVACGAHARTESRGAHSREDFPQRNDQDWLNRTLTSWPDANSLR
FT                   PEMSYEALDVMRMELPPGYRGYGVDNAIAHPDTQKRQQQVEAILAELGDDADRYAKQAA
FT                   LMPFELPEEYQPRNQRFTDTVAKTDAESGEK"
FT   gene            525201..525926
FT                   /locus_tag="Sfri_0458"
FT   CDS_pept        525201..525926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0458"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: son:SO0399 fumarate reductase iron-sulfur
FT                   protein; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70320"
FT                   /db_xref="GOA:Q088J5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q088J5"
FT                   /protein_id="ABI70320.1"
FT                   /translation="MSQARTLTFSIFRYDPQEPGDKPKMVTYSLTEAPGMTVFIALNQL
FT                   RETQDPSLQFDFVCRAGICGSCAMVINGFPTLACRTLTANYPDGHIKLMPLPGFDLIGD
FT                   LSVNTGKFMRELSERLSLWLHPNSADNDIHRIEAPMSPEEATKLYELERCVECGVCVSA
FT                   CATKQMRDTFVGAVGMMKIARFELDSRDTRTADDFYHVIGNQDGVFGCMTLLGCQDTCP
FT                   KDLPHMQQIAYLRRKMASV"
FT   gene            complement(526763..528025)
FT                   /locus_tag="Sfri_0459"
FT   CDS_pept        complement(526763..528025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0459"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: son:SO0405 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; Ribonuclease B, OB region
FT                   N-terminal domain protein; SMART: AAA ATPase; Cold shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70321"
FT                   /db_xref="GOA:Q088J4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q088J4"
FT                   /protein_id="ABI70321.1"
FT                   /translation="MNLTELKDTPISDLVSLAESMNLENMARTRKQDIIFSILKAHAKS
FT                   GEDIFGGGVLEILQDGFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDSIFGKIRPP
FT                   KEGERYFALLKVSEVNFDKPESSRNKILFENLTPLHAEERLRMERGNGSTEDITSRILD
FT                   LCSPIGKGQRGLIVAPPKAGKTLLLQNIAQSITYNNPDVVLMVLLIDERPEEVTEMQRM
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALHRPKRFFGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   QELHLSRKAAEKRVFPAIDFNRSGTRREEKLTTPEELQKMWILRKILHPMDEVSAMEFL
FT                   IDKLAMTKTNEEFFTAMKRAK"
FT   gene            complement(528248..528574)
FT                   /locus_tag="Sfri_0460"
FT   CDS_pept        complement(528248..528574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0460"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: son:SO0406 thioredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70322"
FT                   /db_xref="GOA:Q088J3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q088J3"
FT                   /protein_id="ABI70322.1"
FT                   /translation="MSDKIVYLSDDSFENDVLKSETPVLVDFWAEWCGPCKMIAPILND
FT                   VAEEYAGKLTVAKLNVDQNNVSPAKYGVRGIPTLLMFKGGELVATKVGALSKTQLKEFI
FT                   DAKI"
FT   gene            528728..530032
FT                   /locus_tag="Sfri_0461"
FT   CDS_pept        528728..530032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0461"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; KEGG: son:SO0407 ATP-dependent RNA
FT                   helicase, DEAD box family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70323"
FT                   /db_xref="GOA:Q088J2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088J2"
FT                   /protein_id="ABI70323.1"
FT                   /translation="MSQTHLSTKKFADFPLKPEILAALNENGFEFCTPIQALSLPILLN
FT                   AKDIAGQAQTGTGKTMAFLVATFNHLLNVAAPESRKATEPRAIIMAPTRELAIQIAKDA
FT                   KLLAAHTGLKVGIVYGGESYETQRAVLDKGVDILIGTTGRIIDYVRQGVISLSHIQAVV
FT                   LDEADRMFDLGFIKDIRFLFRRMPDAKSRLNMLFSATLSMKVQELAYDHMNDPEKVEIE
FT                   PLEKTSKNIKEEIFYPSMEDKMRLLLSLIEEDWPDKAIVFSNTKHSCEKLWSYLEGDGH
FT                   RVGLLTGDVPQKKRIRILEQFTSGEIDVLVATDVAARGLHISDVSHVYNYDLPDDCEDY
FT                   VHRIGRTGRAGQKGISISFACEEYALNLPEIETYINHSIPVSNYDKDALLDDIPPPARI
FT                   HRKPPTSRTRDGGSKGAHRSGGNTSRPPRHRTRRP"
FT   gene            530036..530977
FT                   /locus_tag="Sfri_0462"
FT   CDS_pept        530036..530977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0462"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: son:SO0408
FT                   guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70324"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q088J1"
FT                   /protein_id="ABI70324.1"
FT                   /translation="MPLLTVSQPYAAITLGSNSFNMLVANSVGNKPIVIAKYKRKVRLA
FT                   EGIGEDGMLSEHVMQRGLECLAMFADMLAQHHIDSANVAVFATATLRVIRNADEFHQRA
FT                   MPILQHQIEVISGLREAELIYQGMVATTKGEGRRLVIDIGGASTEFIIGDGSQVLFKTS
FT                   LPMGCVLFNQRFFANAPLQAIDFEQAVDYVNTILAEHRPHLLDLGWRSVVGASGAVQSV
FT                   VSVLQHRQRPEVITLKILFGFRNEILSQADARLSGINGLNAEQAPTFAAGVAILIALFE
FT                   SLSISRLHLAGGALREGVLQLLADRIAAKVSI"
FT   gene            complement(531094..531696)
FT                   /locus_tag="Sfri_0463"
FT   CDS_pept        complement(531094..531696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70325"
FT                   /db_xref="GOA:Q088J0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q088J0"
FT                   /protein_id="ABI70325.1"
FT                   /translation="MLEYSQVQYFLLNRDIIMHNNVRTLLATTALFFSTQMLPMAASAN
FT                   SGCAFEKDQQGFIATCSEEKQEVILTGVIQPQTLTTELPGYTEGFTNYQVDAQAIDVLK
FT                   AIKEPTQIVVIIGTWCPDCHRETPHFMRIIEAAANPNIEVEYIGVDRSKQDPEGLAAKY
FT                   AFSRIPTFIVKQQGKELGRIVERPQATLEADLVEILK"
FT   gene            complement(531846..532574)
FT                   /locus_tag="Sfri_0464"
FT   CDS_pept        complement(531846..532574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0464"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   par:Psyc_0937 putative transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70326"
FT                   /db_xref="GOA:Q088I9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q088I9"
FT                   /protein_id="ABI70326.1"
FT                   /translation="MVMYWRQFMPRVGTRKLYQLIKPQLLKQGIKLGRDGLFRYLKQHN
FT                   MLVRPRKNYTKTTHSHHWLRKHPNLLKDRVVKGGEEVFVSDITYVKSDEGTHYLSLVTD
FT                   AYSRKIMGYELSDEMKASDVVKALEMTIKNRQTTTDVIHHSDRGIQYCSAEYQHKLAAN
FT                   AIRPSMTDGYDCYQNALAERVNGILKQEFLLYRCRTMKELAILIKESIRTYNELRPHLS
FT                   LGMKTPNEVHEKASREFQLA"
FT   gene            complement(532679..533074)
FT                   /locus_tag="Sfri_0465"
FT   CDS_pept        complement(532679..533074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0465"
FT                   /product="transposase"
FT                   /note="KEGG: dde:Dde_2987 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70327"
FT                   /db_xref="GOA:Q07X74"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q07X74"
FT                   /protein_id="ABI70327.1"
FT                   /translation="MKPSVSINIKRTQRDYTLGFKLAVVSQVEKGELTYKQAQDHYGIQ
FT                   GRSTVLTWLRKHGRLDWSQPIEHSPMSKSTETPAQKIKRLEKQVSNLEMKNMIYGDMVE
FT                   LLKNEYGIDLEKKYLAERSGLPKKKAL"
FT   gene            complement(533177..534190)
FT                   /locus_tag="Sfri_0466"
FT   CDS_pept        complement(533177..534190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0466"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   son:SO4208 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70328"
FT                   /db_xref="GOA:Q088I7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q088I7"
FT                   /protein_id="ABI70328.1"
FT                   /translation="MNIITSAFPQRRMRRMRKHEFSRRLMSENTLTVNDLIYPMFVLEG
FT                   FQRSEKIASMPGIERFSVDLLLKEAAELVELGIPLIALFPVTPADKKSLLAEESYNPDG
FT                   LVQRAVRELKQAFPQLGIMTDVALDPYTTHGQDGIIDDTGYIMNDITTEILVKQALSHA
FT                   AAGADIVAPSDMMDGRIGAIRQALEENGFVNTQIMAYSAKYSSSYYGPFRDAVGSASNL
FT                   KGGNKHSYQMDPANSDEALHEVALDIQEGADMVMVKPGMPYLDIVHRVKTELAVPTFAY
FT                   QVSGEYAMHMAAIQNGWLAEKAIVMESLLCFKRAGADGILTYFAKRAAQWLKEQNS"
FT   gene            complement(534205..536130)
FT                   /locus_tag="Sfri_0467"
FT   CDS_pept        complement(534205..536130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0467"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor, transmembrane
FT                   region; KEGG: son:SO4207 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70329"
FT                   /db_xref="GOA:Q088I6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q088I6"
FT                   /protein_id="ABI70329.1"
FT                   /translation="MMPLITHQLQQQCKYHFRVLIGLFLLLISQNCWASTLSGVPLRLT
FT                   SDSITKIELQDWVYANQSNDIENLTTLLQRPENSWKKIDTNQPYKIGIKNYWVSFSIFN
FT                   PNDHLSRIIALDNPLLDSVKIYHLINGELVSTEVMGDSLPFKQRPLESNIFLYPVNFEP
FT                   GDTHTFYLKIDSKGSISLPLVLWSSNDLTRLTETKNLFSGMQIGLLLAICLFSLFIALA
FT                   SASYSYSYYSGYVLGLTLLTATIHGVSFRYLWPQWPIIQQYIFIIIIPLTLGFSLMFTE
FT                   KVLQLKYHNLKMLRICRIMAVLCFGLTIIMPFINYSFALYFLAFVVLTMSTILMAFSLI
FT                   QAFGGQRNAPLYAIGRMGLMVGCIITGLIYLGLITLSISPQIPVMIGLTFEVITMAAVL
FT                   ALRYNDERKAKFEIQQQTLEQAQRLREIREEALRNEAENSEKLEQMVQERTLELEITLR
FT                   ELNEVNQKLTEQNTIDSLTGVKNRSAFDRRLIAEGRISRRQQTPMSLLMIDIDKFKNIN
FT                   DQYGHLSGDYTIKMIANTLCEYVKRPTDLVSRFGGEEFAIILPCTDIEGALLVAEQIRQ
FT                   AISELTIVHNGHTIPLTVSIGVSETIIESDEHPMLLLEQADKALYKAKRSGRNKVCYYP
FT                   LETDEI"
FT   sig_peptide     complement(536026..536130)
FT                   /locus_tag="Sfri_0467"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.980 at
FT                   residue 35"
FT   gene            complement(536130..536945)
FT                   /locus_tag="Sfri_0468"
FT   CDS_pept        complement(536130..536945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0468"
FT                   /product="Sec-independent protein translocase TatD"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   son:SO4206 hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70330"
FT                   /db_xref="GOA:Q088I5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q088I5"
FT                   /protein_id="ABI70330.1"
FT                   /translation="MTQYIDIAVNLLSDRLKHDIDTIINDAAKHHVSPLIIIGSDLDES
FT                   SDSISLCQQYPQQLYCTTGVHPHHASSWDQHSKARLTQLATQETVVAIGECGLDYNRDF
FT                   SPRLAQRKAFAAQLELACELNMPVLMHCREAHSDFIAIVNEYRAQLPNALLHCFTGSKD
FT                   ELFECLAADLYIGITGWICDERRGQELAQLVPLIPSNRIMAETDSPYLLPRSMRPKPKS
FT                   SRNLPQYLPYIVEYMANLRQQSPQTLAQECYKNSCDFFQLPVHLNVNNN"
FT   gene            complement(536964..537500)
FT                   /locus_tag="Sfri_0469"
FT   CDS_pept        complement(536964..537500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70331"
FT                   /db_xref="InterPro:IPR016987"
FT                   /db_xref="UniProtKB/TrEMBL:Q088I4"
FT                   /protein_id="ABI70331.1"
FT                   /translation="MRLSLIAVGIILMSANAHANTNLGQQLSICAAKTDKTVRLTCYDE
FT                   LAANAKPSAHIMTTTNTTKIAPSEAPRPPATPIVVAPIAAASPQVLSVDDFGLQKKVIE
FT                   DEVDKIYSEVISVKKDALGAFVITLSNGQVWKQSNSKNYKIKKGQRIFIETGALNSFLL
FT                   GSDERNATVRVRRLK"
FT   sig_peptide     complement(537441..537500)
FT                   /locus_tag="Sfri_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            complement(537546..538292)
FT                   /locus_tag="Sfri_0470"
FT   CDS_pept        complement(537546..538292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0470"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: son:SO4204 Sec-independent periplasmic
FT                   protein translocation protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70332"
FT                   /db_xref="GOA:Q088I3"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q088I3"
FT                   /protein_id="ABI70332.1"
FT                   /translation="MSQQQPLISHLLELRNKLLRAIGSVLLVFITIVYWANDIYHYIAL
FT                   PLMRSLPETGSMIATDVAAPFFAPFKLTLVLAFFIAIPYVLYQVWSFVAPGLYKHEKRL
FT                   VVPLLASSTLLFYLGIAFAYYIVFPVVFGFFTSVVPDGVQVATDISSYLSFILKLFFAF
FT                   GLAFEIPVAVVLLCWAGVTTPDELRQKRPYIVVGAFVVGMVLTPPDIISQTMLAVPMLL
FT                   LFEGGLIAARFYSKKEDEPENEQAEN"
FT   gene            complement(538305..538709)
FT                   /locus_tag="Sfri_0471"
FT   CDS_pept        complement(538305..538709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0471"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: son:SO4203 Sec-independent protein
FT                   translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70333"
FT                   /db_xref="GOA:Q088I2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088I2"
FT                   /protein_id="ABI70333.1"
FT                   /translation="MFDGIGFMELLLIGILGLVVLGPERLPVAVRSLTGWIRALKRMAN
FT                   SVKDELEQELKIDQLHADLKKAESKGLANLSPELQESIDQLKKAAESVNRPYKVEDTSP
FT                   VAPKASPDESPSVVEAKSSEATSENSSTPK"
FT   gene            complement(538716..538961)
FT                   /locus_tag="Sfri_0472"
FT   CDS_pept        complement(538716..538961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0472"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: son:SO4202 Sec-independent protein
FT                   translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70334"
FT                   /db_xref="GOA:Q088I1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088I1"
FT                   /protein_id="ABI70334.1"
FT                   /translation="MGGISIWQLLIVALIVILLFGTKKLRSLGGDLGGAVKGFKNAMTP
FT                   EDENKSLDDKEKDQTAATSQQAAEKQPETESKDKQA"
FT   gene            complement(539071..540720)
FT                   /locus_tag="Sfri_0473"
FT   CDS_pept        complement(539071..540720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0473"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: son:SO4201 ubiquinone
FT                   biosynthesis protein AarF"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70335"
FT                   /db_xref="GOA:Q088I0"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088I0"
FT                   /protein_id="ABI70335.1"
FT                   /translation="MTTASIRRGYHVIKTILHFGLDDLIPKHKKPWYFAIVRNSLFWVR
FT                   NKHKTKSPAERLKLAMQDLGPVYIKLGQMLSTRRDLLDDEWAYQLAMLQDRVPPFDSAL
FT                   AREAIEAELGAPIATYFDDFNDTPLASASISQVHTATLKSNGKAVVLKVLRPNVEQQIL
FT                   ADLQLMTQTANLLETLLGDGNRLRPAEVIEDYRTTILGELNLKLEALNAIKLRNNFLGS
FT                   NSLYVPFVYEEHSYQRLMVMERIYGIPVSDTEALRAQGTNFKLLAERGVELFFTQVFRD
FT                   NFFHADMHPGNIFISREHPDDPFYIGLDCGIMGTLTEVDKRYLAENFLAFFNRDYHRIA
FT                   QLYIESGWVSEHTDIIAFEQAVKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQP
FT                   QLVLLEKTLLYIEGLGRQLYPQLDLWQTAKPFLENWMSEQVGPKAMFNKVKSNAPFWAD
FT                   KLPEFPELIYDNLKLGRKLLGTQQQMLDKYLRYQQKSHKSNYLLITSAVLLICGTILFT
FT                   QIVTLWPAYTCIGAGILIWAIGWRSRPKNRKF"
FT   gene            complement(540717..541337)
FT                   /locus_tag="Sfri_0474"
FT   CDS_pept        complement(540717..541337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0474"
FT                   /product="protein of unknown function DUF1243"
FT                   /note="PFAM: protein of unknown function DUF1243; KEGG:
FT                   son:SO4200 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70336"
FT                   /db_xref="GOA:Q088H9"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q088H9"
FT                   /protein_id="ABI70336.1"
FT                   /translation="MTPNHFALLTCAAIETAFNQLPAQAKSDYARQKSLHGKVFCIQLS
FT                   QLNWPIYLVFAKQIQVLSHYEADVAVTVRADASTLYQLTEGANLTELIKQDKLSLEGDI
FT                   QLLQSLSHYLQNIHVDFAEPLSRYIGDAPTHKLVATAKQFNHDIKLVLQKTRSHISQLT
FT                   TEEYRLAPHKIEWLHFRDNLDELVSQTERIEAKIAQLRDQITQ"
FT   sig_peptide     complement(541260..541337)
FT                   /locus_tag="Sfri_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.636) with cleavage site probability 0.546 at
FT                   residue 26"
FT   gene            complement(541337..542092)
FT                   /locus_tag="Sfri_0475"
FT   CDS_pept        complement(541337..542092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0475"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
FT                   / demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferases; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   son:SO4199 ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70337"
FT                   /db_xref="GOA:Q088H8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088H8"
FT                   /protein_id="ABI70337.1"
FT                   /translation="MSEGEPKNTHFGYKTVEADKKADLVADVFHSVAAKYDIMNDVMSF
FT                   GVHRFWKRHTIEVAAARPGMKVLDLAGGTGDLTAKFSHLVGDRGQVVLADINDSMLKVG
FT                   RTKLRDKGIVNNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMQRVLKPG
FT                   GKLLVLEFSTPKHELMRKVYDMYSFKVLPKMGALITKDADSYEYLAESIRMHPDQETLK
FT                   QMMVDAGFEQVDYTNMTDGVVALHRGYKF"
FT   gene            complement(542349..543377)
FT                   /locus_tag="Sfri_0476"
FT   CDS_pept        complement(542349..543377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0476"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   son:SO4198 arginase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70338"
FT                   /db_xref="GOA:Q088H7"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q088H7"
FT                   /protein_id="ABI70338.1"
FT                   /translation="MFSAFTQQHCDALLNLRPNETKIGQQVYLASAELSLAQNAQRAKS
FT                   SGAQFAIIAIAEDVGPRANLGRGGADDAFIASMKQLINLQSNRFLNGNECAILGQISLD
FT                   TSLPTTATVEQLRQATAQLDDIVIAAVSEIMQAGLEPIVIGGGHNNAYGLLMATKATTG
FT                   LPVAAVNLDPHSDFRPREGRHSGNGFSYAAANGALDHYHILGLHELKNSEETLEQLSLF
FT                   GATWNSFQQIWIRRELSLETALKQIAKSLNQTQLPVALELDVDAIANMPSSAATFAGIS
FT                   ILDACHYVHYIAKHCPCRYAHFAETAPACHHAGLEAGYRDAGQGLSELIYAYLQGRLTC
FT                   LN"
FT   gene            complement(543476..543961)
FT                   /locus_tag="Sfri_0477"
FT   CDS_pept        complement(543476..543961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0477"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: son:SO4197
FT                   regulator of ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70339"
FT                   /db_xref="GOA:Q088H6"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q088H6"
FT                   /protein_id="ABI70339.1"
FT                   /translation="MEYNTSELCDMYIDVVDVVEPMFSNYGGCSSFGGSISTIKCFEDN
FT                   GLIADALEEDGEGKVLLVDGGGSLRRALLDARIAEIAVANNWEGILIYGSVRDVDALEE
FT                   LDIGIQALASIPVGAESNGVGEVEIPVNFGGVTFLPGDHIYADNTGVILSPEPLDIE"
FT   gene            544348..544596
FT                   /locus_tag="Sfri_0478"
FT   CDS_pept        544348..544596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70340"
FT                   /db_xref="GOA:Q088H5"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:Q088H5"
FT                   /protein_id="ABI70340.1"
FT                   /translation="MENINIIEVLGYAASVMVAISLMMKDIVLLRWLNFVGCSFFVAYG
FT                   YAIEAWPVAGMNAFVACINIFHLIKIYRNKSAQPQTA"
FT   gene            545053..545565
FT                   /locus_tag="Sfri_0479"
FT   CDS_pept        545053..545565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0479"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   son:SO4195 PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70341"
FT                   /db_xref="GOA:Q088H4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q088H4"
FT                   /protein_id="ABI70341.1"
FT                   /translation="MKSISQLDKYWFYWVVQFSRDNGLNQAAKRVSATGDGHYYAYLSV
FT                   ALLFFHPNGQHFFNLVLGSFLVELPLYLLLKNSIRRHRPCHALAGFESCFEPADKFSLP
FT                   SGHTASAFVFASVVNLVFPALAPIAFAWACFVGSSRIALGVHYPVDIIAGAGLGIGSVL
FT                   LVDQLML"
FT   gene            545723..546772
FT                   /locus_tag="Sfri_0480"
FT   CDS_pept        545723..546772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   son:SO4194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70342"
FT                   /db_xref="InterPro:IPR005262"
FT                   /db_xref="UniProtKB/TrEMBL:Q088H3"
FT                   /protein_id="ABI70342.1"
FT                   /translation="MKILYGVQGTGNGHISRARVMSKALKQHNIDVDFLFSGRKQQHYF
FT                   DMQCFGDYQTRNGMTFITENGRVNSVKTAKNNLTTPIFSEIKQLDLTGYDLVLNDFEPV
FT                   SAWAAKQQNIPSIAISHQAALQYPVPKQGNSWFNEFLLNHFAPVDIALGCHWHHFGFPI
FT                   LPPFVEVWPNGGDHSHQILVYLPFEEPDRIAAFLAPFDQYHFSVYHSTKPLKPLAEHVH
FT                   WHGFNREGFKQHMAQCGGVIGNAGFELASEAMTLGKKLLVKPLLGQFEQSANVAALELL
FT                   AAAESMQTLDFAVLKRWLKSPSPKPIAYPQVGDALVEWLKMGDWHQSQNLCQHLWSQVE
FT                   LPENWHKRQ"
FT   gene            complement(546845..547312)
FT                   /locus_tag="Sfri_0481"
FT   CDS_pept        complement(546845..547312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0481"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit,
FT                   Rsd/AlgQ; KEGG: son:SO0433 regulator of sigma D"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70343"
FT                   /db_xref="GOA:Q088H2"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:Q088H2"
FT                   /protein_id="ABI70343.1"
FT                   /translation="MLTKLEKAEKRWGGSHNLIDQWLNHRRKLLIQYFIVAGLAPYSRS
FT                   EKSLPSMDQVKQFCAQLVDYVSEGHFEVYDNVVKACEKFGETSIETANALLPLISESTD
FT                   AALDFNDKYTDASDEQVLYQLDNDLSHLAQAMESRFELEDQLLELLYQRLP"
FT   gene            547769..548833
FT                   /locus_tag="Sfri_0482"
FT   CDS_pept        547769..548833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0482"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: son:SO0435 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70344"
FT                   /db_xref="GOA:Q088H1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088H1"
FT                   /protein_id="ABI70344.1"
FT                   /translation="MAELKNDRYLRALLKQPVDVTPVWMMRQAGRYLPEYKEVRAQAGD
FT                   FMSLCRNAELACEVTLQPLRRYDLDAAILFSDILTVPDAMGLGLYFEAGEGPRFERPTD
FT                   TIDAIKKLCIPDPEDELGYVMRAVSTIRRELNGSVPLIGFSGSPWTLATYMVEGGSSKT
FT                   FEKIKRMAYAEPAALHMLLDKLADSVVLYLNAQVANGVQSLMIFDSWGGALSHHAYREF
FT                   SLRYMQKIVDGLTRFADGRKVPVTLFTKGGGLWLESMAETGCDALGLDWTVDIGDARRR
FT                   VGHKVALQGNMDPSMLYATPERIHQEVDQILASYGEGTGHVFNLGHGIHQHVDPEHAGA
FT                   FINSVHELSGKYHK"
FT   gene            549493..549789
FT                   /locus_tag="Sfri_0483"
FT   CDS_pept        549493..549789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70345"
FT                   /db_xref="GOA:Q088H0"
FT                   /db_xref="UniProtKB/TrEMBL:Q088H0"
FT                   /protein_id="ABI70345.1"
FT                   /translation="MSSMEEQAVKIQRSSNLVKGFMALVIIFQVVQFYQTRMLDFGEIA
FT                   GVFGILFFLRGLLSSPLLLVAPLKHWFKSNLVFSTASYKYFICAFALVVVSLF"
FT   gene            complement(549967..551424)
FT                   /locus_tag="Sfri_0484"
FT   CDS_pept        complement(549967..551424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0484"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: cps:CPS_0650 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70346"
FT                   /db_xref="GOA:Q088G9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G9"
FT                   /protein_id="ABI70346.1"
FT                   /translation="MNRLFNRLFLASTIIVLLLFVALWQWLQLNHEFSRNQIQQSLHLQ
FT                   LAEHMAHINPLLSQGITSDAALKEAFHDFMLLGPSFEIYTLDPDGNVIAYDAKEEKIKT
FT                   HRVDTAIIQQFLNGVSLPVLGTDPRSVDTHKIFSASKLVTKDGLHSGYLYVIIGGEDYD
FT                   SWQALINAENQPKIWGATIGFWIIFALVLFVILLRYFTRPIQKLAQDLTELKNTPMSDK
FT                   LMLPQRYRGSLEISQLSHHINHLLQEIQLQQQQVKRQQQAKHDFLLHLSHDLKTPLTAL
FT                   LGYIDTWLILPEHERDEALIQYAANSGQTLQQLLAQLLELAALENGQIDAQLQQVNLSE
FT                   LLSDIEQTFTPRAKKLGVQLDFDINHASQIYTDPALMRRILNNLVDNALRYTPAGGKIQ
FT                   IVNAQHNGQQWLTVRDTGAGMHKHEVDALKQLSMTRLSFEANQSLPQLGVGLAIVRQLL
FT                   GLLKCRIEIDSQPGVGSEFKIELVTQG"
FT   sig_peptide     complement(551347..551424)
FT                   /locus_tag="Sfri_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.884) with cleavage site probability 0.658 at
FT                   residue 26"
FT   gene            complement(551424..552158)
FT                   /locus_tag="Sfri_0485"
FT   CDS_pept        complement(551424..552158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0485"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sde:Sde_3703 response
FT                   regulator receiver domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70347"
FT                   /db_xref="GOA:Q088G8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G8"
FT                   /protein_id="ABI70347.1"
FT                   /translation="MNGTAKHNGHVCPQHILLVEDEQDLAKLIILNLKALNYSVDHATT
FT                   LKQAMHIIEHKKLDLILMDRMLPDGDGIMLCEQLRQDGKEVPLMLLTAKDSEADVVLGL
FT                   EAGADDYLVKPFSVLELRARVKALLRRGKTQHEQTQQIEFNSVSINSSTREVTAFNKAL
FT                   TLTAREFDLLLFLAKHPQQVFSRMQLLEAVWGYNYDGYEHTVNSHINRLRNKLSLCSPE
FT                   HDLVKTVWGVGYKFSPPEVQAH"
FT   gene            complement(552269..552994)
FT                   /locus_tag="Sfri_0486"
FT   CDS_pept        complement(552269..552994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70348"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="InterPro:IPR038678"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G7"
FT                   /protein_id="ABI70348.1"
FT                   /translation="MKRTDFTLKPSLIAMLAAATLLTACGDDNDDDTTVVVTPPAPVMQ
FT                   TFTVTVTNLTANQPMSPVILASHASDAMLWNAGEMASEAIEKIAEGGDTADIAALSVIK
FT                   SSVNGTGLLMPGMSETLTLTLDEADVASISLATMLVNTNDAFTGINSYTIAGMEVDATT
FT                   AMKFMAYDAGTEANSEAKGTMPGPADGGEGFNASRDDVDFVHIHPGVISMYDGLTDSVL
FT                   GASHRFDNPVLAVTIMRTE"
FT   sig_peptide     complement(552914..552994)
FT                   /locus_tag="Sfri_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.868 at
FT                   residue 27"
FT   gene            complement(553006..553707)
FT                   /locus_tag="Sfri_0487"
FT   CDS_pept        complement(553006..553707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_3701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70349"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="InterPro:IPR038678"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G6"
FT                   /protein_id="ABI70349.1"
FT                   /translation="MKRTLVTASLMAAGLFSLPTLAADIEVSVTNLTHGNHFTPILIAA
FT                   HDADSHLFQVGTEASAALQKMAEGGDIADLDAAVTGNAGVTSANPATGLLAAGANVSGV
FT                   MLDTGDNTHLSIVAMVLPTNDAFMGLDGWEIPTEAGTYTMYVNAYDAGTEANDEIINGG
FT                   GMSGVPGIPAAPGGDGGANGTGVMDNSDNSNVHTHPGVLGDMDPAGGMSDLDSRVHRWL
FT                   NPVAKVVVTVK"
FT   sig_peptide     complement(553639..553707)
FT                   /locus_tag="Sfri_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            553850..554407
FT                   /locus_tag="Sfri_0488"
FT   CDS_pept        553850..554407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0488"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="KEGG: cps:CPS_4285 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70350"
FT                   /db_xref="GOA:Q088G5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G5"
FT                   /protein_id="ABI70350.1"
FT                   /translation="MIMIRQLTPADFDAVITLGEIVHGSGYMDIAELTAIYHKGIKNGI
FT                   NANFVALENEQLIGFRLTYAAGQWPQDQWCTVDKWGVKFEDVCYFKSNTIAESGRGQGL
FT                   GGKLLAASKAAVIAQGAKAGVSHLWQQSPNNAAVRYFTKAGGKLIKQHPQRWHQRYMGD
FT                   DYICVLCGEDCHCVACEMLLLF"
FT   gene            554447..555787
FT                   /locus_tag="Sfri_0489"
FT   CDS_pept        554447..555787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0489"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   cps:CPS_1461 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70351"
FT                   /db_xref="GOA:Q088G4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G4"
FT                   /protein_id="ABI70351.1"
FT                   /translation="MYDPLINSHPNNQTFAPSYWANTQALPAPAAALSGRQQTDVAIVG
FT                   GGYTGLLTAYYLATEFNIDCHVLEANQVGFGASARNAGFVLKGSGRLGYAAMTERWDLA
FT                   TTKGIYDEFTQAVARVDGLIKQHNIACEPQEAGYLKVAHNPKALVTLQNAANYIQQHLA
FT                   SSQDSGAEFISSQDFRSQYLDHHQAFGALRLKDGFGLNPLKLLLGYKDMVQAQGVTISE
FT                   QSCVLDWIEEGGKHRLITDKGELIANKVIMAGNAYTPKRFNQRIDDKFLPILSNVIVTE
FT                   PLTAQELAEAGLHTHQVTMDTRILKYYYRLLPDNRLLFGGRGAVWGKDAANPVYGERLK
FT                   MALNKCFPSLTSKAIAYNWTGWIAAAMDDMPHVYSKDGVGYSLGYCGAGVSFSSQAAYR
FT                   LAQSIAGETLPNLPLYQQPLPKFPFTQARRLGQWGYYHYGWLKDRFG"
FT   gene            complement(555821..557320)
FT                   /locus_tag="Sfri_0490"
FT   CDS_pept        complement(555821..557320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0490"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; KEGG: pha:PSHAa1677
FT                   Na+/H+ antiporter NnaC"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70352"
FT                   /db_xref="GOA:Q088G3"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G3"
FT                   /protein_id="ABI70352.1"
FT                   /translation="MSQSASFKPSSSEHKQPSLLDALIPVFALILMLAAAVYLFSSDSS
FT                   SGANQIALVLAACIAMIIGYKNGYSWNQMERGIVKSIGVATGALLILFSVGSLIGTWIL
FT                   AGTVPTMIYYGMQILNPDYFYTACCLLCAVVALSIGSSWTVAGTLGIALVGISSAMGLD
FT                   VNITAGAIISGAYFGDKMSPMSDTTNLAPAVAGTDIFSHIRHMTWTTVPSIIIALIGFT
FT                   FLGLTADVVPIENQLVDTLALLDKTYSPGIHLLIPLLVVLYLANRKMPAFPTVILGTLA
FT                   GAVCAALFQFDNVIAFVHDDTLLPMVALVKGLWIAMFDGYVANTGDEVLDNLLSRGGMS
FT                   SMVTTVWLILCAMAFGGVMEVTGLLNRILESILTVVTGTASLIITTLGVCIGANIITAD
FT                   QYIAIVLPGRMLKVEYTRRKLAAVNLSRTLEDSATVTSPLVPWNTCGAFMASTLGVATI
FT                   AYLPYAFFNLVCPFISASYAYFNFKIEPLDETKISTGEVVG"
FT   gene            complement(557680..557898)
FT                   /locus_tag="Sfri_0491"
FT   CDS_pept        complement(557680..557898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70353"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G2"
FT                   /protein_id="ABI70353.1"
FT                   /translation="MKVNTSDLIYQGEKAGVHNWDTFSGTSFYWHPDWLHIAEDMTGHK
FT                   ALEKIDIPQGEATKADAEKAILKHLNK"
FT   gene            complement(558155..559456)
FT                   /locus_tag="Sfri_0492"
FT   CDS_pept        complement(558155..559456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0492"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: son:SO0441 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70354"
FT                   /db_xref="GOA:Q088G1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q088G1"
FT                   /protein_id="ABI70354.1"
FT                   /translation="MQVLIIGGGGREHALAWKAAQSAQVTKVFVAPGNAGTSLEPKLEN
FT                   VAIDVEQIDALVTFAKDNAIAITIVGPEVPLSLGVVDAFNAAGLPIFGPTKGAAQLESS
FT                   KAFTKDFLARHNIPTADYSNFTEIAPAKAYAAILTAKTGFPVVIKADGLAAGKGVIIAA
FT                   NQVEADAAIDDMLAGNKFGDAGSRVVIEEFLKGEEASFIVMVDGKNILAMATSQDHKAR
FT                   DNADQGPNTGGMGAYSPAPVVTQAVHDWTIANVIRPTVDGMTAEGNVYTGFLYAGLMIA
FT                   PDGSAKVLEYNCRFGDPETQPIMMRLQSDIVELCLAATRGELDKVTAEFDSRAAVGVVM
FT                   AAGGYPDAYNKGDVIDGLTLGDTNGKVFHAGTSMKDGHVVTNGGRVLCATALGNTVTEA
FT                   QQAAYDLVDAIHWDDVYFRTDIAYRAIAREQAKT"
FT   gene            complement(559676..561265)
FT                   /locus_tag="Sfri_0493"
FT   CDS_pept        complement(559676..561265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0493"
FT                   /product="IMP cyclohydrolase /
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: son:SO0442
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase /
FT                   IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme; MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70355"
FT                   /db_xref="GOA:Q088G0"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088G0"
FT                   /protein_id="ABI70355.1"
FT                   /translation="MNNVRPIRRALLSVSDKTGILEFAQALHAQGVELLSTGGTAKLLA
FT                   DNNIPVMEVSDYTGHPEIMDGRVKTLHPKIHGGILARRGIDEIVMEQNAIKPIDLVTVN
FT                   LYPFAETVAKPGCTLADAVENIDIGGPTMVRSTAKNHKDTTIVVNAKDYGRVIAEMQAN
FT                   NGSTTLETRFDLAIAAFEHTAAYDGMIANYFGTMVPAHSNDECHDDSTFPRTFNSQFVK
FT                   KQDLRYGENSHQKAAFYVDTQIDEASVASAIQLQGKALSYNNIADTDSALECVKEFEGP
FT                   ACVIVKHANPCGVALGANLLEAYDRAFKTDPTSAFGGIIAFNQELDAQTAQAIVDRQFV
FT                   EVIIAPKVSQAARDIIAAKANVRLLECGEWNTKTTTLDYKRVNGGLLIQDRDQGMVNLE
FT                   DVKVVSKRQPTAEQLKDLMFCWKVAKFVKSNAIVYAKDGMTIGVGAGQMSRVYSAKIAG
FT                   IKAADEGLVVENSVMASDAFFPFRDGIDAAAAAGISCIIQPGGSIRDEEIIAAADEHGM
FT                   AMVFTGMRHFRH"
FT   gene            561573..562034
FT                   /locus_tag="Sfri_0494"
FT   CDS_pept        561573..562034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0494"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Zn(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG: son:SO0443
FT                   zinc-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70356"
FT                   /db_xref="GOA:Q088F9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F9"
FT                   /protein_id="ABI70356.1"
FT                   /translation="MYRIGKLSALYDIKADTLRFYEKHGLLSPSSRSDSGYRLYNQADS
FT                   ERLKFILRAKAVGFSLNDIADLLSIEVDKSNRACADVKGLVDTKLEQVEAKLAELQHFA
FT                   TSLKSLSNTCCGGPDSAEHCSILEALESSDKHIIAKKEHHHFAHSGHKD"
FT   gene            562037..563569
FT                   /locus_tag="Sfri_0495"
FT   CDS_pept        562037..563569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0495"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: son:SO0444 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70357"
FT                   /db_xref="GOA:Q088F8"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F8"
FT                   /protein_id="ABI70357.1"
FT                   /translation="MLLTNFLHLFLESAPWLLLGLVLAGLLKVFVPMAWMQKQLGGHGM
FT                   KTVVKAALLGAPLPLCSCGVIPAAVGLRRAGASKAATTSFLVSTPETGVDSITVSYVLL
FT                   GPFMAIVRPIAAITSAIVAGLLVGRDDDDGIPASTSAKAKTATDSSASAKPVSSCCGSK
FT                   STASSDASAEASTETTSIGKTTTSTMQNASVKMTAIKSESVNSGSILSPMTAAQSIGGS
FT                   RSQVKQSSCCGSKAADKPAESAPAACCSTKVKDDVKDETPAATVTSSCCSSKAEPKVEA
FT                   ISTSCCSTAATVNHAASKSSDEASCCASTQDMATELKHNSVFSRVLSGLHYAATDLVKD
FT                   TTLWLLVGLFFAAIVQTYVPADFLVKWGDGIPAMLVMVLVSIPMYICATASTPIAAGLL
FT                   LAGVSPGAVLVFMMAGPATNIATLGVVTKELGKRALYGYLGGVIGVALVFGVLVNYLVD
FT                   TFGFEVMPQIGEEHALLPQGVVAISGIVLAVLMAKVLWDMIPKGNKEKGCCS"
FT   gene            complement(563732..563986)
FT                   /pseudo
FT                   /locus_tag="Sfri_0496"
FT   gene            complement(564100..564222)
FT                   /locus_tag="Sfri_0497"
FT   CDS_pept        complement(564100..564222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70358"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F7"
FT                   /protein_id="ABI70358.1"
FT                   /translation="MSKERNNSKEAKKKPALSLKEKRAVKQSKNSPENFASKIK"
FT   gene            complement(564496..565434)
FT                   /locus_tag="Sfri_0498"
FT   CDS_pept        complement(564496..565434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0498"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0523 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70359"
FT                   /db_xref="GOA:Q088F6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F6"
FT                   /protein_id="ABI70359.1"
FT                   /translation="MDLNRVQIFSQVVEQGSFTGAAKALGITKATVSRKIADLEADAGV
FT                   QLLFRTTRSLKLTEAGSSYYHRISKILQDLQNAEDLLSASQQDIKGNLKVICPIELGQL
FT                   FLGRILARFLAAYPNITIDAELTNRKIDVIEEGVDFLFQITEQHDPKLQSYSLVTASRL
FT                   LMASPTYLKRHGTPQIPQDLMLHTAIKLQSAHINGGWRIFDGNQWLDLDPPAQLKVNNV
FT                   TFAREAAIEGLGITAVPVFIAQEAIDSKQLIPILEDFPMMQTKVTLSFPQRVYLPRKYR
FT                   VFVEFLYAALFEHWGEGVLEIPDFVHQSNHN"
FT   gene            565531..566625
FT                   /locus_tag="Sfri_0499"
FT   CDS_pept        565531..566625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0499"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   son:SO0524 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70360"
FT                   /db_xref="GOA:Q088F5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F5"
FT                   /protein_id="ABI70360.1"
FT                   /translation="MSINKRLVLVPSIIVVLVVAGVYWWSQVRYIESTDNAYVEADISN
FT                   ISVKVPGYIVQSTVVDNQHVNKGELLAQLEDSQFVAKLAQSKAVLASTQANLQTLAAKV
FT                   DLQQALINQAKATVVASQSEQLIAQQQLKRSQKLKISNYSSQNDVDQLQAGFDSASAHV
FT                   DEAQAALVAKQRELSVFNAQLLQVQADVDQAMASVELANIQLVDTRVTAPFSGIIGKRG
FT                   AMVGQYVQPGQALFSLVPDAQVWITANFKETQIEHMQAGQAVKVSLDAYPDYVFSGFID
FT                   SLAPASGSKFSLLPAENATGNFTKIVQRIPVRIRLEHDQPSSAIGRILPGLSALVEVDT
FT                   ESATQSHELAKASAVQATSVTAGH"
FT   sig_peptide     565531..565593
FT                   /locus_tag="Sfri_0499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.712) with cleavage site probability 0.666 at
FT                   residue 21"
FT   gene            566627..568258
FT                   /locus_tag="Sfri_0500"
FT   CDS_pept        566627..568258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0500"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   son:SO0525 drug resistance transporter, EmrB/QacA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70361"
FT                   /db_xref="GOA:Q088F4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F4"
FT                   /protein_id="ABI70361.1"
FT                   /translation="MNQSATEADASQVGPVSTVDDKPTGYQRGSTRSWIAVAGGLIGAF
FT                   MAILDIQITNASMKEIQGSLGATLEESSWIATAYLVAEMIAIPLSGWLSTGLSTRRYLL
FT                   WTTAAFIVASVLCSMSWNLESMIAFRALQGFFGGALIPLAFRLILEFLPDDKRAMGMAL
FT                   FGVTATFAPSIGPTLGGWLTEQFSWHYLFYINVPPGLLVMAMLAYGLERKPIIWDKLKD
FT                   ADYSGIVTMALGMGCLEVVLEEGNRKDWFGSDLIRNLAIIAAVNISLFIWIQLRKAQPL
FT                   VNIRLLAQRDFALSTVAYFLLGMALFGAIYMIPLYLSQIHDYTPLEIGEVIMWMGFPQL
FT                   LVLPLVPKLMQKFDPRYLAALGFALFATSYYMNSHMTIDFAGDQMIASQIVRALGQPFI
FT                   LVPIGILATMHLQAHENASASTVLNVMRNLGGAFGIALVATLTDNLARVHLAHIKETLP
FT                   TVSSQAYNYIQHTSSILQTAGSDAVSANSQAYALLAKNMSQQAYIQAYNDVFFIMACFL
FT                   FIAVVAVLLIRKPAVKSDTDQPNEMH"
FT   gene            568305..568769
FT                   /locus_tag="Sfri_0501"
FT   CDS_pept        568305..568769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0501"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   son:SO0526 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70362"
FT                   /db_xref="GOA:Q088F3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F3"
FT                   /protein_id="ABI70362.1"
FT                   /translation="MTLTWLDVGFTELSLEQLYGLMQLRVDVFVVEQNCPYPELDGKDK
FT                   HPQARHLLGLNDQGEILAYSRILAPNVSYPQASIGRVAVAKSARGQGVANQLMQGAIAI
FT                   AKQHWPNDNIQIGAQDYLRQFYQQHGFVVNSDVYLEDGIEHLDMLLIYNS"
FT   gene            568866..569183
FT                   /locus_tag="Sfri_0502"
FT   CDS_pept        568866..569183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0502"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   son:SO0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70363"
FT                   /db_xref="GOA:Q088F2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F2"
FT                   /protein_id="ABI70363.1"
FT                   /translation="MSDYVINTQQIVCVAQFVAKAGKRDELVAVLASLIPDTRRESGCI
FT                   RYELNISVDNDNKVAFVEKFVDRAAFDQHCAKDAIQHYFHNVMPELVESHHVEVFNQVI
FT                   A"
FT   gene            complement(569378..570421)
FT                   /locus_tag="Sfri_0503"
FT   CDS_pept        complement(569378..570421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0503"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: son:SO3896
FT                   outer membrane porin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70364"
FT                   /db_xref="GOA:Q088F1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F1"
FT                   /protein_id="ABI70364.1"
FT                   /translation="MKKTLISASVASVLTLVSFATLAEGPSFYGRLDLAVSNSDQGATT
FT                   QNRKEGTVLENNFSNLGVKGSEKFANGIELLYQMEFQVENTTQTEGKNGSDEVVFKARN
FT                   TFLGLKSDAGTVLVGRNDTVFKQSEGGIDLFGNFNADIDRMIGGQLRKADGLWYYSPVI
FT                   GGLVTLNATYLMEDNYTDDAGKESYDDQYALSATLGDKGLKAHPYYVAAAYNTIGGIDA
FT                   YRGVAQVKLGEFKLGGLYQNTESQTSDQEGDSFFLNVSYNLNGVNLKAEYGQDEAGFGS
FT                   YYKNIKEATGTDVNITQITVGADYRISKSTLVYGHYAMYEGDHKVGTATVDLEDDNIFT
FT                   VGARYDF"
FT   sig_peptide     complement(570350..570421)
FT                   /locus_tag="Sfri_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.967 at
FT                   residue 24"
FT   gene            571212..572015
FT                   /locus_tag="Sfri_0504"
FT   CDS_pept        571212..572015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0504"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   son:SO3895 HesA/MoeB/ThiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70365"
FT                   /db_xref="GOA:Q088F0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q088F0"
FT                   /protein_id="ABI70365.1"
FT                   /translation="MLSESYTHRFAGVGRLYGQAALTTFSQAHVVVVGIGGVGTWVAEA
FT                   LARSGIGQITLIDLDDICVTNTNRQIHALTSTIGQSKVEVMAKRIGEINPECMVNEIED
FT                   FITLDNLAEHFKPTSQGGNIDYVVDCIDAVKPKAGLIAWCKRNKIPLVTIGGAGGQTDP
FT                   TLIQVTDLAKTVQDPLLAKVRNILRKDYNFTKNIQRRFAVDAVFSTQHLVYPQADGSVC
FT                   NTKADAEGSMRMDCASGFGAITMVTGTFAFVAVSRVLSKLAAKSA"
FT   gene            complement(572026..573618)
FT                   /locus_tag="Sfri_0505"
FT   CDS_pept        complement(572026..573618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0505"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO3894 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70366"
FT                   /db_xref="GOA:Q088E9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033414"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E9"
FT                   /protein_id="ABI70366.1"
FT                   /translation="MLISIRQLLQSPIARKLTLSIVIFSSLITLVTTAYQLVSDYQNDV
FT                   SRIDRVFSNIEAVNLEVLAASLWVIDEHLIDTQLRGLSQLPDINYISIRDDSNQEWHFG
FT                   EYKNTAVIEKKYPLIYTNNENIPVGTLIVQADLNVIYDRLYNKTILILLSNAIKTFLVA
FT                   GFILFLVWFNVTKHLRHLSKYCDDISLDHNFTPLDFNRKPQHDEFSLVADAVNTMQRQI
FT                   RGSYQALRQSKVDLQHALEDRDRLLLLERSYKDELTRQVKEQTKELEQSLQMLKRTQQV
FT                   LIEKEKMAALGGLVSGVAHEINTPIGICLTAASSQLSHIEELIKLIHSDDATLEQINEI
FT                   LEQYQQSSQLIVSNITRASYLIQQFKSIAAEQSHEQNTTFNLSHQLRDITDSTLMIFSP
FT                   QEVEITISIDEQLQLNSNASLLSQAITNVVSNAFSHAFKDVTQAKIHINVVTEPESIHI
FT                   EIQNNGAAIPNDIVEHIFEPFFTTARHKGGVGLGLAAAFNAVAQLKGNISYVPISPLGG
FT                   PMFVISVPRLPTA"
FT   sig_peptide     complement(573514..573618)
FT                   /locus_tag="Sfri_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.908) with cleavage site probability 0.768 at
FT                   residue 35"
FT   gene            573849..574460
FT                   /locus_tag="Sfri_0506"
FT   CDS_pept        573849..574460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO3892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70367"
FT                   /db_xref="GOA:Q088E8"
FT                   /db_xref="InterPro:IPR025982"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E8"
FT                   /protein_id="ABI70367.1"
FT                   /translation="MMKIKVGSIKLLNSKRLFVSSMSWLIVACASLLFAPKDLLAFLSL
FT                   DQLVHQYGQFIGLGLIMGVAYFLSQIFAFIVDEAIVYLRQKRTVETIDAKVKLLDPAER
FT                   ALLREFFLQGQTILTLPQNELAVKNLVNTSILEMLGNERHYAIQGPTAEYKISMQARNY
FT                   LNRDVLRLPAGEPSAEEMNHLIKTRPHFINGLIQSRKHAV"
FT   sig_peptide     573849..573974
FT                   /locus_tag="Sfri_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.918) with cleavage site probability 0.369 at
FT                   residue 42"
FT   gene            complement(574647..574778)
FT                   /locus_tag="Sfri_0507"
FT   CDS_pept        complement(574647..574778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA2831 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70368"
FT                   /db_xref="GOA:Q088E7"
FT                   /db_xref="InterPro:IPR021494"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E7"
FT                   /protein_id="ABI70368.1"
FT                   /translation="MAFWLDLMFGNAIGLLSMTVIFCTFGIMSYLMWMFIVKSAPTK"
FT   gene            575178..575262
FT                   /locus_tag="Sfri_R0023"
FT                   /note="tRNA-Leu3"
FT   tRNA            575178..575262
FT                   /locus_tag="Sfri_R0023"
FT                   /product="tRNA-Leu"
FT   gene            complement(575637..577280)
FT                   /locus_tag="Sfri_0508"
FT   CDS_pept        complement(575637..577280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0508"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family protein"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; 4-vinyl reductase,
FT                   4VR; SMART: AAA ATPase; KEGG: gme:Gmet_2116 transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70369"
FT                   /db_xref="GOA:Q088E6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E6"
FT                   /protein_id="ABI70369.1"
FT                   /translation="MKTSQLDLRELLAFKPRGGTMSFLGQRTYLTDMVSHGILRKELLS
FT                   TVDSNVTRTIITRSGFIRGWLLAEQIKRKMPEVWSEARQGKLGPMVCSMFGFGEVLTSH
FT                   RTDGLSGAPLVETYFIGSYEAEQQLRLSGQSQDVVCWEQVGFASGYVSHVQQRTVYFIE
FT                   SECQAKGDCHCHLIGNYAEKWTEKDTLSLHYYNGINIENIKTEVEEILKIEEYFPRNVH
FT                   SNIDLDTPNDYVQSGYPIINSYPMKKLIEMAINVAKVPTSIFVTGESGVGKEKLVDFIH
FT                   RLSDRNNKPLLAINCGALTESLLDSELFGHVKGAFTGAENNKMGLIESANGGTLFLDEV
FT                   GELSPSMQTKLLRVIQEKQIRRVGDNNIKDVDVRIISATNKDLEAAVEAGDFRQDLYYR
FT                   LNVIELKIPPLRNRGEDILPLARCFLSDFNEKLGRKITGFNYKTADLLLNYDWPGNIRQ
FT                   LANTIERAVVLSPGPQIMPEDLPEEFHQNITKPSINNGIKPLNTIEKDYIVSVLETLNN
FT                   NKALTAKKLGMSLATLYRKLKEYDELQNFD"
FT   gene            complement(577479..577835)
FT                   /locus_tag="Sfri_0509"
FT   CDS_pept        complement(577479..577835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0509"
FT                   /product="tetraheme cytochrome c"
FT                   /note="KEGG: son:SO3056 tetraheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70370"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E5"
FT                   /protein_id="ABI70370.1"
FT                   /translation="MFSDWMTIMDKKLILTLLTVLTLFFTHYASAKTMKSHHKKSGLNC
FT                   ADCHISKTFEAAPMEQCLTCHELPQKKQDYHGAPDKHDSPHYGVELECENCHAEHETSE
FT                   NFCNNCHEFEFNVP"
FT   sig_peptide     complement(577740..577835)
FT                   /locus_tag="Sfri_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(577874..579076)
FT                   /locus_tag="Sfri_0510"
FT   CDS_pept        complement(577874..579076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0510"
FT                   /product="secreted porin family protein"
FT                   /note="KEGG: ilo:IL2008 secreted protein of porin family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70371"
FT                   /db_xref="GOA:Q088E4"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E4"
FT                   /protein_id="ABI70371.1"
FT                   /translation="MNKLYARKPLVIAVAIAIPLMLGTASVNSAEFDIADTKVAVGGYA
FT                   KFMLNYDTDGTITAPFNGDLYSVYTTPIDGSANAEKSDLHMTARESRLFIKTASENKYG
FT                   TLKTYVEGDFFADIDSDGPTWSNSNGFRIRHAYGEMTMGKHVVLAGQTWSNFMDFAGIM
FT                   PSMDFATDPGTTFVRQPQVRYQYNIGKGQYTSISLENPTLGLTAAGPYTLVNNGSSEDV
FT                   MPDIIAKYFYANSRVTFSPRVVIRRFELEGDDAFGYGLALNTSLKFGDGHKAVLGLMYG
FT                   DGIGRYAGLGFNAGAGINADGETDTLEYSSITGGVVFALQQNMRLAIGAGYSEQDEKGL
FT                   EDGILTEYANKTAFSWHTNLFWNITPDIEWAVGVTMGDVENMADKEGDMTRFQTYVKYT
FT                   F"
FT   sig_peptide     complement(578987..579076)
FT                   /locus_tag="Sfri_0510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 30"
FT   gene            complement(579146..580678)
FT                   /locus_tag="Sfri_0511"
FT   CDS_pept        complement(579146..580678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0511"
FT                   /product="flavocytochrome c"
FT                   /note="KEGG: dsy:DSY2606 putative fumarate reductase
FT                   flavoprotein subunit; TIGRFAM: Twin-arginine translocation
FT                   pathway signal; flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70372"
FT                   /db_xref="GOA:Q088E3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E3"
FT                   /protein_id="ABI70372.1"
FT                   /translation="MSTDTKTNLSRRHFLKATSITTATAGLALSGFASAKTESSCTSLP
FT                   DKWDETYDVVVVGSGFAGLSAAIEAKNAKSSVVVLEKMPVPGGNSTINGGGMAVVGSDI
FT                   QKANGVTDSVDAMLADMYKAGLGLNYPKQARMVAEQSNDAFEWCRDYLGVKFKEKLAQF
FT                   GGHSIPRTHTTYNQSGSGIVHPMLEKAKELGIPLKKKVFVKRLISNKEGRIVGLEVITK
FT                   FKPGKENSTATHFIKANKGVVMASGGFATDVVYRSSQDPRLTEELATTNHMGATSECLK
FT                   EMIRVGANPVQLSWIQLGPWASPDEKGFGLAPIFAAYSAFTHGVMVNPETSERFVDELA
FT                   DRKVRADAIIKTGNVAVAICDAKGVKASMHVMPKLLDRKVVHTFDTIQALAAHYNMSAK
FT                   TLEAQIQRYNSYVLAKNDPEFNKPFSMNQQPIVEAPFYAVRLWPKAHHTMGGVEIDTEA
FT                   RVINIATRETIPGLFACGESTGGTHGACRLGTVAIPDCIVFGRIAGKNVAKA"
FT   sig_peptide     complement(580571..580678)
FT                   /locus_tag="Sfri_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 36"
FT   gene            581602..582300
FT                   /locus_tag="Sfri_0512"
FT   CDS_pept        581602..582300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70373"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E2"
FT                   /protein_id="ABI70373.1"
FT                   /translation="MQAQFNVQIGSFRKINKIPNAWSNEDYLQLMAIMGLDDGLEGMEA
FT                   TELREMCMMSLNDLEANEAAKIVLTHLFSELTEGKIDQLSNDMIGDRMWEEYSDCLLHE
FT                   GFFSAYALLREAFNGVFAEPTGVEFMVNVTAADAAELTIFDESLHASMVRLLASGLSPD
FT                   ALLHRLYEDQITGTQFPEALGILWKLELVSSEGLSRQFKMVSSDFWFGKLANVEQFEAS
FT                   AHADESDENE"
FT   gene            complement(582403..586041)
FT                   /locus_tag="Sfri_0513"
FT   CDS_pept        complement(582403..586041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0513"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; protease-associated PA domain protein; KEGG:
FT                   son:SO3800 serine protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70374"
FT                   /db_xref="GOA:Q088E1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E1"
FT                   /protein_id="ABI70374.1"
FT                   /translation="MKTKLALAISAALISGTCFAEPANKYNTTDRVNSEYAGIKATKTE
FT                   KQSTVSAWMIKLNTPSVSQQSRLSKVSSVQATVSVKESQSRVLSAIDGLDADIQVVGQT
FT                   SKLVNAILVKADKKQLISLLKNSDVADILPIYDYELDVADSADYIGATAVIEAGIASGK
FT                   GQKVAVLDTGVDYTHKSLGGSGLVADYEAAVAAQADMPNWPQGKIVGGYDFINNDPNPI
FT                   DVDTNHGTHVSHSVVGIAPDVELYVYSVCNSGCPGLAQLYALEAAMDPNNDGDISDRVN
FT                   TVNMSLGGDFGDTKGGAVQELIDEMVELGVNLVISAGNDGATPFVVGGPSTSVNALSVG
FT                   AMTHPATPVGKVDATAAGVELTAVAAGFNTTNTYSFDSTTAKLVVPTSNLNGCTAFASD
FT                   VDFSGQIPIIDRGACNFTSKVLNAQAKGAPFVIVANNAAGAGASTMGGSDPLVTIPSVM
FT                   ISKEEGDALKAEIAKGDVAFSITSVEVTTAGAIATFTSRGPSIAGTLKPEITAPGTSIM
FT                   TAHPGLGDGLSPISGTSFSSPITAGAMSIVKEALPNRSALEIKATMMNAANLNVTVEPI
FT                   ELNADAELAPISYIGAGLVDIEKSINLPVIAYDKATMQAALAFGLVSLSETSSMTKTIS
FT                   VKNFSAEAKTYTLMAEQRFQNDIDSAAVTFDMPASIKIPAGQTKTFDVTVTIDPTKLPE
FT                   WTLDSSYELSGTALEASDALTLSEYDGAIKFMDGEEQALNVVYHILPKAAAAASVSTEV
FT                   TADGIVRTLTNVGATSITDPFSAPLTATSPKDMTKRHDLLNASSELTGSATCDEGIAIW
FT                   NTFQMRDPIVHGLVASYNVDYDLDNDGVYDYTATTINLDWFSNDAVTYPRALYGFVMAY
FT                   GTGNGAFSPAYHVTGNDFLTTKACFEDIGLTAADLGTTIGVRFRVEESDWEPTSTGTGD
FT                   EIEATLALVGSDATAGLVDAEGEPVTELKPGESAILINEVGNNSLGYMLLSDSGSMSVV
FT                   ANTTDEGNVAPTVEDLVVYVDKGAAAGTELGQVIATDPDMLTSPVSEFIVMSSNSSMFM
FT                   IDSKGKVSLSATAVIDQMSETMEAQVIAIDTMGNRSEPATVSVMINNTQPTVAPTGMTS
FT                   TEGFVVTAKANGKDADGDTLTYNWVQTSGPTVAFGNGGPAISFTAPSGNNTIKFSVTAS
FT                   DTRLESAAGTATITVTKKEEKSSGGSMGWLTALLVPLAALRRRKHS"
FT   sig_peptide     complement(585979..586041)
FT                   /locus_tag="Sfri_0513"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(586334..586795)
FT                   /locus_tag="Sfri_0514"
FT   CDS_pept        complement(586334..586795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0514"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   son:SO3799 regulatory protein AsnC"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70375"
FT                   /db_xref="GOA:Q088E0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q088E0"
FT                   /protein_id="ABI70375.1"
FT                   /translation="MDSSFQRDELDNHILTALMQDARTPFAELAKRFNVSAGTIHVRVE
FT                   KMKQAGIITGAQITVNPKALGYDVCCFIGINLKSAGDYPAAIAKLNELEEVVEAYYTTG
FT                   NYSVFVKVMCQSIDGLQHVLINRIQSIDEIQSTETLISLQNPIVRSVKP"
FT   gene            complement(586896..587573)
FT                   /locus_tag="Sfri_0515"
FT   CDS_pept        complement(586896..587573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0515"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: pseudouridine synthase; KEGG: hch:HCH_04661
FT                   pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70376"
FT                   /db_xref="GOA:Q088D9"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D9"
FT                   /protein_id="ABI70376.1"
FT                   /translation="MADFIYTPPTTPWLDIVYQDKDILVANKPSGLLSVPGREAIYHDS
FT                   IYSRVLAEHPNAQIVHRLDMATSGVIVVALRRSAERELKRQFRDRETAKTYFARVAGHM
FT                   KSNISKVDLPLICDWPNRPKQKVDHTVGKPSVTLVEVVSYGAKSTLVKLTPITGRSHQL
FT                   RVHMMALGHPILGDGFYADPLAKSLSPRLLLHAAALSITHPYSQQVMHFESPVTFMTPT
FT                   ADQ"
FT   gene            complement(587668..587958)
FT                   /locus_tag="Sfri_0516"
FT   CDS_pept        complement(587668..587958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70377"
FT                   /db_xref="GOA:Q088D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D8"
FT                   /protein_id="ABI70377.1"
FT                   /translation="MFPYPDQYRVAMPPMTTALMVVWALMTHAIFTDASPFSLYPLLAL
FT                   FPTVIGAHLYLIWQAKGMSRLDQCFYALVHIPLAFVVWTFTIMHVNGNAFS"
FT   gene            complement(587991..588410)
FT                   /locus_tag="Sfri_0517"
FT   CDS_pept        complement(587991..588410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70378"
FT                   /db_xref="GOA:Q088D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D7"
FT                   /protein_id="ABI70378.1"
FT                   /translation="MNQKKNLPVSDRRFWIERISKTALRALHIIGVVGSGGGIIFNLEL
FT                   SLWLNYWLVAIISGVLLMSWEIIRDWRWLIQLKGVLTLLKVILLGFFIQISQCHSELVI
FT                   FIILLSVIVSHGPAGLRHYSVVHRKVIQSKKEIKG"
FT   gene            588987..589976
FT                   /locus_tag="Sfri_0518"
FT   CDS_pept        588987..589976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0518"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: son:SO0968 D-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70379"
FT                   /db_xref="GOA:Q088D6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D6"
FT                   /protein_id="ABI70379.1"
FT                   /translation="MRIGFFSAKPYDIRHFNSINETFKVDIEFFDYRLCMQNVKLAEGY
FT                   EVVCAFVNDSLCEEVLVELAKGGTKIIAMRCAGFNNVDLIAAERLGMKVVNVPAYSPES
FT                   VAEHSVALMLTLNRKIHKAYQRTRDANFALSGLVGFNMFGKTVGVIGTGKIGLATIKIL
FT                   LGFGCKVIAHDPYPNQAVIDLGVEYVDLNTLYPQCDIISLHCPLTKDNHHLLNKVSFSQ
FT                   MKQGVMVINTSRGGLLDAFDAMEALKDGQIGSLGLDVYENEKGLFFEDKSNEIIQDDIF
FT                   RRLSACHNVIFTGHQAFLTEEALNAIASTTLTNVTQLTTGQTCNNELF"
FT   gene            590077..590814
FT                   /locus_tag="Sfri_0519"
FT   CDS_pept        590077..590814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0519"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: pha:PSHAa2188
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70380"
FT                   /db_xref="GOA:Q088D5"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D5"
FT                   /protein_id="ABI70380.1"
FT                   /translation="MITTTEIHDIKTATGLMRTTLYRPDTKGQFATIIFYSEIFQQTAP
FT                   IARSAAILAGHGFVVLVPEVFHELNPIGTVLAYDEAGKDKGNADKWAKPLEHHDSDTCA
FT                   LVDFARAQSFCNDKVGAMGVCIGGHLAYRTALNPDISGAFCLYPTDIHSNTLPCQEGND
FT                   SLSRTGDIKGELVMVFGKQDPHVSKEGRKLIYQKLEQVNANFTWQEVNAQHAFMRDEGE
FT                   RYDAALALQMYLQAVAFFHRVLN"
FT   gene            complement(590884..591423)
FT                   /locus_tag="Sfri_0520"
FT   CDS_pept        complement(590884..591423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO0961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70381"
FT                   /db_xref="GOA:Q088D4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D4"
FT                   /protein_id="ABI70381.1"
FT                   /translation="MLNQLLMCIVYLAVFLFPQRQVSKWIRQQAEKKQVNEVRSRLVTR
FT                   LISYFMFFVTISIMAISLGLGYQEVSLFVSSAFAVLGVALFAQWSILSNITAGVLIFFA
FT                   FPYRIGDRIRIVEKDEDMSGVIVEIALFHILIKRESGDVMTYPNSLLLQKGVIKLPNEM
FT                   PAKKVQPIKRVIPKRK"
FT   gene            591575..592318
FT                   /locus_tag="Sfri_0521"
FT   CDS_pept        591575..592318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0521"
FT                   /product="conserved hypothetical spermidine synthase"
FT                   /note="KEGG: son:SO0960 hypothetical spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70382"
FT                   /db_xref="GOA:Q088D3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D3"
FT                   /protein_id="ABI70382.1"
FT                   /translation="MSDYKVLHVDSDSVGDFCVLDDGDFRVLSFGDNDEQSKMDKAQPH
FT                   VPQHTYVQAMLAVLLFTQPKSVIILGLGGGALVHSLRHVDAAIKITAVELRERVIEVAK
FT                   RFFQLPLGKKLNLVHQDANVFLANAEHKKVDVVFADIYSNKGVDKQQLSTLFIGQAKQL
FT                   LKTDGFLVLNCWKEHSRDTQLRDTLYSHFTHVYACLTGGGNWVVYATNGHTGFAAANNK
FT                   QALQALSQKLDTNISRVLTRFGIWE"
FT   gene            592539..593108
FT                   /locus_tag="Sfri_0522"
FT   CDS_pept        592539..593108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0522"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   son:SO0958 alkyl hydroperoxide reductase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70383"
FT                   /db_xref="GOA:Q088D2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D2"
FT                   /protein_id="ABI70383.1"
FT                   /translation="MTQSIINSTIKPFKATAFHNGAFVEVTEQDLLGKWAVVFFYPADF
FT                   TFVCPTELGDMADHYEKLQAMGVEVYSVSTDTHFTHKAWHSSSDTIGKITYPMIGDPTG
FT                   AITRNFGVMIEEDGLALRGTFVINPEGQVKVAEIHDLGIGRSASELVRKIQAAQYVATH
FT                   DGEVCPAKWQPGEETLAPSIDLVGKI"
FT   gene            593221..594786
FT                   /locus_tag="Sfri_0523"
FT   CDS_pept        593221..594786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0523"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: son:SO0956 alkyl hydroperoxide
FT                   reductase, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70384"
FT                   /db_xref="GOA:Q088D1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D1"
FT                   /protein_id="ABI70384.1"
FT                   /translation="MLDANVKNQLKTYLQNLKRPVELVVSADDSNKGKELTSLAQDIVD
FT                   SSDLVSVTYQQGKRTPSMSVINPQAATNITFAGLPMGHEFTSLVLALLHSGGHPIKLDA
FT                   DIIEQIRQLPGEFHFETYISLSCQTCPEVIQALNMMAAINPNITNVMIDGALFQQEVSD
FT                   RNIMSVPSVFLNGEAFSVGAISVVEVLNKLDKNAAGRQAEQLNQKSVFDMLVVGGGPAG
FT                   AAAAIYSARKGLNTGIVADKFGGQVAETVGIENFISVSKTEGPKLVANLEAHVKDYDVD
FT                   IMQNQRALSLAKNGLFDVTLESGATLSSKTIILATGARWREMNVPGEQEYRNKGVAYCP
FT                   HCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDSKLRADEVLQRKAKSMGN
FT                   ITIITQAMTTEVKGDGIRVTSLIYTDRATGESNTVTLAGIFVQIGLVPNTEWLKGVVDM
FT                   TPRGEIIVDERGQTSIPGVFAAGDVTNTPFKQIIIAMGSGATASLGAFDYLIRHSEEED
FT                   VKAA"
FT   gene            595234..596853
FT                   /locus_tag="Sfri_0524"
FT   CDS_pept        595234..596853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0524"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: hch:HCH_06069
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70385"
FT                   /db_xref="GOA:Q088D0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q088D0"
FT                   /protein_id="ABI70385.1"
FT                   /translation="MNWFSNMSIFKKVGLIFVLSVIIFAVNLGISTVAINKNRDTLSFM
FT                   ETKVAHRVELANQNVIYVQRLDELYTQAVSFADEDLLENANKTFVSLNDNLTDLSTTDQ
FT                   QETAVLSQLSNNLNEYNTMTLSLARGMLDGTIDMADVGQISQKKAKIFDKLTNGITVYK
FT                   ADKVDEFSSTIKEAGDRSEQSLYLSFSIGIALLVFMALATISIARAISGSAGDVANSLG
FT                   ELADGKGNLRHQLTVAGTDELGQVSSNFNRFLRLLADSIQRVVSVTSPLLDSASSLKER
FT                   MAVATKATKQQSHDAKAVHMSMEEMRHSVNDISHSAQQAAEAAQVAEREATEGLAVVQR
FT                   TVRISQELNSGIELASNSIHELAKDTESVGSILNVITSIADQTNLLALNAAIEAARAGE
FT                   HGRGFAVVADEVRALASKTADATKEIRGVLEKLKIAAESSVSTMDVAITKSSENERYAK
FT                   DTGEVLSSIQSKIVSINSMNTHIASATEQQSLVAAHVANNVVEMNASFEQTLGILAEVQ
FT                   GISEGLDGFANELNHATSQFKL"
FT   sig_peptide     595234..595320
FT                   /locus_tag="Sfri_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.853) with cleavage site probability 0.482 at
FT                   residue 29"
FT   gene            597251..600922
FT                   /locus_tag="Sfri_0525"
FT   CDS_pept        597251..600922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70386"
FT                   /db_xref="InterPro:IPR021979"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C9"
FT                   /protein_id="ABI70386.1"
FT                   /translation="MVELLLNGHTNICGTNASGKTTLQRLVPVFYGEYPSRVVPSTRDS
FT                   FERWYLPHDSSYIIYEYQKDDGLLYQAVLASAGDGKGVNYRFIGRAFELEHYIKSRNGD
FT                   TIICHSMAGLGREVKRDGVAHTNLLNTREFRAIIQNDRSLLNTGSNRNELRTYARQFSL
FT                   CDGEHSLRHIEKLAKAVHSKEGKMETVKSMIAAILEEDGVNPPTSRLNPQRVETWIRES
FT                   QLVQGFEQIRPEYEKLEQEFNQLLSAELRLASLSRGYRADETLEAERQDRNQTHGKELN
FT                   LKLRLLDDEWKDVRDELNQELSAAKGDAGKFEDELNAIEDQHAAFLDADIEQAKADLDN
FT                   LPNWRSDVENLNERHKLQTEKHQDIEAAFNARRSKIAEQLHRELETLHLEQDTQREARD
FT                   KQRELANDDIAKLELQWREQTDAGKAKFSEQEYQLKLTAAELKHQVDGVTYTEDEKMRL
FT                   AIFDERISLADEEQETCNQKVDRLTTEERKQRAKRDQANEALRISSIRVSDRENAKEEL
FT                   HHMLFPQSHTLLEFLRKEAHGWEHTFGKVIAPELLHRSDLHPSLTKDSSEALFGVNLDL
FT                   KAIDVPEYAATEQDLRIRLAKAEEALKSAQEMHAEAEDQLVAMNTALDNITRELTFART
FT                   AYKNSREDLRRVFDEKRNEQQKINQAVADRKVDSSKRLVQLDNELKLLSNQHLGWLSEQ
FT                   KEQALEARMEKNAYWQEVVGAIDNQLGQIKANIEQRRANAKTEQKAGETWYKNELKSRG
FT                   VDEGTILALKKQIRDLEACISNAEQRRSEVLRFDDWYQHTWLVRKPKVQTQLTDVKRAT
FT                   LELEQLLKAKTAEIKHRRDSLETERKACDAAQVEASENLTKLRAVMRKLAELKLPANND
FT                   EAMGSIGERLRQGEDLLLKRDYLMGSVKQYVEHFDSVIASKSGSSLAEFWERARDESSF
FT                   VNDKGIRLLDYRKLVPQLEQLLNVMVPQSLMAIREQGRIFGIDLTAFYDVLTDIDRRIA
FT                   SQSARITREVGEELFLEGVSESAVRIRSRISELEFWPELEVFVKAFKAWKADGFSLLPD
FT                   EHYTNSMRRALDIIGRAALTGGIAKLLEIELRLKEGNSDLIIRTDRQLNESSSHGMAYL
FT                   ILCKFLLAFTRLLRGKANVTIHWPIDELGTLHHTNVKKIFDACENNNISVLGAFPNPES
FT                   EVLSLFANRYIINKQTKKLQVVKPKANPLAARLSQRNTKTEMPTAEMTRAETAKEHI"
FT   gene            600922..601575
FT                   /locus_tag="Sfri_0526"
FT   CDS_pept        600922..601575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70387"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C8"
FT                   /protein_id="ABI70387.1"
FT                   /translation="MSESTETTLVGTGALIEQLLRGEFICRVTNEDGWRALKNNSTRDR
FT                   VETYLNQINRTIASAGEGEVFFCGYLQLGEVERKVISSQFKDICSGLIPLVEWLVLVQE
FT                   ASGQDAPLSEGAPIRLTDLQARIEDTPAFREQLTKLSHYRLFGSSSTNVDGQIKLVFKR
FT                   LVELGYLTKPNSEKQIYIATGKLDYLYEVIRFIDETEGLSLEAQAETATQRDLI"
FT   gene            601572..602792
FT                   /locus_tag="Sfri_0527"
FT   CDS_pept        601572..602792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70388"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C7"
FT                   /protein_id="ABI70388.1"
FT                   /translation="MSSNLHQAGVKLLKQLGRHADVVMDAYLAGSINDTAHDAGVIEKL
FT                   KKSGILWRPEPDQELRLKRSVRALLEEALSDERNRQIDANVGSALATIKTLADHYKEAR
FT                   RDVDFSAAEAYLADLNEHVYSFTDSLRYSIRVLWSRINNEFGYVGTISAKIRENELAQS
FT                   QVSELLNGLEMFQFSELGEIAGDIRELRRLLMTSLQETLSQCTQELSIVQARLYELLGR
FT                   FRQIQGRTRLLKGWLLHTNMHPDYQPENHVVHKAVPVLFNCAEALIAPASVDVSNPHHE
FT                   LELMGLVAQVKAISRDSLPAVLREHNVTFEMGDREDFDIPENPLKIAVDEYFCEVIDSG
FT                   LRQSALSYLQEKQLTWDAESWLYQVIGGYEGLADEHKNYFELEPIGKPDPVYSGNFIIN
FT                   DVELWLA"
FT   gene            602780..603784
FT                   /locus_tag="Sfri_0528"
FT   CDS_pept        602780..603784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70389"
FT                   /db_xref="GOA:Q088C6"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C6"
FT                   /protein_id="ABI70389.1"
FT                   /translation="MASLSKRQLQLMEHAAKQRLPRVKFTADWNKLYQLWQIGETDGTD
FT                   KYLYLTANDYVLLRNMAQIDSGLDILALDFDVPRQQMSQLSANEKYANISPEADYVLIK
FT                   LAPSLSQDQVTDLAPGSVADLLSVHNCSLRLKVDSAIALCQQLNLTNLIVVENLDSFDH
FT                   FFANSFTPDLQVIINNCMVLYRGSHDYSPAGRKRFLHLLQPLNINVISFTDLDPAGLMI
FT                   ANTLESCSSIIVPQLALESPDKLLALAQTNSTDDFHKQHKQWAYLNNLHRDAHSGEQSK
FT                   SLSAYQSSSQSIKYSSQWLALVQWLGQHCVSIKQQHMLAKSMSLTLLNIHCSE"
FT   gene            604347..605468
FT                   /locus_tag="Sfri_0529"
FT   CDS_pept        604347..605468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0529"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   son:SO4004 proton/glutamate symporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70390"
FT                   /db_xref="GOA:Q088C5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C5"
FT                   /protein_id="ABI70390.1"
FT                   /translation="MFVNMIMMLVVPLVFVSIVCGVCELQDLKSFGRLGGKTFGFYIIN
FT                   TMVAILAAFTVAMIFEPGKGVDMSSNGSLDITATELPDLMSLIVSIVPNNPFSAFTSGN
FT                   MLQVIFMALLMGGVIKSMGQSVEGAVKGFQTANKIMMRLISVVMSLAPYGVFALMFKLG
FT                   ATLEPEIFVSVVEYLVLILALLLIWIFIVYPYSVSLFTPISAKTFRDKTQEQILFSLST
FT                   ASSNATIPVTMRTLTDKLGVSQAVAGFGVPLGATMNMGGVSIYITIAIFFVANAFGMPI
FT                   SNDQIPSLLFSVFLLSVGAGGVPGGGMVMIGVLIYQLGLPAEAFVIVAALDRIIDMVLT
FT                   SCNVVGDTAVLTIVDQTEQAHQLEAAKAAAEKV"
FT   gene            complement(605615..606826)
FT                   /locus_tag="Sfri_0530"
FT   CDS_pept        complement(605615..606826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70391"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C4"
FT                   /protein_id="ABI70391.1"
FT                   /translation="MPHARSSNKNKYIAAILLLLLISMSAYAYLISTKAPTIETGTILV
FT                   LPVQLATDNTDSQWNRYAAMDMLINKLNVSVSYPLLQTEDIINIISLIANDHLSQTVDI
FT                   QQLMAVSGAGLVIESSITSANNQYQLAYTLHQQHHTKVGVINASSIEQALLTAANEITE
FT                   RINPQHNLQNNLQQNQHHKKTTTQYHSRLSEPLLFNAMTQLQLGDIKAAEQHLSKLIRS
FT                   TPDNLVAIRLLASIQLQQQQYQQLNTTLIAAIDLATHQQDERELARLRLLLAQSYTETD
FT                   RIEQALGVLTIAKTNAAKVKDWLTLGYISQLAGMINQRIGRNDEAREQFKKAIEYHQMM
FT                   NYPIGQTQALNELAELEIIEFNYPQAYRYINRSYEQVAHRGLDDLEKTTFKLMTKIENK
FT                   MQHR"
FT   sig_peptide     complement(606740..606826)
FT                   /locus_tag="Sfri_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 29"
FT   gene            complement(607034..608026)
FT                   /locus_tag="Sfri_0531"
FT   CDS_pept        complement(607034..608026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0531"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-1,6-bisphosphatase; KEGG: son:SO3991
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70392"
FT                   /db_xref="GOA:Q088C3"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088C3"
FT                   /protein_id="ABI70392.1"
FT                   /translation="MQTLAQTLSVQAVNASLTQLLLTLADTSKAISGAVRHGALAGVLG
FT                   ATEQENIQGETQKKLDVITNDMLKDALKADGNVRGLASEEEDYVVEVNAKGEYLVCFDP
FT                   LDGSSNIDINSLVGTIFSVLPAPAGELNEQSFLQAGRKQVAAGYVLYGPSTMMALTTGQ
FT                   GTQFYTLAPDSQEFLLTDDSVQITPDTAEFAINMSNQRFWEAPMQTYIADLLLGEIGPR
FT                   EQSFNMRWIAAMVGDVHRVLCRGGIFSYPTDNKNPAKPFKLRLMYEANPMALLVEQAGG
FT                   KASTGYETILDIQPTEIHQRVAVILGSANEVDTCLSYHGIDYSEEPSID"
FT   gene            608202..610505
FT                   /locus_tag="Sfri_0532"
FT   CDS_pept        608202..610505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0532"
FT                   /product="dipeptidyl-peptidase IV. Serine peptidase. MEROPS
FT                   family S09B"
FT                   /EC_number="3.4.14.5"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; peptidase S9B, dipeptidylpeptidase IV
FT                   domain protein; KEGG: son:SO3990 dipeptidyl peptidase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70393"
FT                   /db_xref="GOA:Q088C2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C2"
FT                   /protein_id="ABI70393.1"
FT                   /translation="MTTTWKHHALAAVSAVPLLFTSSVFSATATAQGSIMNSSTTATLT
FT                   AINGSTTPLTIERIHASPAVAGSSPRGLALSPNGKRVTYLSNRADNQHLYDLWQMDIAT
FT                   GKRSILINADQLEAGELSDEEKARRERQRIYGQGIMEYFWSEDSQHILIPAAGKLYLYD
FT                   VASNKVAELATGDGFATDGRLSPKGHFVSFVRDQNLFVLSLDSQKVTALTTDGKGPIKN
FT                   AMAEFVAQEEMDRMTGYWWAPDESAIAFTRIDESGVELVTRNEIYAEGIKLTEQRYPYA
FT                   GKANVEIALGVVTLKDRSISWIDLGKQKDMYLPRVDWLPDSQHVSFQWQSRDQQTLDLR
FT                   IAAISQPTQAKTVIEERSKAWVNLNNDLHFLKQQAALIWGSERDGFNHLYLFDLQGKQL
FT                   KQLTQGDWAVDTLEFVDEATGWVYFSGRKDSVVERHLYRVNLNKGMDSIERISQASGMH
FT                   EAVFADKKPVYLDYFSSLQQPPQISLHNDSGKQLAWVEQNDIDKNHPLYDYAGLWQMPE
FT                   FGQLSAEDGQALQYRLFKPVPFDAAKQYPVVVRVYGGPHAQLVVNSWSEADYFTQYLLQ
FT                   QGYAVFQLDNRGSAHRGTQFEHVIYQNMGDAEVNDQKVGVDYLRSLPFIDGDNIAIYGH
FT                   SYGGYMALMSQFKAPGYFKAAISGAPVTDWRLYDTHYTERYMGNPLTNKKGYDASSILP
FT                   YVKNYQSGLLMYHGMADDNVLFENSTRVYKALQDEGKLFQMMDYPGSKHSMRGEKVRNH
FT                   LYKSLAAFLDQQLK"
FT   sig_peptide     608202..608282
FT                   /locus_tag="Sfri_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.557 at
FT                   residue 27"
FT   gene            complement(610595..611311)
FT                   /locus_tag="Sfri_0533"
FT   CDS_pept        complement(610595..611311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0533"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO3988 aerobic
FT                   respiration control protein ArcA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70394"
FT                   /db_xref="GOA:Q088C1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C1"
FT                   /protein_id="ABI70394.1"
FT                   /translation="MQNPHILIVEDEAVTRNTLRSIFEAEGYVVTEANDGAEMHKAMQD
FT                   NKINLVVMDINLPGKNGLLLARELREINNIGLIFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLTRVNNAAAETEEKGSVEYYRFNGWSLEINSRSLVNPQGEAYKLPR
FT                   SEFRAMLHFVENPGKILTRADLLLKMTGRELKPHDRTVDVTIRRIRKHFESLPDTPEII
FT                   ATIHGEGYRFCGDLEA"
FT   gene            611977..612420
FT                   /locus_tag="Sfri_0534"
FT   CDS_pept        611977..612420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO3987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70395"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:Q088C0"
FT                   /protein_id="ABI70395.1"
FT                   /translation="MENVIDTLWNEYQSTHFLFTQRLSHDFPFAIVTAHNPRGSRLSPS
FT                   QNRLLDRQLQSKIQQYNRPYRALIGAAPDLSHMEKSWAIFIDKEQAIELGREFNQHAIY
FT                   YVNQGLLSLIACLDIIKPEVDMGMFNHRLRVVSEWPEIGSYTG"
FT   gene            613005..614384
FT                   /locus_tag="Sfri_0535"
FT   CDS_pept        613005..614384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0535"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: son:SO3986 aspartokinase III,
FT                   lysine-sensitive; TIGRFAM: aspartate kinase; aspartate
FT                   kinase, monofunctional class; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70396"
FT                   /db_xref="GOA:Q088B9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B9"
FT                   /protein_id="ABI70396.1"
FT                   /translation="MSFVQSEIDTPELVVAKFGGTSVADYASMSRCADIVLANQATRLV
FT                   VVSASSGVTNLLVELTQANVNDERRLVLLKQIAQIQYAILDELGRPQDVAASIDKILSR
FT                   MSVLSESLELNRSKAVMDELLSTGEQCSSILFSAVIREKGTASNHFDVRQVLRTDSHFG
FT                   RAEPQIEAISTLAGDFLQPLLARYVIVTQGFIGADEEGRTTTLGRGGSDYSAALLAEAL
FT                   RATAVEIWTDVAGIYTTDPRLAPNARPIAEISFNEAAEMATFGAKVLHPATILPAVRQK
FT                   IQVFVGSSKAPELGGTWIRHQVEDTPVFRAVALRRDQTLLNLHSLQMLHAQGFLAETFA
FT                   TLARHKISVDLITTSEVNVSLTLDKTGSDSSGQGLLSESLLQELSQHCRVRVEENLALI
FT                   AIIGNRIASTAGICSRVFKVLENHNVRMICQGASPHNLCVLVAESEAAQVVNALHQNLF
FT                   E"
FT   gene            614754..615872
FT                   /locus_tag="Sfri_0536"
FT   CDS_pept        614754..615872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0536"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: son:SO3985 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70397"
FT                   /db_xref="GOA:Q088B8"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="PDB:3LWU"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B8"
FT                   /protein_id="ABI70397.1"
FT                   /translation="MTKAIQSSVQVGELATGQALTVPIYSFMGSENSAPSVYIQANVHG
FT                   AEVQGNAVIYQLMTLLEGYQVLGDITLAPLANPLGINQKSGEFTLGRFDPITGVNWNRE
FT                   YFDHNVDIQNWYAEHQHLTNSELFCAYRSMLVETCQARLTHSFGISTGHRLAVNLQAMA
FT                   HQADIVLDLHTGPKSCKHLYCPEYDIDAARFFSIPYTLIIPNSFGGAMDEATFCPWWQL
FT                   TEYATSQGREFSVPVSAFTLELASQERIDLADALEDAKGILAYLSHRGVIAEKVNPASM
FT                   ERFGCYLKDYKKFHAPKAGLIEYCASVGEPLTAGKPLVNILRIDLYGSEQAYQAISLPM
FT                   DCVPILHFASASVLQGTELYKVMTNVFPLQPS"
FT   gene            complement(615944..617080)
FT                   /locus_tag="Sfri_0537"
FT   CDS_pept        complement(615944..617080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0537"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: son:SO0823 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70398"
FT                   /db_xref="GOA:Q088B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B7"
FT                   /protein_id="ABI70398.1"
FT                   /translation="MELLNIECLGKRLRLEGSIAGWQQLYWDNQLVSQKSASASDQAFH
FT                   IHSFELTAQTSVPTETNINNDDPVNPNIGSLPIRLEIDVNWQPFQLDYCLLIDDESITQ
FT                   GQRTVEDIERQTPEIAAVKNQKLSVVGLASLGFKLLKSAKVVKVLFAGASVAAYSWLFS
FT                   FEFALALIGCLVFHEYGHIRAMKHFGMKTKGIYLIPFVGGLALSDERINTRWQDVYISI
FT                   MGPTFGLILSIISLGLYWLTGNVFFAGLAAFNALLNLFNLLPILPLDGGHILKSISFSM
FT                   NSVVGLVACIAGAAIGVFISYSLGLALLGFLLLIGSVEIVFEWRGRHQSHLLPLDRYGQ
FT                   IFSTVWYLLTVASLVGIIWYFAASGDEMLAIPLQILGS"
FT   gene            complement(617296..617658)
FT                   /locus_tag="Sfri_0538"
FT   CDS_pept        complement(617296..617658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70399"
FT                   /db_xref="InterPro:IPR025284"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B6"
FT                   /protein_id="ABI70399.1"
FT                   /translation="MQQINWPAILQFDQDDELMYLVNYQDWLGFICANQFTVHAEDKLI
FT                   DNAGHVYSIQKHPPQDPSVAELPALVKLSQDMSVLQLLPLVRQYGQFQGHCCSAKIVFT
FT                   TIEQGIATVAELEQLY"
FT   gene            complement(617703..619370)
FT                   /locus_tag="Sfri_0539"
FT   CDS_pept        complement(617703..619370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0539"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   son:SO0826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70400"
FT                   /db_xref="GOA:Q088B5"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B5"
FT                   /protein_id="ABI70400.1"
FT                   /translation="MLEPSLVALSADKNKVELRIIPNTHGPVSAEDINALLTQAAFAML
FT                   FPITPAITKAVAEVNALCGQNPGDHELFFAIAERKDGVVNINVSDDKMQASMKITSAWG
FT                   GKDITLPDVLNTLKNQKIKMGLSKPKIMALMQRLSILPPGESCEGIIACGKAAVNGENA
FT                   ILTRKVALARERLLQPQEREDGSVDMRNLGALITVKPNDVLMVKNPSTIGTPGFNVHGD
FT                   VLQQIPGKDKPMEPGTGTSLHPKDQHKLIATVSGQPVENRNGMQVDDMLQIKDVDVRYG
FT                   HVNFKGSVLITGDVHEGMEVKASGDVTVMGFVESASIEAQGDVIVSKGVIGRLIKEHEL
FT                   STKIKATGQICAQFVQYSHLEALGNILVTKQLLHSNSTSGDTITVSDPQGRRGDLVGGI
FT                   ATAAKGIRAIAFGATAGTKTELFCAMHQGELKQELKELDDSIKGMVVAGLEIEARLRKL
FT                   PPKTEWQSDAGMIEQVKMMLDQKNQMAEERIKEEVEYTQHLNEVEGYYNNYVIKAEKHI
FT                   FTNVEIHIGAAFNRSQREHGPCIVKNVNQEVSFDYSNR"
FT   gene            complement(619548..620585)
FT                   /locus_tag="Sfri_0540"
FT   CDS_pept        complement(619548..620585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0540"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   small, N-terminal domain protein; KEGG: son:SO0828
FT                   ribosomal RNA small subunit methyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70401"
FT                   /db_xref="GOA:Q088B4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088B4"
FT                   /protein_id="ABI70401.1"
FT                   /translation="MLTNPSQALIRNSKYFQQHSVLVLNYEADTFAHQCLEFADNVTAL
FT                   ALDYNHHLTLSSCANEKLQSYFGHQLPESLADTKFDSVIIYFPKAKPLMGYLLQLAAQH
FT                   LNVDGQLIIVGENKGGIKSIAKLTPDYYSQPIKQDNARHCLVYVSYLIQAAPTLSIRDW
FT                   VSQYSLETPQGTLQICNAVGVFSEKRLDQGTDLLLSHLPDNLRGRVLDFGCGAGVITAA
FT                   LLKANPELTIECIDINAMALLSCELTLAANSMQAKVYPSDGFNQITGKFDGIISNPPFH
FT                   DGLTSTTDIATQFVQQSAIRLTSNGIWQIVANRHLPYSETIATHFGKVNVVAENNKYKL
FT                   YLHQR"
FT   gene            complement(620690..622057)
FT                   /locus_tag="Sfri_0541"
FT   CDS_pept        complement(620690..622057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0541"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: Alkaline phosphatase; KEGG: son:SO0830
FT                   alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70402"
FT                   /db_xref="GOA:Q088B3"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B3"
FT                   /protein_id="ABI70402.1"
FT                   /translation="MHFLSTYQRIISRLLLVSSLIVTGAMADEVIMPPAVANTASNNVP
FT                   TVGPSRPKNIIIMIGDGMGPAYTTAYRYYKDNPDTEEIEQTVFDRLLVGMASTYPASVS
FT                   GYVTDSAASATALSTGVKSYNGAIAVDTEKRPLTTLMEKAKALGLSTGVAVTSQVNHAT
FT                   PAAFLAHNESRSNYIDIAEAYLTSDADVILGGGQQYFTPTLLEQFSAKGYQHISEFSEL
FT                   ASVTTPKVLGLFADVQLPWAINDKQAHKLSHMTQKALDLLSQNEQGFVLLVEGSLIDWA
FT                   GHSNDIATAMGEMDEFASAIEVVEQFVRQSKDTLMVVTADHNTGGLSVGAHDKYEWHPE
FT                   VLHKVKASPDVIATRAIAEDNWQPLTATLLGFTPNEAQYSQLQSARMQGNEPLSIALRK
FT                   LIDIQSNTGWTSGGHTAMDVQVFAEGPGARLFSGHQDNIDIAIKMFSLLPQSVQTP"
FT   sig_peptide     complement(621974..622057)
FT                   /locus_tag="Sfri_0541"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            complement(622066..623019)
FT                   /locus_tag="Sfri_0542"
FT   CDS_pept        complement(622066..623019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0542"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: son:SO0831 glutathione synthase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase domain
FT                   protein; glutathione synthetase, ATP-binding; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70403"
FT                   /db_xref="GOA:Q088B2"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B2"
FT                   /protein_id="ABI70403.1"
FT                   /translation="MIKLGIVMDPISDINIKKDSSFAMLLDAQARGYQLFYMEMHDLAM
FT                   VNGKAMATMRELSVKQDADQWFTLGESVDTPLAELDVILMRKDPPFDTEFIYATYMLER
FT                   AEEEGVLIVNKPQSLRDANEKLFTAWFSEFTPETIVTRDAKRIRAFHQLKQDIILKPLD
FT                   GMGGTSIFRVKKDDPNVGVIIETLTSYGQQYAMAQAFIPEITQGDKRILVVDGEPVPYA
FT                   LARIPMKGETRGNLAAGGSGVAQPLSESDWKIARAIGPELKKRGLIFVGLDVIGDKLTE
FT                   INVTSPTCIKEIEAAFDVNITGMLMDAIEARISQQK"
FT   gene            complement(623058..623798)
FT                   /locus_tag="Sfri_0543"
FT   CDS_pept        complement(623058..623798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0543"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   son:SO0832 conserved hypothetical protein TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70404"
FT                   /db_xref="GOA:Q088B1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B1"
FT                   /protein_id="ABI70404.1"
FT                   /translation="MRVPRIFQPLDNLQQGQTLQLDEDGVAHIGRVLRMGMGDQISLFN
FT                   GDGNDYLAEIIETSKKSIAVTVLSCEANNSESPLDLHLGQVISRGDRMEFTVQKSVELG
FT                   VTTITPLFSDRCGVKLSGERLEKKLQQWQKIVISACEQSGRSIVPIVRPAMTLAQWCEE
FT                   STEALKLNLHPRASHGINGLQLSGQHHKVRLLIGPEGGLSDEEIAMTETQHFTDILLGP
FT                   RVLRTETASLTAITALQVKFGDIG"
FT   gene            complement(623849..624613)
FT                   /locus_tag="Sfri_0544"
FT   CDS_pept        complement(623849..624613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0544"
FT                   /product="Deoxyribonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /note="PFAM: Endonuclease I; KEGG: son:SO0833 endonuclease
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70405"
FT                   /db_xref="GOA:Q088B0"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:Q088B0"
FT                   /protein_id="ABI70405.1"
FT                   /translation="MFLLILGFILRLSSTHSWLFGVSLLCGIFSSTLIAAEHPSSFGKA
FT                   KKVAKKIYQQHLPLSSFYCGCDIAIAGKLWQADHASCGYQVRKQIIRANRIEWEHVVPA
FT                   WEFGHQLQCWQDGGRKNCGKNNKQFKKMEADLHNLVPAVGEVNGDRSNFRFSDWGGKAD
FT                   QYGQCEMIVDFKGRKAQPPKRARGPIARTYLYMQKIYGLQISSSQQKLFNAWDKMQPVT
FT                   ATECKRDTLIAANQGNHNDFVFKQCQNNGLVR"
FT   sig_peptide     complement(624506..624613)
FT                   /locus_tag="Sfri_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.976 at
FT                   residue 36"
FT   gene            complement(624707..625318)
FT                   /locus_tag="Sfri_0545"
FT   CDS_pept        complement(624707..625318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0545"
FT                   /product="protein of unknown function DUF335, SprT"
FT                   /note="PFAM: protein of unknown function DUF335, SprT;
FT                   SMART: protein of unknown function SprT; KEGG: son:SO0834
FT                   sprT protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70406"
FT                   /db_xref="GOA:Q088A9"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A9"
FT                   /protein_id="ABI70406.1"
FT                   /translation="MFKNIFNLTQRAHQTLTQDVHEKGSSLSTGPRPHQTQNTTVSNPL
FT                   QLQILAKVEADYLLAEQHFKRQFPRPSVHFSLRGKSAGTAHLQTNKLRFNPVLLAENHD
FT                   IFINEVVPHEISHLLCFHLFGKVKPHGKEWQSVMLTTFKITPKTTHQLNTQSVSGQQFE
FT                   YFCGCGSINLTIRRHNRIVRGQTQYRCRHCQQTLTSFNPK"
FT   gene            complement(625401..626585)
FT                   /locus_tag="Sfri_0546"
FT   CDS_pept        complement(625401..626585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70407"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A8"
FT                   /protein_id="ABI70407.1"
FT                   /translation="MIKHSAFIMLSSLALVTLSTAVNAGPLSKDVEEMRVSKAGQTMPN
FT                   VVNRYQAISDTVEVKLAQSTDELAVTEMAAHQGHRLWQQAVRDVQSGHSDDRSLYWSRL
FT                   SMRNVLKQEKAGFNVADWQRDILVKAVEKSSRGFSDIEFSPDTQINILVTGFDPFFLDR
FT                   NIGQSNPSGLAALALDGYRFDVNGKKAQIETVMIPVRYADFDNGIIESLLTPFYRDNSV
FT                   DMVFTISMGRENFDIERFPGRNRSAEAPDNLNVLTGASQRNPKAPLFNNGTSTDGKLNG
FT                   PEFVQFSLPIEAMAAVKGHWSVNDNNQISTLSRGQFKASSLAELQNEISVEGSGGGYLS
FT                   NEISYRSILLRDQFNLNLPVGHIHTPRIKGYDSQVESDIVEQIRAMIAAAASTL"
FT   sig_peptide     complement(626511..626585)
FT                   /locus_tag="Sfri_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            complement(626923..627834)
FT                   /locus_tag="Sfri_0547"
FT   CDS_pept        complement(626923..627834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0547"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0839 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70408"
FT                   /db_xref="GOA:Q088A7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A7"
FT                   /protein_id="ABI70408.1"
FT                   /translation="MPDLNGMMLFAAVVRAKGFSQAAREIGQPKSTISRKVAQLEEQLG
FT                   VRLLQRDTRNLSLTQVGALFFQHCDSISHEIEAAKATIENTHNDISGALRIAIPVSFSQ
FT                   DVIGHLCSSFMRLYPNIELDIQFTDNDVGLVGEGYDIAIKYGPLQSSDLVARLLFERQP
FT                   ILVASPGYIKKFSSPATPQELTQHNGILLGTTLSAPIWALGKGNRKIMATFKRKVRVNS
FT                   ASMVKRLALDDYGIAMLSNTSCKQELATGSLVPILQEWPMEPFKVYGVYSSRRQLASNI
FT                   SAFLDFFTKRYTSQESLHSMMS"
FT   gene            627964..632517
FT                   /locus_tag="Sfri_0548"
FT   CDS_pept        627964..632517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0548"
FT                   /product="Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   son:SO0840 acetyl-CoA carboxylase multifunctional enzyme
FT                   accADC, carboxyl transferase subunit alpha/carboxyl
FT                   transferase subunit beta/biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70409"
FT                   /db_xref="GOA:Q088A6"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A6"
FT                   /protein_id="ABI70409.1"
FT                   /translation="MTSKKQPANKTQALSADPLFLQAEHLAKDFSLFPAHNKQSLSEEV
FT                   KGLLTEDSIQSNLKSLASLDVDGYVNKVIQPTLDKNRPGAKRMIADLKGKIIAESHIGP
FT                   FYRAEVELNFGTRTRRIGFIAQERTTANGAWMPEHHLAACKAIRHFAELSMPIVYLIDT
FT                   PGADAGEIANSQNQAHTISKAIAESANVDVPTVGIVIGAGYSGGAIPLAAANILLSVRD
FT                   GIFNTIQPQGLQSIARKYNLSWQECAKSVGVSPEELYTAGCIDGIIDFTPSDKDERQHN
FT                   FRRAIISSIEAVERAAMNFVRESTDLREHYDRSLQRYLAPSANLLTLENNTRLSVANNP
FT                   TMYHNIFGSAYRYLRYLTLRSRIHSISQEQYGRLSKVSVPEGDLLARIKQEQERVFQAW
FT                   LTNPDKLVYDEELNKLWGTFSAKRKDISAERNVITRFILGEPKENYKKARKALLFNIGW
FT                   SLYHRWKSNAANNFNGLIKHLESLPKSTTQAPWPELSQLTVLDIVVNDELRADFIWQCH
FT                   NVLIFNALYDNVVGSLASISKEAMMSKSLSRESVDKLLHKSIDNALSTSDKANDKSKFY
FT                   KWLKYFMDQSNRAELLTRVEQWKSVGFPQLNDSLFVILTYFFERLLPEYFDSEDEHDKY
FT                   TGTINPVRIGRRKDFWNRLTMGYQDLLIQKILREEKKQGKMGWENIIKQFFTKFDEIDA
FT                   DKMSANMLNFPGFRLSIEDAIDKKIRPCGLITGLADFNNNGSKLRVGVAVSNTAFQAGA
FT                   FDMASAEKFSSLLIECAKRKLPVICFISSGGMQTKEGAAALFSMAVVNDRITRFIRDNE
FT                   LPVLMFGFGDCTGGAQASFVTHPLVQTYYLSGTNMPFAGQMVVPAYLPSTATLSNYLSK
FT                   VPGAMTGLVHNPFSDTLDTQLSGIDPLMPLPTINIEEVISKALSTLVPEVIELEDVIVQ
FT                   DDPRALMKPINKVLVHARGCTAVKLIRKAHDNNINVVLVASDPDMTSVPADMLKDTDKL
FT                   VCIGGNTSDESYLNAYSVLKVAEYENVDALHPGIGFLSESPQFAALCVNNGVNFVGPSV
FT                   HSMTTMGNKSNAIHTSQKQNVPVVPGSHGILTNAEQAVNVASEIGYPVLLKAVQGGGGK
FT                   GIQVVKRPEDMIGFFQKTATEAAAAFGNGDLYLEKYVTSLRHIEVQLLRDKFGNTKVLG
FT                   IRDCSVQRNNQKVIEESGSTMLPEELKQRVMEYTRALGDATDYMGAGTVEFIYNLDANE
FT                   VYFMEMNTRLQVEHPVTEATSGIDIVSAQFDIAAGRSIENLEPVDQGYAMEVRVTAEKA
FT                   ALDSHGILQLIPNPGKITECVLPQRDDVEIISIAAAGKEVSPYYDSLIAQIIIRGTDRA
FT                   DVVSKMYAYLDSVVIKGIATNIPLLKLILKDPTFNEGVYDTNYLPRLMAELDIPALIAE
FT                   MEAAAEALEVDTESLRVGESNELKVLAQGAGIFYTSPAPGEADFVKEGDIVTVEQTLAL
FT                   MEAMKMFSQLTLAGFNRQTGVLYPEDQKYRIERILNSNGQQVSQGDLLFVILPIEA"
FT   gene            632671..634137
FT                   /locus_tag="Sfri_0549"
FT   CDS_pept        632671..634137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0549"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: son:SO0841 GGDEF domain protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70410"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A5"
FT                   /protein_id="ABI70410.1"
FT                   /translation="MRTLSRLEFSSVLLITLLIFITLINAKHASASVVETQSFINLKNR
FT                   NIIRYCVDPDWLPYEAIVDGRHTGISSDYLALLANYTDLTFVLMPTSSWRQSLELLKQG
FT                   ECELTPILNQTPKRDAYLSFSDIFFKSPNVLVSLKSQPFLQGFENIGDRLLAIPKDYRL
FT                   VEYIQQFYPTINTVLTKNERQGLEKVANGEADVFVGSMFSVNAYIQQHGLTSLKIAGWG
FT                   GPEDELRIGVIHAKQDLLSQINAGLAKITQADHISVYKKWHNITVVEDIDYSLVVQVVT
FT                   ALGMFILFLLYRTMCVSKYNVHLETSNKQLQKLQLELEKKNCDLDFLAQHDPLTKLYNR
FT                   QYFNQTFLDDARQPQKKMRQNNMSLIIIDIDFFKAINDKHGHTIGDKILVQVAQVLQAS
FT                   VRELDVVARWGGEEFVVVCQHVALHDATELCQRITDELSHFHFYHNIKVTCSFGIALLG
FT                   ENEPIQACFERADAALYKAKQSGRNQYCSA"
FT   sig_peptide     632671..632751
FT                   /locus_tag="Sfri_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.486 at
FT                   residue 27"
FT   gene            634530..636623
FT                   /locus_tag="Sfri_0550"
FT   CDS_pept        634530..636623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0550"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: son:SO0842 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70411"
FT                   /db_xref="GOA:Q088A4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q088A4"
FT                   /protein_id="ABI70411.1"
FT                   /translation="MTELSKYRNIGIFAHVDAGKTTTTERILKLTGKIHKIGEVHDGES
FT                   TTDFMEQEAERGITIQSAAVSCFWKDHRFNVIDTPGHVDFTVEVYRSLKVLDGGIGVFC
FT                   GSGGVEPQSETNWRYANDSEVARIIFVNKLDRMGADFLRVVKQTKDVLAANPLVMVLPI
FT                   GIEDEFCGVVDLLTREAHIWDDSGLPENFEIKPVPADMVDIVEEYREMLIETALEQDDA
FT                   LLEAYMEGVQPSIEDVKRCIRAGTRTMAVFPTYCGSAFKNKGMQLLLDAVVDYLPDPVE
FT                   VDPQPLTDEEGNENGEFAIVDVDAPFKALAFKIMDDRFGALTFVRIYSGRLKKGDTILN
FT                   SFTGKTERIGRMVEMQANERNELESAQAGDIIAIVGMKNVQTGHTLCDPKHPCTLEAMV
FT                   FPEPVISISVTPKDKGGSEKMGIAIGKMIAEDPSFRVETDIDSGETILKGMGELHLDIK
FT                   VDILKRTYGVDLIVGEPQVAYRETITKEIEDSYTHKKQSGGSGQFGKIDYTIRPGEQNT
FT                   GFTFTSKVVGGNVPKEFWPAVEKGFKSMMNTGTIAGFPVLDVELVLQDGAFHAVDSSAI
FT                   AFEIAAKGAFRQSMPKAGAQLLEPIMNVDVFSPDDNVGDVIGDLNRRRGMIKDQNAGVT
FT                   GVRIKADVPLSEMFGYIGSLRTMTSGRGQFSMEFAHYSPCPNSVSEKVVAQVKERKAAE
FT                   AKK"
FT   gene            complement(636730..637614)
FT                   /locus_tag="Sfri_0551"
FT   CDS_pept        complement(636730..637614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0551"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0843 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70412"
FT                   /db_xref="GOA:Q088A3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A3"
FT                   /protein_id="ABI70412.1"
FT                   /translation="MNIPIKTLQIFLTIVETKNFTRAAQKCFMTQPTLTKTIQRLEDNM
FT                   GEQLLIRNNQTVELTQAGQLFEQSAREILGHWHRLQEGINNLSGLKSGRLRLGVCPMMS
FT                   SLITPLLTDYRQKYPGIELQMYEYGGFGCEQALLSNSLDIAFTALPTTHKTELASQPLT
FT                   KYPLLACLPEGHPLADNADIRWQDFESYPFILYNEDFSLAKLINYLSRKVGVHLNIAFR
FT                   TGQWDFLAAMVEANLGVAILPEPICQRLTNSKLVFKPMQPAMTWDLALIWRENLPLTPP
FT                   AQALLTLSRNSHE"
FT   gene            complement(638003..638434)
FT                   /locus_tag="Sfri_0552"
FT   CDS_pept        complement(638003..638434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0552"
FT                   /product="periplasmic nitrate reductase subunit NapB"
FT                   /note="KEGG: son:SO0845 cytochrome c-type protein NapB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70413"
FT                   /db_xref="GOA:Q088A2"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A2"
FT                   /protein_id="ABI70413.1"
FT                   /translation="MKKLLSVAAILLSLSAYSGQQAVADNTPVKVESRVGNVAITDNSP
FT                   ADAIATYPTRGKAIARSFAEQPPLIPHKDSYSITTDKNGCLTCHSWDKAKRMKATPVAK
FT                   SHVVDDKGTVNGMNYFCVQCHVAQADNKQELVENTFTTK"
FT   sig_peptide     complement(638360..638434)
FT                   /locus_tag="Sfri_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.734 at
FT                   residue 25"
FT   gene            complement(638536..641019)
FT                   /locus_tag="Sfri_0553"
FT   CDS_pept        complement(638536..641019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0553"
FT                   /product="periplasmic nitrate reductase subunit NapA
FT                   apoprotein"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   periplasmic nitrate reductase, large subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: son:SO0848 periplasmic nitrate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70414"
FT                   /db_xref="GOA:Q088A1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A1"
FT                   /protein_id="ABI70414.1"
FT                   /translation="MSISRREFLKANAAAAAASAVGIAIPINIVQAAEGKSEIKWDKAP
FT                   CRFCGVGCSVLVGTQNGKIVATQGDPESPVNKGLNCIKGYFLSKIMYGKDRLTSPLLRM
FT                   KDGKYDKEGDFTPVSWDVAFDTMAEKWKASIAKKGPTSVGMFGSGQWTIWEGYAASKLH
FT                   KAGFLTNNIDPNARHCMASAVGGFMRTFGIDEPMGCYDDLEAADHFVLWGANMAEMHPI
FT                   LWARLTDRRLSHKDARVHVLSTYENRSFDLADNAMVFKPQTDLVILNYIANYIIQNKAV
FT                   NKDFVSKHTKFALGTTDIGYGLRPEHPLEKKAKNPGSGDAKPISFDEYAKFVSTYTVEY
FT                   AAKMSGVPAEKLEIMAKAYADPNIKVMSLWTMGINQHTRGVWANNMLYNIHLLTGKIAT
FT                   PGNSPFSLTGQPSACGTAREVGTFSHRLPADMVVNNDKHREITEKLWQVPAGTIPAKPG
FT                   YHAVLQSRMLKDGKLNCYWTMCTNNMQAGPNINDEVYPGFRNPENFIVVSDPYPTITAM
FT                   AADLILPTAMWVEKEGSYGNAERRTHFWHQLVPTPEGSKSDLWQLVEFSKRFKVSEVWP
FT                   AELIAKQPELADKTLYEVLFANGVINKFPTSDCKGAYNDENEHFGFYLQKGIFEEYAQF
FT                   GRGHAHDLADFDTYHQTRGLRWPVVNGKETTRRFVEGSDPYVKAGEGFNFYGKPDGKAV
FT                   IFALPYEPAAEEPNEEFDLWMSTGRVLEHWHTGSMTARVPELHKAMPSAQVFMHPADAK
FT                   ARGLVQGDEVTVASPRGEINTRVETKGRNKPPRGVVFMPFFDAKQLVNKLLLDATDPLS
FT                   KETDFKKCPVKIFKA"
FT   sig_peptide     complement(640921..641019)
FT                   /locus_tag="Sfri_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            complement(641432..642619)
FT                   /locus_tag="Sfri_0554"
FT   CDS_pept        complement(641432..642619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70415"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:Q088A0"
FT                   /protein_id="ABI70415.1"
FT                   /translation="MISVTFKGIYSIAFKFVLHTKFTTRQTQWMLLLALPLCAMLTACS
FT                   PAQDSVTKESTISSMSSASAEGYSEVTQGKTLHFPQDHLAHDDFKIEWWYLTANLTTAA
FT                   GEDVGVQWTQFRIGMTPPQKSTVATNDWETNQLYMAHAAVTTSNEHLLAEKWSRGHPQL
FT                   AGVKSQPFEVHLQNWQWLGQSDSLFPATLNVASDQFSYQLQLNSQQPLQLQGDKGYSSK
FT                   SADQSVASYYYSQPFIDVTGQITRHGVTELVSGKAWLDREWSSQFLTKAQQGWDWFSLR
FT                   LDDNSTLMAFRLRGENDQAHFYSARRMFTDGSGHNINSRDNPGDIDMQPTQWQQTALGN
FT                   HPIAWRIKINSEAIDVTTQAVNPNSDMPVSTSYWEGPITIKGSHQGQGYMELTGY"
FT   sig_peptide     complement(642488..642619)
FT                   /locus_tag="Sfri_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.451 at
FT                   residue 44"
FT   gene            complement(642616..645213)
FT                   /locus_tag="Sfri_0555"
FT   CDS_pept        complement(642616..645213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0555"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   son:SO0856 putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70416"
FT                   /db_xref="GOA:Q087Z9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z9"
FT                   /protein_id="ABI70416.1"
FT                   /translation="MMTHSSSYLSSIKRLRLCLQLFASHYRHAPLQASAILLGIMLAVT
FT                   LLIGVYATNENAKQSYGNVSELMSQQARLSISHRTEDSIDESVYFALANAGFNTIASIE
FT                   GIATDEQGRLWRVNSSDVVAAITSSMQLQQSGTSSSITATHIPLAELLAGKPKVLMSTS
FT                   QRERMSKVTNNTDRIILNGMPVEFVAIDDSWGLGSAILADISLAQPMLNMQGKLSYIAV
FT                   FDSPSADTNISDANESETDAQLIARLTHTLTQAGIVPTKLNFTTQTSEGESLTALTASF
FT                   HLNLDAMSMLAFVVGLFIAYNGVRYSLMKRQKLLVQIMQQGLDRRTIMLALSIEIICLV
FT                   FIGCVLGFIVGLQLSQWLQPMVAMTLEQLYGAKLLPGNWQWQWFAQALVLTLSAAFAAC
FT                   IPMLINLINTPLAQGAQKQPQSRQLSIIHWRQFIIAALLLLVCTIAFAFTEQYRHSLIL
FT                   LGVLSVAIPLLLPQCLHWAVNLLSPFMPKGLWHYVIAETKEIIAPLALAMMAMLLALCA
FT                   NIAMNTLVGSFEITLKKWLDARLHADLYIRPNPNQIDTLTLLLKQDPKVEAIYEQWTVD
FT                   SHLNRAETPQTQVPIHLVSRDHLSLTETTVFKTTADDFWTTFTAGESLMISEPLSIKYQ
FT                   LDIGDKVQLSQLDQHIMTIGGIYYDYGNPQGEAIITQSLWQQSQLPAKPISLAVSYQGD
FT                   ITPLQNSISQQLNLSSAYMYSQQRIKTEAINMFNKTFSITVVLNSLTLLVAAIGLFSAC
FT                   IMLTQARQAPLARLYALGVSRNQLRMMVLVQMLFIVFLTCFLALPTGALLGYLLIHKVT
FT                   LQAFGWSIAMVWDWAAYAQVVIIAVVSCLLAVCLPLYWQTRKPLISSLQQEAL"
FT   gene            complement(645218..645922)
FT                   /locus_tag="Sfri_0556"
FT   CDS_pept        complement(645218..645922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0556"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: son:SO0857 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70417"
FT                   /db_xref="GOA:Q087Z8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z8"
FT                   /protein_id="ABI70417.1"
FT                   /translation="MTTIVTLENMSKGFRDGESFHSVLNNVSLTLQQGQTIALTGPSGS
FT                   GKSTLLNIIGGFETIDSGDMLIRQTGNMHSVTKWQDKQWSHYRRQSLGVIFQQFNLLTP
FT                   LNVRDNIQFSLALNQLAWSPWCDELCHQLGLTPLLARNVENLSGGQQQRVAIARALAHK
FT                   PQLILADEPTGNLDQHAGLQVMKLLTELAQQANCCILMVTHSEQCAAFMQHRWHVENQQ
FT                   IVINPADMTLQG"
FT   gene            complement(646068..647030)
FT                   /locus_tag="Sfri_0557"
FT   CDS_pept        complement(646068..647030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0557"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); KEGG: son:SO0861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70418"
FT                   /db_xref="GOA:Q087Z7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z7"
FT                   /protein_id="ABI70418.1"
FT                   /translation="MTISVNQPDWDFIATSPELMLSSLTHMGLIEITGEQGRSFIHGQV
FT                   TTDITSLGTNEWKWGAHCDPKGKMLASFRTFSIGDSLFMLLPKSTLSLDLPQLQKYAVF
FT                   SKAELADVSNNYQIIGIAGSQAQAFATENFGDVSQAINLVEQGVIIRDGERFIAIINNA
FT                   AAETIISQSGQTLIDASAWQALEIKAGYPNIDAAHSGQYVAQMCNLQAINGISFTKGCY
FT                   MGQETIARMKYRGGNKRALYIISGTTKQTISTDTQLEIALEDGFRRGGNIIECVQYGDK
FT                   VLLTAVLPNDTENTAQLRIAGDESSQLSIIELPYSLADA"
FT   gene            complement(647203..648432)
FT                   /locus_tag="Sfri_0558"
FT   CDS_pept        complement(647203..648432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0558"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   region; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding; KEGG: son:SO0862 D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70419"
FT                   /db_xref="GOA:Q087Z6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z6"
FT                   /protein_id="ABI70419.1"
FT                   /translation="MAKHSLDKDKIKILLLEGVHQTAVDVLERAGYTNIEYHKASLGEE
FT                   ALLASIKDAHFVGLRSRTQLTAEVLHHAEKLVAIGCFCIGTNQVDLASAEKLGIPVFNA
FT                   PFSNTRSVAELVIGEIIMLMRGIPQRNAMSHRGGWLKSANGSVEVRGKTLGVIGYGHIG
FT                   TQLGILAETLGMRVIFFDIEDKLPLGNASQVHSMDKLLAQADVVSLHVPETPQTKDMFA
FT                   KAEFAQMRQGSFFINASRGTVVDIEDLANALKSEHLAGAAIDVFPVEPKSNDDEFISPL
FT                   RGLDNVLLTPHIGGSTAEAQENIGVEVAGKLVKYSDNGSTLSAVNFPEVSLAQHSGTSR
FT                   LLHIHQNRPGVLIKINQAFSEKGINIAAQYLQTTAEIGYVVMEVDSDQAEEALVELKSI
FT                   EGTIRARVLF"
FT   gene            648625..649248
FT                   /locus_tag="Sfri_0559"
FT   CDS_pept        648625..649248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70420"
FT                   /db_xref="GOA:Q087Z5"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z5"
FT                   /protein_id="ABI70420.1"
FT                   /translation="MKNKVIWIGIYLLVLLWSVSAPKDMFTWWLEAIPALIALPILFFS
FT                   RKSFPLTTLAYALILVHCCVLFVGARYTYAEVPLFDWLAQVMGSERNNYDKVGHFAQGF
FT                   IPVILAREIFIRKQVMQIGAWCQFLAVCFVLAFSAFYELVEWWVAIATGENAEAFLGTQ
FT                   GYVWDTQSDMFLALIGGVCGLLLLSSLHNKQIATKMALNQPSAS"
FT   gene            649717..650385
FT                   /locus_tag="Sfri_0560"
FT   CDS_pept        649717..650385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0560"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: son:SO0864
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70421"
FT                   /db_xref="GOA:Q087Z4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z4"
FT                   /protein_id="ABI70421.1"
FT                   /translation="MSSNIDELVFLHQIAAPCHLAILAESIGLKTRIVKHAAELELEKK
FT                   SNNFYLVSQKGAALDSKGIPLLVSRLVEHVPVALYQVERGSLDQESALLLGVRGLLYSD
FT                   QRMDLMLTGLRKMVSDELWYDRPLISKIFRRLVQQLDTSAEIPADTVAILQRLTSRERT
FT                   IIQLVSSGARNKEIAQRLCISEHTVKAHISSIFRKTESRNRVELLRWAQTYQSHCELVS
FT                   "
FT   gene            650531..650968
FT                   /locus_tag="Sfri_0561"
FT   CDS_pept        650531..650968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0561"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: son:SO1068
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70422"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z3"
FT                   /protein_id="ABI70422.1"
FT                   /translation="MSIWFNTVTLEDCARLDAGMHGKGTLMQTLGIKITEIGDDYMVAT
FT                   MPANPAVHNPLGIVHGGANVALAETVASYAANFVVDFTRYYCVGQEINANHLKASRNGE
FT                   LTATAKPVHLGKRSSVWEVLIRNSAGELCCISRMTAAVVER"
FT   gene            651194..651436
FT                   /locus_tag="Sfri_0562"
FT   CDS_pept        651194..651436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70423"
FT                   /db_xref="GOA:Q087Z2"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z2"
FT                   /protein_id="ABI70423.1"
FT                   /translation="MDSINIWEWVGYLASVVVAISLMMSDIKKLRWWNLIGAGLFVAYG
FT                   LAIDAIPVALVNFFIVLIDAYYLVKLYRDPPPPTE"
FT   gene            651700..653160
FT                   /locus_tag="Sfri_0563"
FT   CDS_pept        651700..653160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0563"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: son:SO1070
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70424"
FT                   /db_xref="GOA:Q087Z1"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z1"
FT                   /protein_id="ABI70424.1"
FT                   /translation="MNQTNYLTSQNGAPVADDQNSMSAGERGPLLLQDWHLIEKLAHFN
FT                   RERIPERVVHAKGTGVYGTFTLTKDLSEFTIADHFNGVGKQTETFMRFSTVGGEMGSAD
FT                   AERDPRGFGLRFYTARGNHDIVGNNTPTFFIRDGIKFPDFIHTQKRHPQTNLKDPQAMW
FT                   DFWALNPESMHQVTILMSDRGIPANYRQMHGYGSHTFSFWNAQGERFWVKFHFKSQQGV
FT                   VNLTGEQADILKGIDPDSSQRDMVAAINDANFPRWTVNVQIMPEADANTYAINPFDLTK
FT                   VWPHSDYPLIEVGELELNRLPQNYFAEVEQVALAPSNLVPGVGASPDKMLQARLFSYAD
FT                   AQRYRIGTNYNQLPVNCPHAAKANHHQRAGAMAGAQCSYQGSQTGGDASVNYGPNSVAP
FT                   LTENASFAEPPLRLAGEVARFSRYNQDDFTQAGNLYRIFSEAEKNRLVETIAGTLSQTT
FT                   LDVQQKMVDHFTKADVDYGRRVKQALAK"
FT   gene            complement(653315..654799)
FT                   /locus_tag="Sfri_0564"
FT   CDS_pept        complement(653315..654799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0564"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: son:SO3769
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70425"
FT                   /db_xref="GOA:Q087Z0"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Z0"
FT                   /protein_id="ABI70425.1"
FT                   /translation="MDAEIELKLFIQPQHHDLLKKILNEYPNSTPQGQKKLTNGYFDTD
FT                   DLQLRRWDMGLRVRGFDNQLEQTIKTAGRVVGGIHSRPEYNVNIDQKTPILSRFPKEIW
FT                   PIGNDLDKVSTSLTCIFETNFERQTWHIYLNDSLVEVALDVGEIIANDKVDPICELEFE
FT                   LLAGDTSALVTLAIEVAKSVPFRLGKASKAQRGYQLAGKSKPFTIEHIDYVSLPKNNNM
FT                   QQVLSTLLETGLERWQLIENILTLPTSDVHQQSALWGELRHCVRLLRLTLNQFGLLDQR
FT                   TSPLFDHLEQALAFVSPLQSCCLLLQDDAKPLANINNKTLVCQQLENHISLMSVSTQLA
FT                   SIWQQPEYGQLQLALVDLLLTAESGKNQGRHYPELGLFANQLQQASWKRIGKSMPITAE
FT                   MNSIDYQHVADALDESILVGFAYGEMYPAKKREAFRAPWQDLALGISTLSAYKILRHLS
FT                   AQHQLNIEAWLDNKETSLLFAMEHSRKSALKVPIYW"
FT   gene            655036..655716
FT                   /locus_tag="Sfri_0565"
FT   CDS_pept        655036..655716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0565"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   son:SO3770 conserved hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70426"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y9"
FT                   /protein_id="ABI70426.1"
FT                   /translation="MPVNSILGVFAKSPLKPLELHIDKVHECASLLVPFFDATNSGDWD
FT                   EAIKIRKQISLLEKEADSLKREIRLTLPGGLFMPVERTDLLELLTQQDKIANKAKDISG
FT                   RIIGRQLVLPQPMQDAFGAYLKRCLDAVSLAKRAINELDDLLETGFRGREVELVAKMIT
FT                   ELDLIEEDSDDLQIQVRRQLYALESELNPIDVMFTYKIIEWVGGLADIAERVGSRLELM
FT                   LARN"
FT   gene            655742..657010
FT                   /locus_tag="Sfri_0566"
FT   CDS_pept        655742..657010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0566"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: son:SO3771
FT                   phosphate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70427"
FT                   /db_xref="GOA:Q087Y8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y8"
FT                   /protein_id="ABI70427.1"
FT                   /translation="MVDVLVTNGPMLIMIAAAFGFLMAWGIGANDVANAMGTSVGSNAI
FT                   TIKQAIIIAMIFEFAGAFLAGGEVTSTIRKGIIDASYFTDVPELLVYGMIASLLAAGIW
FT                   LVVASALGWPVSTTHSIIGAIVGFAAVGVSADSVEWGKVGGIVGSWVVTPAISGFIAYI
FT                   IFQSVQKLIFNTDDPLTSAKRYVPFYMALAGFVMSLVTITKGLSHVGINFSTVEAYALA
FT                   IVVAAVVGLAGKIAISRLKMSDKADLKTQYGNVEKVFAILMVVTACCMAFAHGSNDVAN
FT                   AIGPLAAVVSVVESGGVIGAKAVLAWWILPLGAVGIVLGLAIFGQRVMQTIGKNITHLT
FT                   PSRGFAAELAAASTVVIASGTGLPISTTQTLVGAVLGVGMARGIAAINIGVVRNIVVSW
FT                   VITLPAGAALSILFFFIIKSIFS"
FT   gene            657151..657732
FT                   /locus_tag="Sfri_0567"
FT   CDS_pept        657151..657732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0567"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; SMART: SH3 domain
FT                   protein domain protein; KEGG: son:SO3772 SH3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70428"
FT                   /db_xref="GOA:Q087Y7"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y7"
FT                   /protein_id="ABI70428.1"
FT                   /translation="MLRVLSILIFLLAPSGVFAAQAPTRFISDDVFTYIHGGPGTEFRI
FT                   IGSVEAGQPVTLLDNTEGDFTQIIDHKGREGWVLTSLVSDQPSFRERFPEMEAQLKQAN
FT                   EQLNNITQNTDNTEESLTLSNEKVAELRAALTKAIKERDDAKSKVQQAADNQRYEMWQQ
FT                   GGLIAGIGALIGIVLVYLPRPQRRKKSRWM"
FT   sig_peptide     657151..657210
FT                   /locus_tag="Sfri_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            658135..661329
FT                   /locus_tag="Sfri_0568"
FT   CDS_pept        658135..661329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0568"
FT                   /product="L-proline dehydrogenase /
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /EC_number="1.5.5.2"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: aldehyde dehydrogenase; Proline
FT                   dehydrogenase; KEGG: son:SO3774 proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70429"
FT                   /db_xref="GOA:Q087Y6"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y6"
FT                   /protein_id="ABI70429.1"
FT                   /translation="MEANTMFKASEVLDGRYDNATLEELFTAVTNNYIVDEEQYLSELI
FT                   KLVPSSEQDIEQVTRRAHELVSKVRQFEKKGLMVGIDAFLQQYSLETKEGIILMCLAEA
FT                   LLRIPDAATADALIQDKLSGAKWDEHLNKSESLLVNASTWGLMLTGKLVKLDRNTDGSP
FT                   SHILKRLVNRVGEPMIRQAMLAAMKIMGKQFVLGEDVKEALKNSEAKRKLGYTHSYDML
FT                   GEAALTANDAQKYFNDYSNAIRDLGEQQYDEANSPRPTISIKLSALHPRYEVANEDRVL
FT                   SELYDTVIKLIVQARELNIGISIDAEEVDRLELSLKLFKQLYQSEAAKGWGLLGIVVQA
FT                   YSKRCLPVLCWLTRLAKDQGDEIPLRLVKGAYWDSELKWAQQAGERGYPLYTRKAGTDV
FT                   SYLACARYLLSEATRGAIYPQFATHNAQTVASIDAMAGNRIYEFQRLHGMGQELYDTML
FT                   AESGAKAVRIYAPIGAHKDLLPYLVRRLLENGANTSFVHKLVDPNTPIESLVVHPLVTL
FT                   LGYKSLANQKIVKPADIFGAERKNSKGLNMNIISESEPFFAALDKYSDTQWTAGPLVNG
FT                   KTLTGEVQTVVSPYDTSLTVGTVAFADANAIEQAIAGADAAFGSWVRTPVETRANALQK
FT                   LADLLEENREELIVLCTREAGKSIQDGIDEVREAVDFCRYYAVQAKKMMAQPELLPGPT
FT                   GELNELFLQGRGIFVCISPWNFPLAIFLGQVSAALAAGNTVIAKPAEQTCLIGYRAVQL
FT                   AHEAGIPTDVLQFLPGTGAVVGSAITADERIGGVCFTGSTGTAKLINRTLANRDGAIIP
FT                   LIAETGGQNAMVVDSTSQPEQVVNDVVSSSFTSAGQRCSALRVLFLQEDIADRVIEVMK
FT                   GAMEQLVIGNPSSVKTDVGPVIDATAKANLNAHIDHISQVGKLINKLELPAGTENGHFV
FT                   APTAVEISSIKLLEKEHFGPILHVIRYKAADLAKVVDEINSTGFGLTLGIHSRNEGHAL
FT                   SLADKVNVGNVYINRNQIGAVVGVQPFGGQGLSGTGPKAGGPHYLTRFVTEKTRTNNIT
FT                   AIGGNATLLSLGDAEE"
FT   gene            complement(661394..661678)
FT                   /locus_tag="Sfri_0569"
FT   CDS_pept        complement(661394..661678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70430"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y5"
FT                   /protein_id="ABI70430.1"
FT                   /translation="MERKPDRVSAMKQLLDQVKTSLPLDQPGIFSCGPTNNCVGCPKKL
FT                   LDLVDAEMNYWDAAIAQGVIPSFGDISRFGKLCRNVSRGLQRNDIQGHH"
FT   gene            662046..663389
FT                   /locus_tag="Sfri_0570"
FT   CDS_pept        662046..663389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0570"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; KEGG: son:SO1087
FT                   Na+/H+ antiporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70431"
FT                   /db_xref="GOA:Q087Y4"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y4"
FT                   /protein_id="ABI70431.1"
FT                   /translation="MTKATSSVTTAGNSPASFVALLPLFLFLGLFIGAGLYFQSQGVDY
FT                   AFYQLPSVIAILPAIVLAVLLSKQKINSAIETFIEGIGHSNIIAMCLIYLLAGAFAAVA
FT                   KATGGVDATVALGLSFIPSNLLLPGFFVIAAFIATSMGTSMGTIAAVAPVALGVADQAQ
FT                   IDYALMAGAVMSGALFGDNLSIISDTTIAATRTQGCEMKDKFRENLVFAIPASLLTLIA
FT                   FSIVGQGQADIAAQDIEILKVLPYLTILVLAVVGLNVFVVLSLGIVLAGMTGVLTSEYS
FT                   VIQFGNDIYTGFTNMQEIFILSMLVGGLAALMQQQGGLTFVSKQIEGLISRFSKANGEA
FT                   SSRAAELGMAAIVAATNTCVANNTVSIVVTGDIAKELAEKHGVSPKRAASILDIFACII
FT                   QGLIPHGAQALLIASVFTISPLTAVSNAWYCMILAVIAVIIVIFRKRT"
FT   sig_peptide     662046..662105
FT                   /locus_tag="Sfri_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.806) with cleavage site probability 0.492 at
FT                   residue 20"
FT   gene            663678..664322
FT                   /locus_tag="Sfri_0571"
FT   CDS_pept        663678..664322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO1086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70432"
FT                   /db_xref="GOA:Q087Y3"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y3"
FT                   /protein_id="ABI70432.1"
FT                   /translation="MSLAAAAICSFGVGSALIVQADGISLDMLMIRPDTLGNYMHSSFA
FT                   IVFNLSLLAGGSCFLLAMVAVFNTFPDLLSRYIAIIGGVVGVSIVLMGVFPINFLDLHR
FT                   KASTLYLFSTIFLHCICLLDYFKPGSTMTKRMLSLSIISICSGLLLLTLFDWSQLDFAE
FT                   CSADLPQYCIVSSAMWTLTQANILWCICLGLSLLSTIKTQQHNVYQFLETR"
FT   sig_peptide     663678..663743
FT                   /locus_tag="Sfri_0571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            664353..665069
FT                   /locus_tag="Sfri_0572"
FT   CDS_pept        664353..665069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0572"
FT                   /product="Pseudouridine synthase, Rsu"
FT                   /note="TIGRFAM: Pseudouridine synthase, Rsu; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: pha:PSHAa0085 ribosomal RNA pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70433"
FT                   /db_xref="GOA:Q087Y2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y2"
FT                   /protein_id="ABI70433.1"
FT                   /translation="MTSMRLSHYLAVCGVASRRQAARLIDTGRVSINHQLAKHTDRVNF
FT                   CEIETILVDDKPILAVQDKQYWLYHKPVGIDCRLLVDDPHSLLHVLPELPRLYPAGRLD
FT                   KDSRGLLLLTNDGQLTQALMHPDYYHPKTYVVQVDKPISTSFLSMMANGVSYGDVQTRS
FT                   CDIRPLSLTAEEDRFEIVLTQGLNRQIRRMCQTLGYKVIDLMRTQLLDIRIDELAEKTM
FT                   RPLTAAELLSLKRAVN"
FT   gene            complement(665073..667229)
FT                   /locus_tag="Sfri_0573"
FT   CDS_pept        complement(665073..667229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfri_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO1075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfri_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABI70434"
FT                   /db_xref="GOA:Q087Y1"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR019500"
FT                   /db_xref="UniProtKB/TrEMBL:Q087Y1"
FT                   /protein_id="ABI70434.1"
FT                   /translation="MKKWLLTVAMAASFGAAADEGMWQPHQLPAMADELKAKGLEISAD
FT                   SISKLTEFPMNAVISLGGCTASFVSPKGLVVTNHHCAYGSIQYNSTPEKNLLKDGFLAK
FT                   TYAEELPATPGSRIFVTEAVTDVTDKVKANQMDKVGNEFYKGIELQEKTLVAECEKEDG
FT                   YRCQVYSFHGGLEYYLVKQLEIRDVRLAYNPAASVGKYGGDIDNWMWPRHTGDFSFYRA
FT                   YVSKDGKPADFSKDNVPYEPKSFLKVSAKGVSDGDFVMVAGYPGRTNRYRTADEVNNQF
FT                   NWAYPEGKVLQERMISIIKETASEGSDERIKYESLIAGLANYAKNFTSMIEYYGKSTML
FT                   ADREKIESDLANWIGKDKKRQQQYGETLSSLEKLVAKSQQNQQRDILLGYIGYTTMVTT
FT                   ARDLYRLANEKTLADMAREPGYQERDMTNFTSSMERIDRRYAASVDKALLADLLTRYAA
FT                   LPAEQHLAALDKAFGISSKFDAKALAKTLDKMYANTKLNNKETRLAWMNKSVADFKASN
FT                   DPFIQFAVQTFDADMAREKEKKQLEGDLMKVRPQYMDAIIAYNRELGKPVYADANSSLR
FT                   VTVGNVKGYSPQDGLVAVPFTRLEGILAKDTGVDPFDAPAKQLELIKQKQYGDYYVKAV
FT                   DSVPVNFLSTLDTTGGNSGSPTLNGRAELVGLLFDGVYESIIGDWGYDAQSNRSIQVDS
FT                   RYMLWVMQYLDNADNLLAEMEIVR"
FT   sig_peptide     complement(667173..667229)
FT                   /locus_tag="Sfri_0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 19"
FT   gene            com