(data stored in SCRATCH3701 zone)

EMBL: CP000448

ID   CP000448; SV 1; circular; genomic DNA; STD; PRO; 2936195 BP.
XX
AC   CP000448; AAJG01000000-AAJG01000101;
XX
PR   Project:PRJNA13014;
XX
DT   15-SEP-2006 (Rel. 89, Created)
DT   26-FEB-2014 (Rel. 119, Last updated, Version 5)
XX
DE   Syntrophomonas wolfei subsp. wolfei str. Goettingen G311, complete genome.
XX
KW   .
XX
OS   Syntrophomonas wolfei subsp. wolfei str. Goettingen G311
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Syntrophomonadaceae;
OC   Syntrophomonas.
XX
RN   [1]
RP   1-2936195
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Sims D., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Boone D.R.,
RA   Brockman F., Culley D., Ferry J., Gunsalus R., McInerney M.J., Morrison M.,
RA   Plugge C., Rohlin L., Scholten J., Sieber J., Stams A.J.M., Richardson P.;
RT   "Complete sequence of Syntrophomonas wolfei subsp. wolfei str. Goettingen";
RL   Unpublished.
XX
RN   [2]
RP   1-2936195
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Boone D.R.,
RA   Brockman F., Culley D., Ferry J., Gunsalus R., McInerney M.J., Morrison M.,
RA   Plugge C., Rohlin L., Scholten J., Sieber J., Stams A.J.M., Richardson P.;
RT   ;
RL   Submitted (25-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 2ba861a7d378908d8138846fd0b00a31.
DR   BioSample; SAMN02598286.
DR   EnsemblGenomes-Gn; EBG00001435909.
DR   EnsemblGenomes-Gn; EBG00001435910.
DR   EnsemblGenomes-Gn; EBG00001435911.
DR   EnsemblGenomes-Gn; EBG00001435912.
DR   EnsemblGenomes-Gn; EBG00001435913.
DR   EnsemblGenomes-Gn; EBG00001435914.
DR   EnsemblGenomes-Gn; EBG00001435915.
DR   EnsemblGenomes-Gn; EBG00001435916.
DR   EnsemblGenomes-Gn; EBG00001435917.
DR   EnsemblGenomes-Gn; EBG00001435918.
DR   EnsemblGenomes-Gn; EBG00001435919.
DR   EnsemblGenomes-Gn; EBG00001435920.
DR   EnsemblGenomes-Gn; EBG00001435921.
DR   EnsemblGenomes-Gn; EBG00001435922.
DR   EnsemblGenomes-Gn; EBG00001435923.
DR   EnsemblGenomes-Gn; EBG00001435924.
DR   EnsemblGenomes-Gn; EBG00001435925.
DR   EnsemblGenomes-Gn; EBG00001435926.
DR   EnsemblGenomes-Gn; EBG00001435927.
DR   EnsemblGenomes-Gn; EBG00001435928.
DR   EnsemblGenomes-Gn; EBG00001435929.
DR   EnsemblGenomes-Gn; EBG00001435930.
DR   EnsemblGenomes-Gn; EBG00001435931.
DR   EnsemblGenomes-Gn; EBG00001435932.
DR   EnsemblGenomes-Gn; EBG00001435933.
DR   EnsemblGenomes-Gn; EBG00001435934.
DR   EnsemblGenomes-Gn; EBG00001435935.
DR   EnsemblGenomes-Gn; EBG00001435936.
DR   EnsemblGenomes-Gn; EBG00001435937.
DR   EnsemblGenomes-Gn; EBG00001435938.
DR   EnsemblGenomes-Gn; EBG00001435939.
DR   EnsemblGenomes-Gn; EBG00001435940.
DR   EnsemblGenomes-Gn; EBG00001435941.
DR   EnsemblGenomes-Gn; EBG00001435942.
DR   EnsemblGenomes-Gn; EBG00001435943.
DR   EnsemblGenomes-Gn; EBG00001435944.
DR   EnsemblGenomes-Gn; EBG00001435945.
DR   EnsemblGenomes-Gn; EBG00001435946.
DR   EnsemblGenomes-Gn; EBG00001435947.
DR   EnsemblGenomes-Gn; EBG00001435948.
DR   EnsemblGenomes-Gn; EBG00001435949.
DR   EnsemblGenomes-Gn; EBG00001435950.
DR   EnsemblGenomes-Gn; EBG00001435951.
DR   EnsemblGenomes-Gn; EBG00001435952.
DR   EnsemblGenomes-Gn; EBG00001435953.
DR   EnsemblGenomes-Gn; EBG00001435954.
DR   EnsemblGenomes-Gn; EBG00001435955.
DR   EnsemblGenomes-Gn; EBG00001435956.
DR   EnsemblGenomes-Gn; EBG00001435957.
DR   EnsemblGenomes-Gn; EBG00001435958.
DR   EnsemblGenomes-Gn; EBG00001435959.
DR   EnsemblGenomes-Gn; EBG00001435960.
DR   EnsemblGenomes-Gn; EBG00001435961.
DR   EnsemblGenomes-Gn; EBG00001435962.
DR   EnsemblGenomes-Gn; EBG00001435963.
DR   EnsemblGenomes-Gn; EBG00001435964.
DR   EnsemblGenomes-Gn; EBG00001435965.
DR   EnsemblGenomes-Gn; EBG00001435966.
DR   EnsemblGenomes-Gn; EBG00001435967.
DR   EnsemblGenomes-Gn; EBG00001435968.
DR   EnsemblGenomes-Gn; EBG00001435969.
DR   EnsemblGenomes-Gn; EBG00001435970.
DR   EnsemblGenomes-Gn; EBG00001435971.
DR   EnsemblGenomes-Gn; EBG00001435972.
DR   EnsemblGenomes-Gn; EBG00001435973.
DR   EnsemblGenomes-Gn; EBG00001435974.
DR   EnsemblGenomes-Gn; EBG00001435975.
DR   EnsemblGenomes-Gn; EBG00001435976.
DR   EnsemblGenomes-Gn; EBG00001435977.
DR   EnsemblGenomes-Gn; EBG00001435978.
DR   EnsemblGenomes-Gn; EBG00001435979.
DR   EnsemblGenomes-Gn; Swol_R0001.
DR   EnsemblGenomes-Gn; Swol_R0002.
DR   EnsemblGenomes-Gn; Swol_R0003.
DR   EnsemblGenomes-Gn; Swol_R0004.
DR   EnsemblGenomes-Gn; Swol_R0005.
DR   EnsemblGenomes-Gn; Swol_R0006.
DR   EnsemblGenomes-Gn; Swol_R0008.
DR   EnsemblGenomes-Gn; Swol_R0009.
DR   EnsemblGenomes-Gn; Swol_R0010.
DR   EnsemblGenomes-Gn; Swol_R0011.
DR   EnsemblGenomes-Gn; Swol_R0012.
DR   EnsemblGenomes-Gn; Swol_R0013.
DR   EnsemblGenomes-Gn; Swol_R0014.
DR   EnsemblGenomes-Gn; Swol_R0015.
DR   EnsemblGenomes-Gn; Swol_R0016.
DR   EnsemblGenomes-Gn; Swol_R0017.
DR   EnsemblGenomes-Gn; Swol_R0018.
DR   EnsemblGenomes-Gn; Swol_R0019.
DR   EnsemblGenomes-Gn; Swol_R0020.
DR   EnsemblGenomes-Gn; Swol_R0021.
DR   EnsemblGenomes-Gn; Swol_R0022.
DR   EnsemblGenomes-Gn; Swol_R0023.
DR   EnsemblGenomes-Gn; Swol_R0024.
DR   EnsemblGenomes-Gn; Swol_R0025.
DR   EnsemblGenomes-Gn; Swol_R0026.
DR   EnsemblGenomes-Gn; Swol_R0027.
DR   EnsemblGenomes-Gn; Swol_R0028.
DR   EnsemblGenomes-Gn; Swol_R0029.
DR   EnsemblGenomes-Gn; Swol_R0030.
DR   EnsemblGenomes-Gn; Swol_R0031.
DR   EnsemblGenomes-Gn; Swol_R0032.
DR   EnsemblGenomes-Gn; Swol_R0033.
DR   EnsemblGenomes-Gn; Swol_R0034.
DR   EnsemblGenomes-Gn; Swol_R0035.
DR   EnsemblGenomes-Gn; Swol_R0036.
DR   EnsemblGenomes-Gn; Swol_R0037.
DR   EnsemblGenomes-Gn; Swol_R0038.
DR   EnsemblGenomes-Gn; Swol_R0039.
DR   EnsemblGenomes-Gn; Swol_R0040.
DR   EnsemblGenomes-Gn; Swol_R0041.
DR   EnsemblGenomes-Gn; Swol_R0042.
DR   EnsemblGenomes-Gn; Swol_R0043.
DR   EnsemblGenomes-Gn; Swol_R0044.
DR   EnsemblGenomes-Gn; Swol_R0045.
DR   EnsemblGenomes-Gn; Swol_R0046.
DR   EnsemblGenomes-Gn; Swol_R0047.
DR   EnsemblGenomes-Gn; Swol_R0048.
DR   EnsemblGenomes-Gn; Swol_R0049.
DR   EnsemblGenomes-Gn; Swol_R0050.
DR   EnsemblGenomes-Gn; Swol_R0051.
DR   EnsemblGenomes-Gn; Swol_R0052.
DR   EnsemblGenomes-Gn; Swol_R0053.
DR   EnsemblGenomes-Gn; Swol_R0054.
DR   EnsemblGenomes-Gn; Swol_R0055.
DR   EnsemblGenomes-Gn; Swol_R0056.
DR   EnsemblGenomes-Gn; Swol_R0057.
DR   EnsemblGenomes-Gn; Swol_R0058.
DR   EnsemblGenomes-Gn; Swol_R0059.
DR   EnsemblGenomes-Gn; Swol_R0060.
DR   EnsemblGenomes-Gn; Swol_R0061.
DR   EnsemblGenomes-Gn; Swol_R0062.
DR   EnsemblGenomes-Gn; Swol_R0063.
DR   EnsemblGenomes-Gn; Swol_R0064.
DR   EnsemblGenomes-Gn; Swol_R0065.
DR   EnsemblGenomes-Gn; Swol_R0066.
DR   EnsemblGenomes-Gn; Swol_R0067.
DR   EnsemblGenomes-Tr; EBT00001813916.
DR   EnsemblGenomes-Tr; EBT00001813918.
DR   EnsemblGenomes-Tr; EBT00001813919.
DR   EnsemblGenomes-Tr; EBT00001813922.
DR   EnsemblGenomes-Tr; EBT00001813924.
DR   EnsemblGenomes-Tr; EBT00001813925.
DR   EnsemblGenomes-Tr; EBT00001813928.
DR   EnsemblGenomes-Tr; EBT00001813930.
DR   EnsemblGenomes-Tr; EBT00001813932.
DR   EnsemblGenomes-Tr; EBT00001813933.
DR   EnsemblGenomes-Tr; EBT00001813936.
DR   EnsemblGenomes-Tr; EBT00001813937.
DR   EnsemblGenomes-Tr; EBT00001813940.
DR   EnsemblGenomes-Tr; EBT00001813942.
DR   EnsemblGenomes-Tr; EBT00001813943.
DR   EnsemblGenomes-Tr; EBT00001813945.
DR   EnsemblGenomes-Tr; EBT00001813948.
DR   EnsemblGenomes-Tr; EBT00001813949.
DR   EnsemblGenomes-Tr; EBT00001813951.
DR   EnsemblGenomes-Tr; EBT00001813952.
DR   EnsemblGenomes-Tr; EBT00001813954.
DR   EnsemblGenomes-Tr; EBT00001813955.
DR   EnsemblGenomes-Tr; EBT00001813956.
DR   EnsemblGenomes-Tr; EBT00001813958.
DR   EnsemblGenomes-Tr; EBT00001813960.
DR   EnsemblGenomes-Tr; EBT00001813961.
DR   EnsemblGenomes-Tr; EBT00001813962.
DR   EnsemblGenomes-Tr; EBT00001813963.
DR   EnsemblGenomes-Tr; EBT00001813964.
DR   EnsemblGenomes-Tr; EBT00001813965.
DR   EnsemblGenomes-Tr; EBT00001813966.
DR   EnsemblGenomes-Tr; EBT00001813967.
DR   EnsemblGenomes-Tr; EBT00001813968.
DR   EnsemblGenomes-Tr; EBT00001813971.
DR   EnsemblGenomes-Tr; EBT00001813972.
DR   EnsemblGenomes-Tr; EBT00001813973.
DR   EnsemblGenomes-Tr; EBT00001813974.
DR   EnsemblGenomes-Tr; EBT00001813975.
DR   EnsemblGenomes-Tr; EBT00001813976.
DR   EnsemblGenomes-Tr; EBT00001813977.
DR   EnsemblGenomes-Tr; EBT00001813978.
DR   EnsemblGenomes-Tr; EBT00001813979.
DR   EnsemblGenomes-Tr; EBT00001813981.
DR   EnsemblGenomes-Tr; EBT00001813983.
DR   EnsemblGenomes-Tr; EBT00001813984.
DR   EnsemblGenomes-Tr; EBT00001813986.
DR   EnsemblGenomes-Tr; EBT00001813988.
DR   EnsemblGenomes-Tr; EBT00001813991.
DR   EnsemblGenomes-Tr; EBT00001813993.
DR   EnsemblGenomes-Tr; EBT00001813995.
DR   EnsemblGenomes-Tr; EBT00001813998.
DR   EnsemblGenomes-Tr; EBT00001814001.
DR   EnsemblGenomes-Tr; EBT00001814003.
DR   EnsemblGenomes-Tr; EBT00001814005.
DR   EnsemblGenomes-Tr; EBT00001814007.
DR   EnsemblGenomes-Tr; EBT00001814008.
DR   EnsemblGenomes-Tr; EBT00001814011.
DR   EnsemblGenomes-Tr; EBT00001814012.
DR   EnsemblGenomes-Tr; EBT00001814014.
DR   EnsemblGenomes-Tr; EBT00001814016.
DR   EnsemblGenomes-Tr; EBT00001814018.
DR   EnsemblGenomes-Tr; EBT00001814020.
DR   EnsemblGenomes-Tr; EBT00001814022.
DR   EnsemblGenomes-Tr; EBT00001814024.
DR   EnsemblGenomes-Tr; EBT00001814027.
DR   EnsemblGenomes-Tr; EBT00001814029.
DR   EnsemblGenomes-Tr; EBT00001814032.
DR   EnsemblGenomes-Tr; EBT00001814035.
DR   EnsemblGenomes-Tr; EBT00001814037.
DR   EnsemblGenomes-Tr; EBT00001814038.
DR   EnsemblGenomes-Tr; EBT00001814040.
DR   EnsemblGenomes-Tr; Swol_R0001-1.
DR   EnsemblGenomes-Tr; Swol_R0002-1.
DR   EnsemblGenomes-Tr; Swol_R0003-1.
DR   EnsemblGenomes-Tr; Swol_R0004-1.
DR   EnsemblGenomes-Tr; Swol_R0005-1.
DR   EnsemblGenomes-Tr; Swol_R0006-1.
DR   EnsemblGenomes-Tr; Swol_R0008-1.
DR   EnsemblGenomes-Tr; Swol_R0009-1.
DR   EnsemblGenomes-Tr; Swol_R0010-1.
DR   EnsemblGenomes-Tr; Swol_R0011-1.
DR   EnsemblGenomes-Tr; Swol_R0012-1.
DR   EnsemblGenomes-Tr; Swol_R0013-1.
DR   EnsemblGenomes-Tr; Swol_R0014-1.
DR   EnsemblGenomes-Tr; Swol_R0015-1.
DR   EnsemblGenomes-Tr; Swol_R0016-1.
DR   EnsemblGenomes-Tr; Swol_R0017-1.
DR   EnsemblGenomes-Tr; Swol_R0018-1.
DR   EnsemblGenomes-Tr; Swol_R0019-1.
DR   EnsemblGenomes-Tr; Swol_R0020-1.
DR   EnsemblGenomes-Tr; Swol_R0021-1.
DR   EnsemblGenomes-Tr; Swol_R0022-1.
DR   EnsemblGenomes-Tr; Swol_R0023-1.
DR   EnsemblGenomes-Tr; Swol_R0024-1.
DR   EnsemblGenomes-Tr; Swol_R0025-1.
DR   EnsemblGenomes-Tr; Swol_R0026-1.
DR   EnsemblGenomes-Tr; Swol_R0027-1.
DR   EnsemblGenomes-Tr; Swol_R0028-1.
DR   EnsemblGenomes-Tr; Swol_R0029-1.
DR   EnsemblGenomes-Tr; Swol_R0030-1.
DR   EnsemblGenomes-Tr; Swol_R0031-1.
DR   EnsemblGenomes-Tr; Swol_R0032-1.
DR   EnsemblGenomes-Tr; Swol_R0033-1.
DR   EnsemblGenomes-Tr; Swol_R0034-1.
DR   EnsemblGenomes-Tr; Swol_R0035-1.
DR   EnsemblGenomes-Tr; Swol_R0036-1.
DR   EnsemblGenomes-Tr; Swol_R0037-1.
DR   EnsemblGenomes-Tr; Swol_R0038-1.
DR   EnsemblGenomes-Tr; Swol_R0039-1.
DR   EnsemblGenomes-Tr; Swol_R0040-1.
DR   EnsemblGenomes-Tr; Swol_R0041-1.
DR   EnsemblGenomes-Tr; Swol_R0042-1.
DR   EnsemblGenomes-Tr; Swol_R0043-1.
DR   EnsemblGenomes-Tr; Swol_R0044-1.
DR   EnsemblGenomes-Tr; Swol_R0045-1.
DR   EnsemblGenomes-Tr; Swol_R0046-1.
DR   EnsemblGenomes-Tr; Swol_R0047-1.
DR   EnsemblGenomes-Tr; Swol_R0048-1.
DR   EnsemblGenomes-Tr; Swol_R0049-1.
DR   EnsemblGenomes-Tr; Swol_R0050-1.
DR   EnsemblGenomes-Tr; Swol_R0051-1.
DR   EnsemblGenomes-Tr; Swol_R0052-1.
DR   EnsemblGenomes-Tr; Swol_R0053-1.
DR   EnsemblGenomes-Tr; Swol_R0054-1.
DR   EnsemblGenomes-Tr; Swol_R0055-1.
DR   EnsemblGenomes-Tr; Swol_R0056-1.
DR   EnsemblGenomes-Tr; Swol_R0057-1.
DR   EnsemblGenomes-Tr; Swol_R0058-1.
DR   EnsemblGenomes-Tr; Swol_R0059-1.
DR   EnsemblGenomes-Tr; Swol_R0060-1.
DR   EnsemblGenomes-Tr; Swol_R0061-1.
DR   EnsemblGenomes-Tr; Swol_R0062-1.
DR   EnsemblGenomes-Tr; Swol_R0063-1.
DR   EnsemblGenomes-Tr; Swol_R0064-1.
DR   EnsemblGenomes-Tr; Swol_R0065-1.
DR   EnsemblGenomes-Tr; Swol_R0066-1.
DR   EnsemblGenomes-Tr; Swol_R0067-1.
DR   EuropePMC; PMC2897672; 20348258.
DR   EuropePMC; PMC3584212; 23239474.
DR   EuropePMC; PMC5017805; 27431485.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP000448.
DR   SILVA-SSU; CP000448.
DR   StrainInfo; 157804; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634478
CC   Source DNA and bacteria available from Michael J. McInerney
CC   (mcinerney@out.edu)
CC   Bacteria also available from DSMZ: DSM 2245B
CC   Contacts: Michael J. McInerney (mcinerney@out.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2936195
FT                   /organism="Syntrophomonas wolfei subsp. wolfei str.
FT                   Goettingen G311"
FT                   /sub_species="wolfei"
FT                   /strain="Goettingen G311"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:335541"
FT                   /culture_collection="DSM:2245B"
FT   gene            83..1393
FT                   /locus_tag="Swol_0001"
FT   CDS_pept        83..1393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0001"
FT                   /product="initiation of chromosome replication"
FT                   /note="KEGG: bha:BH0001 initiation of chromosome
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67360"
FT                   /db_xref="GOA:Q0B0Z4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Z4"
FT                   /protein_id="ABI67360.1"
FT                   /translation="MSNYKDYSLVWNEVLDSMYQEIGSTSFEIWFSRVKFSSFHDNIFC
FT                   IIVPDSLTKEWIESRYLDIMQNKLRRLIDSRVILSIRTEILSGKSDPVSALNPKYTFDT
FT                   FVVGNSNRFAHAACYAVGESPFKSYNPLFIYGGVGLGKTHLMQAIGHHILSRKPNYLVM
FT                   YVSSEQFTNDMISSIKDDTTSLFRNKYRSIDVLLVDDIQFLAGKERTQEEFFHTFNTLH
FT                   ESNKQVVISSDRPPRNIPTLEDRLRSRFEWGLITDIQPPDLETRIAILRKKAQGENLNI
FT                   PYSVLDYIANYIDSNIRELEGALIRLVAFATINNKPLDMNTAVEALKDIMPPPRPRKIT
FT                   IETIQKTVAAHYHLEINEIISKKRNKQLVYPRHIAMYLCRKLTDASFPQIGEQFGGRDH
FT                   TTVMHAHEKLVNELLSDRELVAEIELLCKKIDPNYII"
FT   gene            1450..2679
FT                   /locus_tag="Swol_0002"
FT   CDS_pept        1450..2679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: chy:CHY_2709 DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67361"
FT                   /db_xref="GOA:Q0B0Z3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Z3"
FT                   /protein_id="ABI67361.1"
FT                   /translation="MLIHKNQAPTTITTKLLIKKRKRMTEGFSMKFMIEKKDLLAITSM
FT                   VYRAASSKNAIPVLSGLLLESDPDTGLTMTATDMEIGIRASTAKIEVIEKGSVLVNAHY
FT                   FFDFIKLLPEVPIFIELNQETAQLDIKYGRSSGFINTYRDYEYPALPLKKIKPCFTIKQ
FT                   EVLKEALKKTVFAAATTHFRQVFTGVLFDLGEGGNLNVVASDTHRLARYSCTIKLDAPE
FT                   PLSFIIPTRTANEILRLLDDSPEEINIGLSNNNVSFYRNNFLLLSRLIEGQYPNYEQVI
FT                   PRSFSYKVKLDTQVLADTLERARVIPSDDKLKIQYTRFKFEENEVEVNSYSEIMGEITE
FT                   VIEIKDPVEGEGELNISFNTNYFLDVVKILEGEAKELLINLSSILGPVMIVNPQKDNYL
FT                   YVLVPLRTSN"
FT   gene            2699..3796
FT                   /locus_tag="Swol_0003"
FT   CDS_pept        2699..3796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: bha:BH0004 DNA repair and genetic
FT                   recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67362"
FT                   /db_xref="GOA:Q0B0Z2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0Z2"
FT                   /protein_id="ABI67362.1"
FT                   /translation="MKILKFQIKDFRNLKKIEYQPSPGLNIFYGENAQGKTNILEALYY
FT                   LATGNSFRSNKEKTLISYESSSLQVQARYNHQERIIDSSITYGLDGKVFRINKKRASYN
FT                   HTDRLRIILFSPDDLYLVKGAPYKRRFFLDFLLGQISNEYLFKLDNYRKILKKRNLLLK
FT                   KEETNSRSFAIINDIFMDLAAQLLISRLNLINVLDEAIQEIYPQINNDGGQLKIRYALS
FT                   FPVDSGKINLDILKDSLKKQVESETEKEKKRKTTLLGPHLDDMHIYLNEQMARLFASQG
FT                   QQRNIVICLKLAEIMTFRKIKGFFPIFLLDEVLAELDDSRSNKLLKYLAQSPFQSFLTS
FT                   VKLEKFEVMDASIFLVKDGCLLGKE"
FT   gene            3803..4042
FT                   /locus_tag="Swol_0004"
FT   CDS_pept        3803..4042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67363"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Z1"
FT                   /protein_id="ABI67363.1"
FT                   /translation="MYVHLGNNYIISFSDIIAILNIEPPISHDLKDVIDMARIERCLVS
FT                   ISEKGKEKSLVICNDKLYLSPISSNTLFKRAANR"
FT   gene            4057..5958
FT                   /locus_tag="Swol_0005"
FT   CDS_pept        4057..5958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mta:Moth_0007 DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67364"
FT                   /db_xref="GOA:Q0B0Z0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Z0"
FT                   /protein_id="ABI67364.1"
FT                   /translation="MLEREYNASDIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVFEIVD
FT                   NSIDEAVAGFCKKIEVTINQDNSITVCDDGRGIPVDIHPAMGIPALQVILTTLHSGGKF
FT                   GGSGYNISGGLHGVGLSVVNALSRRMEVRVKRDGHIYQQDYERGNPVNEIRIIGESKET
FT                   GTSICFFADDEIFEEINFEREILLQRLRELSFLNRNLKISLRDEREEEVFYQEFHYSHG
FT                   LKDFVAYINKNKEVINDNPIYFENKKDDVIVQVAIQYNNSYSENLYSFANNIRTQEGGT
FT                   HEIGFKNALTRVINDYAKKNNILKENDNNLSGEDIREGIAAIISVLVKDPQFEGQTKTK
FT                   LGNTYIRGIVESIVFEHVEDYLNENPAAARKLLDKAISARRAREAAKKARELTRRKNAL
FT                   ESTALPGKLADCSNKNPAESELFIVEGDSAGGSAKQGRDRTYQAILPLRGKILNVEKAR
FT                   LDRVLSSEEIRNLITAMGTGIGEDFDIKKARYHKLFIMTDADVDGSHIRVLLLTFFYRY
FT                   MKELIEEGYLYIAQPPLYGLKRGKEIKYFYNDADLNAFLSQTEQKWSIQRYKGLGEMDP
FT                   EQLWTTTMDAESRTVLKVTIEDAIKANDIFSALMGDNVQPRREFIESNARYVANLDI"
FT   gene            5973..8411
FT                   /locus_tag="Swol_0006"
FT   CDS_pept        5973..8411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: chy:CHY_2704 DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67365"
FT                   /db_xref="GOA:Q0B0Y9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y9"
FT                   /protein_id="ABI67365.1"
FT                   /translation="MAQDSLFEKVIPIDIEKEVKKSFLEYSMSVIVSRALPDVRDGLKP
FT                   VHRRILYALHEQGMTHDKPHKKSANIVGEVMGKYHPHGDAAIYQTMVKLAQEFAMRYPL
FT                   VDGHGNFGSIDGDAAAAMRYTESRMSRIAAELLKDIDKDTVDWRPNYDESREEPQVLPA
FT                   RIPNLLLNGSAGIAVGMATNIPPHNLREIVKGIKEYIDNPDITIEELMQSIPGPDFPTG
FT                   GILEARGIRQAYETGRGTIRTRARYEIEEKKGGKFSIVVTEIPYQVNKARLVEKIAELV
FT                   RDKKVEGIVDLRDESDRKGIRIVIELRKDVNVNVILNKLFRHTQMEDSFGIIMLSLVNG
FT                   EPRILNLKEMIQYYVEHRQEVINRRTTYELNLAKNRKHILEGLKIALDNLDEIINLIRN
FT                   SRDRENARGELQSRFNLSEIQANAILDMRLVQLTGLERSKVENEYEEVLLRIADYEDIL
FT                   ARPERVLSMIKEDLDDIEKRYGDNRRTEISQEESSYEEEDFIDDHEVVITLSNRGYVKR
FT                   QPLDTYRSQKRGGKGVSATTIRAEDFAHDVLVTSALATLLFFTNQGRVFTTRAFQIPES
FT                   SRQAKGMPLVNFLELRPGEKVTTIVGAREFNREHHLLMVTKKGIIKKTALKAFQNVRKS
FT                   GLIAVNLREDDELVGVIRVKTGSKVMIANSRGISIMFDEKQVRSMGRTAAGVKAINLSK
FT                   DDYVVGLDRYREGADVLLVTEKGYGKRTALSEFKLQNRGGKGLKAIEITRRNGKLVAFQ
FT                   IVSKEDELVILTSEGNIIRLEVEDISQQKRYSRGVLLMRLPEEDRIVGVARFKIEKEED
FT                   "
FT   gene            8470..9354
FT                   /locus_tag="Swol_0007"
FT   CDS_pept        8470..9354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0007"
FT                   /product="vitamin B6 biosynthesis protein"
FT                   /note="KEGG: mta:Moth_0009 vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67366"
FT                   /db_xref="GOA:Q0B0Y8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y8"
FT                   /protein_id="ABI67366.1"
FT                   /translation="MEEKATLKSKTDLAQRLKGGVIMDVTTPEQAKIAEEAGACAVMAL
FT                   ERVPADIRAAGGIARMADPSVILRIKEKVTIPVMAKCRIGHFVEAQILEALGIDFIDES
FT                   EVLTPADDKHHVNKDAFQVPFVCGARNLGEALRRIGEGAAMIRTKGEAGTGNVIEAVRH
FT                   IRQVNEHIRWVSSLPAEELMAAAKELGAPYELLQEVARLKGLPVVNFAAGGIATPADAA
FT                   MMMQLGCDGIFVGSGIFKSGDPMKRARAIVTATAYYQDPVVLAEVSRDLGEAMVGIDIS
FT                   TIRPEERMQERGW"
FT   gene            9743..10894
FT                   /locus_tag="Swol_0008"
FT   CDS_pept        9743..10894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0008"
FT                   /product="L-aspartate aminotransferase / phosphoserine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /EC_number="2.6.1.52"
FT                   /note="KEGG: mta:Moth_0019 serine--glyoxylate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67367"
FT                   /db_xref="GOA:Q0B0Y7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y7"
FT                   /protein_id="ABI67367.1"
FT                   /translation="MIGEQYLLLPGPTPVPERVVRAMSRPMVNHRGSEFKEILINVTEG
FT                   IKQVYHTEHQVIIYPASGTGALEAAAVNFISPGDKVLAVSIGVFGDRFATIAREFGAQV
FT                   EKLDFPWGEPTDPQVLRERLAQDIKQEIKAVLITHNETSTGVFNDLAAIRAAVGEHPAL
FT                   LMVDAVSGLAAVALKMDEWKLDVVVSGSQKAFMIPPGLSFLAFNDRALRIHQENKNHKY
FT                   YWDVSAGLKYLEKGQNPYTPAISLYYGLEEALKMMLEEGLDNILIRHQNYREMVRAALK
FT                   EMGLNLLAADGYASPALTSVIAPQGIGGNKIRQYMRERFNIVLAGGQQKLDDVIFRIGH
FT                   LGYVRELDLLAVLAALEIALLNCGYPIELGKGLKKAQEYISSI"
FT   gene            11004..12596
FT                   /locus_tag="Swol_0009"
FT   CDS_pept        11004..12596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0009"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="KEGG: ctc:CTC00694 D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67368"
FT                   /db_xref="GOA:Q0B0Y6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y6"
FT                   /protein_id="ABI67368.1"
FT                   /translation="MERKKVIVSERIADEGIELLKTELEVDYRDGISREELLEIIDQYD
FT                   ALIVRSVTQVDEELIRRAKRLKIVGRAGNGIDNIDVDVCTRYGVIVANTPDSNTISAAE
FT                   QTISLLLSSIRNTAWASEYLKGGTWDRKPFRGVELYGKTVGIVGLGRIGSMVATRLKAF
FT                   NMRVIAYDPYISDERFTRFGAEKMESLEELVKEADFITVHTPRNEETMHMIDERILGLA
FT                   KEGVRVVNCARGGIIKEEALLKGLESKKVLSAGLDVFEKEPAIDNPLFQFKSVVVTPHL
FT                   GADTFEAQKRVGENIAEQVIKALKGEIVPNLVNLPAMLKDELEYLKPYITLAEKLGNIY
FT                   YQMEKSAVSRVELTYSGPISSNETEILTVAFLKGLLEPVMGDKVSYVNARLMAEDRGIK
FT                   VFDHKEEQSPKRYKNLITARVFDHERELAIEGTLSRARFPLLVEINGYETESNLEGYLL
FT                   VVENEDRPRVIGPFATALGDEGINIAGMKVARKTKGEKAIMIINVDNKVEEPVLEKLSQ
FT                   LDGIVGKPILLQL"
FT   gene            12776..14059
FT                   /locus_tag="Swol_0010"
FT   CDS_pept        12776..14059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0010"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: chy:CHY_2697 seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67369"
FT                   /db_xref="GOA:Q0B0Y5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0Y5"
FT                   /protein_id="ABI67369.1"
FT                   /translation="MLDAKLIKANAALVEQQLEKRGLSGVLKPFLALDEERRKILVQVE
FT                   ERKNFRNNSSQQIGKMKKEGLNPADLMEEVRQAGQQIKELDEELARVEKEIEKILLNIP
FT                   NLPHESVPVGEDEKSNQEVRRWGEPRQFNFEPQAHWDIGPALDILDFERAAKLSGARFT
FT                   VYKGAGARLERAVINFYLDIHCGEHGYREILPPFMVIADCMVGTGQLPKFAEDMFKLEG
FT                   KDMYLIPTAEVPLTNLYREEILEAKDLPFYLTAYTPCFRAEAGSHGRDTRGVIRQHQFN
FT                   KVELVKLCEPQNSYEELEKLTKDAERVLQLLGLPYRVVVLSTGDMGFSAAKTYDIEVWM
FT                   PGYQDYREISSCSNCEDFQARRANIRYRPDPKAKLQYVHTLNGSGVAIGRTVAAILENY
FT                   QQEDGSVIIPEVLRPYMGGLEKINRPEA"
FT   gene            14133..14222
FT                   /locus_tag="Swol_R0001"
FT                   /note="tRNA-Ser1"
FT   tRNA            14133..14222
FT                   /locus_tag="Swol_R0001"
FT                   /product="tRNA-Ser"
FT   gene            14345..14438
FT                   /locus_tag="Swol_R0002"
FT                   /note="tRNA-Ser2"
FT   tRNA            14345..14438
FT                   /locus_tag="Swol_R0002"
FT                   /product="tRNA-Ser"
FT   gene            14445..14521
FT                   /locus_tag="Swol_R0003"
FT                   /note="tRNA-Arg1"
FT   tRNA            14445..14521
FT                   /locus_tag="Swol_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(14740..16320)
FT                   /locus_tag="Swol_0011"
FT   CDS_pept        complement(14740..16320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0011"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: mta:Moth_0689 putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67370"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y4"
FT                   /protein_id="ABI67370.1"
FT                   /translation="MENMHSLLRRQLRKQFGNNIPDIPGWDTFLKQVNDAYQEFDADRN
FT                   MLERALEISSQELLETNSQLRAVLEAFPDVFLLLDSQGIIIELKAGRSTDLYMSPEQLL
FT                   GHHIEVIHPDISNSPFATAVEQVLQSGKLISFEYPVLLNQQEHYFEARLLPVSGDHVFV
FT                   IIRNVTERRIMEDQLRYLSMHDALTGLYNRSYFKLETAHLEKQSRRPIGLIVGDVDGLK
FT                   LVNDTLGHEAGDDLLIKAAHVLKDSLRDCDFVARIGGDEFAAILYDCNTPGIEGVIKRI
FT                   EKNIALVNSRNPTLPLSISLGYAVRNDASKSMDELFKEADDNMYKEKLDHRKNFNANLV
FT                   STLMSSMDEKHFFNQDHVEQMQELVCIMAEALDMSPSQISCMNLLAQYHDIGQVGISDA
FT                   VLFKKGKLNSQERLQIERHPEIGYRIARLSPELMPIADWILRHHEWWNGQGYPCGLAGE
FT                   DIPLECRILALVDAYSAMTSDRPYRKAMSHEEAIEEIKSKAGTQFDPELVRLFLSEIET
FT                   KFPSPGSKS"
FT   gene            complement(16325..17464)
FT                   /locus_tag="Swol_0012"
FT   CDS_pept        complement(16325..17464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr2286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67371"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y3"
FT                   /protein_id="ABI67371.1"
FT                   /translation="MRIEQKLWRENTGWSDLSPQVDGLMPQLLIVFGTRKYLQEEVRFE
FT                   EIKGFYPGAHIFGCSTAGEICATNVFEDALAITALEFEHTRIESRQIHLSQVQNSFQAG
FT                   EYLASSLTHDDLSHVLVLSDGLHVNGSELLQGLTSSLPPGIAITGGMAGDGVSFEETLV
FT                   FLDAPPTPDTIAVLGFYGNHLRVGYGSMGGFDPFGPKRLITRSAANVLYEMDGRSALEL
FT                   YKKYLGEHAEGLPATGVFFPLSISGEEVAESLVRTILAVNEEEQSLTFGGDVPTGAYAR
FT                   MMKANLDRLIDGAVTAAESILSVVNNASPELAILISCFGRRSILKQRTEEEVEAVSDVF
FT                   GSGCMLTGFYSYGEISPFKPGEKPEFHNQTMTITTFREV"
FT   gene            18046..18122
FT                   /locus_tag="Swol_R0004"
FT                   /note="tRNA-Arg2"
FT   tRNA            18046..18122
FT                   /locus_tag="Swol_R0004"
FT                   /product="tRNA-Arg"
FT   gene            18168..18623
FT                   /locus_tag="Swol_0013"
FT   CDS_pept        18168..18623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0013"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="KEGG: dsy:DSY0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67372"
FT                   /db_xref="GOA:Q0B0Y2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y2"
FT                   /protein_id="ABI67372.1"
FT                   /translation="MQHEDFMRHALEEAREAYKRGEIPVGAIVVHNGKIIARAHNEKES
FT                   YQDATAHAEMLALQRAARHLGHWRLNESVLYCTLEPCVMCAGAMVNVRLGHLVYGVTDP
FT                   KAGSAGSIYDIVRSPALNHQVVVEGGVLKEECSELLKRFFASLRRDG"
FT   gene            18610..18704
FT                   /locus_tag="Swol_R0005"
FT                   /note="tRNA-Ser3"
FT   tRNA            18610..18704
FT                   /locus_tag="Swol_R0005"
FT                   /product="tRNA-Ser"
FT   gene            18932..20284
FT                   /locus_tag="Swol_0014"
FT   CDS_pept        18932..20284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67373"
FT                   /db_xref="GOA:Q0B0Y1"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y1"
FT                   /protein_id="ABI67373.1"
FT                   /translation="MMEQAAIIAVIIGLALLVFLLFQLQQRINTLRDQMDKLAAGNLHL
FT                   EKSQERMEQLLREEMSCNREEMNVTARQGREELSNSFKTLSDSLSARMVEMGNLQQYQL
FT                   DGFSQQMAHLTQSNEQKLEQMRGTIEERVRELQKENAQKLEQMRTVVDEKLHATLEQRL
FT                   GESFKLVSERLEQVHKGLGEMQALASGVGDLKKVLSNVKSRGTWGEVQLGNILEDILAP
FT                   EQYGSNVAVKKGAERVEFAVKLPGPDKEGSPLWLPIDAKFPLEDYHRLLEAYDGADLAA
FT                   IEQAGKNLENRIKAQAKEICSKYIEPPATTDFAIMFLPTEGLYAEVLRRPGLFENLRQD
FT                   YRITVAGPTTLAALLNSLSMGFRTLAIQKRSGEVWAILGAIKSEFGKFGMVLEKTRKKL
FT                   QEASNSIEEAARRSRVMERKLKEVEELPEKQANELLSAEGYGEEIAAGSDS"
FT   gene            complement(20287..21099)
FT                   /locus_tag="Swol_0015"
FT   CDS_pept        complement(20287..21099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67374"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Y0"
FT                   /protein_id="ABI67374.1"
FT                   /translation="MQHWQWADGSEIPYITIPHWREAGVNIAFSSRWGGSSSPPFASLN
FT                   LGLHVGDEREKVLDNRRRFLASLGQKLNNLVCCQQVHGQRVLRVDKSLAGSGAWDYETA
FT                   LPGFDAMVGNSPGIILGSFYADCIPLFFFDPEKRVVAMAHSGWKGTMGKIAAESVKEML
FT                   KLGCLPRDIEVFLGPGIGPCCFQIQPELALRVKTAFPHHQAILHKNAHGYYWDLRESIK
FT                   QSLQESGIQEAHIIDSHLCTACNCHLFFSYRAEKGRTGRMGAFIGLED"
FT   gene            21440..22291
FT                   /locus_tag="Swol_0016"
FT   CDS_pept        21440..22291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67375"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0X9"
FT                   /protein_id="ABI67375.1"
FT                   /translation="MLTISEVAGRFNISNRQVHELMDYGYLTVAQVERKDNRGICFLFS
FT                   EKEIETLDIPSLLAEIKEKRERNEKPRYQGSSDLRKIIKAFNYYDRFLEEIEEYPEAEL
FT                   LKACFYLFHLNHYAKTYPEISKSLYQLKARVLEKVYRENQAKFKVIYLLGADKKKVWLC
FT                   EDCKEAAHSRGLSYNRFIREDAYCSKCYIQSVEKEYYSLLEFILRVGDYRFIFHSPRSL
FT                   AAAWVDNLPELPCEVRREGFYEDRMYLYGRRVTAVEERVFPLEMIKEKLMDYLGRDPQS
FT                   ND"
FT   gene            22691..22786
FT                   /locus_tag="Swol_R0006"
FT                   /note="tRNA-Ser4"
FT   tRNA            22691..22786
FT                   /locus_tag="Swol_R0006"
FT                   /product="tRNA-Ser"
FT   gene            complement(22808..23266)
FT                   /locus_tag="Swol_0017"
FT   CDS_pept        complement(22808..23266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67376"
FT                   /db_xref="GOA:Q0B0X8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0X8"
FT                   /protein_id="ABI67376.1"
FT                   /translation="MFVIGEKRSRYPNKPLKYFAKPEQPVSIIRMDTGCSISIKEVKYS
FT                   MIKIDLARAIADKVLPQITQKEADAFLTAFMDIIGEALKKLRRSMPGYLVSYSLQANYL
FT                   KHGLQNIFASIMQYFFLFPAILTHFGYSRATPALSFVNNIKKRFQHKV"
FT   gene            23707..24207
FT                   /locus_tag="Swol_0018"
FT   CDS_pept        23707..24207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67377"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0X7"
FT                   /protein_id="ABI67377.1"
FT                   /translation="MSESQEKRARDTIHDRIMILNELGIFNVPVETEVDVELQIDGNTV
FT                   SGIVDGIELHPDSGIIIRDWKSSIHEEFYKRYEKQLQFYTLALIEQEKQVSSAQLVDVS
FT                   KTIESKNLFTREINIDPSSLESIVTELRAALKGILEGDYRPNPKPETCFCCDMSRLCAE
FT                   RVD"
FT   gene            24209..24766
FT                   /locus_tag="Swol_0019"
FT   CDS_pept        24209..24766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67378"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0X6"
FT                   /protein_id="ABI67378.1"
FT                   /translation="MFTRAEDIWELKPLAEDLEAGARYASITLPWTFNRMAYNTGSKGQ
FT                   QGRGLNIAKGIVAQKMLSRALSERNVVAEVQRKSHRDDDLFDFQVVINGKMSKLDLKSW
FT                   NYFSNYNVSGREPFTSALIEKNAGYAGPEWRKFFPMLVPHTQIGQEKEAYCFGLASSID
FT                   FRNNVEADRDGYILTAYPYGVV"
FT   gene            24773..25507
FT                   /locus_tag="Swol_0020"
FT   CDS_pept        24773..25507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67379"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0X5"
FT                   /protein_id="ABI67379.1"
FT                   /translation="MSSSKLCLVREEEGKGIFLKLTWQPGFIGKSNMGISIVGEWDNQV
FT                   SKTVIMLKGGKPKILGPFSCISSFQISHEEYNDWVNGTIEIGIAKNELTKQVLNSVRRN
FT                   VNIIPAACMTLERNDFCNLMLPNDYTLYLIGWLTKEEFLEACKKYTGWVWPYDRVSRFN
FT                   NQAWEQITDDDRKKITRAGFADCIQEKPRLVKAGWLKTTGRGGGACCYVYPNIGSNGGI
FT                   KETNLYVLAQDLHTMEELCIET"
FT   gene            25523..26968
FT                   /locus_tag="Swol_0021"
FT   CDS_pept        25523..26968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0021"
FT                   /product="DNA modification methylase-like protein"
FT                   /note="KEGG: ssp:SSP0028 putative DNA modification
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67380"
FT                   /db_xref="GOA:Q0B0X4"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0X4"
FT                   /protein_id="ABI67380.1"
FT                   /translation="MIDTETSNNNLTKKRSGPPNRMNDLIYRDWMKFQKSFFRFKDYQN
FT                   LIEECVCFFTKAIWPDNRPSQTLIIGFEDINKEMIPKPRQIEYKSVKSIGEIVKILKQK
FT                   EEYYDFVLIDLTNIDSEEKLADFLNNDADLLFYSLRRSMVTFRYCGVVSKLPRTNGSGF
FT                   PIPWSIAFSSRNHLRLRDEKVGLVEATGQILYCLFMQAEDDSELAKKVFPNELSIFNGN
FT                   IEIPSWTIPKSPPRSSIEVLHPAKFPETLVEEFIKLFTKPGDNVFDPMAGTGSTLIAAL
FT                   RNERNAIGVELSPEWASIGQNRLNYELQPTLFGEPLQKAKMLQGDATNLDAIGQLNGVY
FT                   FDYVVTSPPYWSMLTNPGSENQRNRRNKNLPLTYSKDQNDLGNIQDYNDFLDKLVNVYD
FT                   DVVKKLNSGGVITIVVKNVKRNHILYCLAWDLTIRLCQKDKLLEYAGTTLWCQDDVGLK
FT                   PFAVGTHWVSNILHQYCLHFRKK"
FT   gene            complement(27101..27949)
FT                   /locus_tag="Swol_0022"
FT   CDS_pept        complement(27101..27949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0022"
FT                   /product="Multimeric flavodoxin WrbA-like protein"
FT                   /note="KEGG: chy:CHY_1344 putative FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67381"
FT                   /db_xref="GOA:Q0B0X3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0X3"
FT                   /protein_id="ABI67381.1"
FT                   /translation="MKKVLGLVVSNRKLGNSEILVKEIINNIPEECNRELIRLTDLEIK
FT                   PCKACYRCLQPNNACPVRDDFNFVIEKIREADALIIGVPVYFLGPHGYYKMLTDRLLGS
FT                   QNYSQDTQGKPCIIVMPYGSEGWEGYSKIACMVMPKLLRMKLVDCWQIHASLPGESLLN
FT                   PENISYARALGRELFNGREYHAESKECPICGSDLFRLINENQVECPICGSRGILKNNFS
FT                   PDFSDSDYRRFSDHEMDEHFKGWLLEMKDRFSAEKNHLKELQKGYRNQNWWIKPCRLDE
FT                   C"
FT   gene            complement(28170..28892)
FT                   /locus_tag="Swol_0023"
FT   CDS_pept        complement(28170..28892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67382"
FT                   /db_xref="GOA:Q0AUU4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AUU4"
FT                   /protein_id="ABI67382.1"
FT                   /translation="MKELIKDYCKQLRWGNSIVQNYADIKADTHEEFLAKLLEIEVKGR
FT                   ELNRKNRCLRQAGFDVIKTFNGYSFDHIEIPASIPLDDLKTAALLKNRENLILYGPVGT
FT                   GKTHMATAIGVEACNQGKKVGFYRTSTLVNELNDAQNAGNLGKMLKQLAKLDLLICDEW
FT                   GYIPLDRQGAQLLFQVVADCYEKRSIIITTNLEFSKWNGIFYDEKLTSAIIDRLIHHSH
FT                   LLVFGGQSYRLTHSTIRK"
FT   gene            complement(28889..30394)
FT                   /locus_tag="Swol_0024"
FT   CDS_pept        complement(28889..30394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0024"
FT                   /product="transposase (25)"
FT                   /note="KEGG: bha:BH3998 transposase (25)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67383"
FT                   /db_xref="GOA:Q0AUU5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AUU5"
FT                   /protein_id="ABI67383.1"
FT                   /translation="MLTMIQQYHIKHLNFHKGKSLRSIAEETGHDFRTVKKYAEQTDFN
FT                   EIRKPKRGRPSKLDPVKPIIDAWLKEDLNRPVKQRHTARRIYDRLCDEHQDIFNACERT
FT                   VRTYVSARKKELYGEEEGYLPLEHPAGEAQVDFGEIVMIEQGQKVKGYELILSLPYSNA
FT                   GYPQIFRGQNQECLLTGLKDIFEYLEHVPRIIWFDNMSAAVAGIGEKGERKLVDQFYRF
FT                   ALHYGFKPQFCNPGKGHEKGHVENKVGYSRRNYFVPEPSFSDIEEFNQGLFAVAEKDHC
FT                   RKHYRKGRVINELLQDDLTAMLPLPAKPFTIGRMQKLSANKYGKVCVDTNVYSASPQVA
FT                   NKELYMRLGAHQVELLNEQYQPIVKHKRLYGQNQELMDWLPYLTTLAKRPNALKYTGFY
FT                   RELPDPWQDYFNNLDYAEKKKSLNLLVRMITETDMDTATICLLETLDSGKADADSILLS
FT                   YRRLTEPTFNDFLPLLSAGINSPAIYTPDLTCYDTFLKAGECR"
FT   gene            complement(30491..30919)
FT                   /locus_tag="Swol_0025"
FT   CDS_pept        complement(30491..30919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0025"
FT                   /product="Uncharacterized aromatic compound catabolism-like
FT                   protein"
FT                   /note="KEGG: aci:ACIAD1699 conserved hypothetical protein;
FT                   putative protein involved in aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67384"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0X0"
FT                   /protein_id="ABI67384.1"
FT                   /translation="MRLINPDHIKEVIDLINRGPYFQLLSMQIYELGIGYSKVLVDLER
FT                   KHLNPFGGIHGGVYSSLIDTAAYWAVYCHVEENAGYISMDVSVDNLAPVKEGRLIVEGK
FT                   LIKAGRSICITEAMVNDNNGRHLAHGVYGTIKIQRMAS"
FT   gene            complement(31006..31611)
FT                   /locus_tag="Swol_0026"
FT   CDS_pept        complement(31006..31611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0026"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="KEGG: dde:Dde_0960 putative transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67385"
FT                   /db_xref="GOA:Q0B0W9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:3LWJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W9"
FT                   /protein_id="ABI67385.1"
FT                   /translation="MPIPLEKQNKERRQKILTCSLDLFIEKGYYNTSIRDIIALSEVGT
FT                   GTFYNYFVDKEDILKNLLEDFAKQIISSISEYYLVEKDLYERFIETKRLTMEVFAQNET
FT                   LSEIYSRVAGSSAPIDQCLKQFEDRLLEFYSRNIEYGIKKGVFKNVPVSPIAHSILAIE
FT                   KFSLYKWVVLKAITKEEMIEMVLSFHKTLAVGLLVVND"
FT   gene            31931..33280
FT                   /locus_tag="Swol_0027"
FT   CDS_pept        31931..33280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67386"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W8"
FT                   /protein_id="ABI67386.1"
FT                   /translation="MYRLAIEQLYTWKAKKNKKPLIIRGARQVGKTWLMKEFANAAYES
FT                   SVYVSFDNNQRMQDLFTVNFDVERIITGLELYAGQKINPQSTVLIFDEIQEVPKALTAL
FT                   KYFNENTPQYQIICAGSMLGVALRQGTSFPVGKVEFLDLYPLSFTEFMLAMGKEQFVDL
FT                   LHKGDFNMVTTFKTSFFDLLKFYYYVGGMPEVVQNFAENKDFNEVREIQQRILDAYEQD
FT                   FSKHAPNEVVPRIRMLWNSIPAQLTKENKKFIYGLIREGARAKEYELALLWLNDCGLVH
FT                   KVHRVTKPLLPLKAYEELKAFKLFLVDVGLLSCMLRLKQDTLLDGNELFKEFKGSLTEQ
FT                   YVLQQLKTLKDIGIYYWTNDRGSAEIDFIVDNGRQVIPIEVKAEVNLQAKSLKSYRGKF
FT                   NPAISIRTSMADYKKEEWLLNLPLYAVELMNTAVAHFLCEHFEGKIDVDR"
FT   gene            33372..34574
FT                   /locus_tag="Swol_0028"
FT   CDS_pept        33372..34574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67387"
FT                   /db_xref="GOA:Q0B0W7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W7"
FT                   /protein_id="ABI67387.1"
FT                   /translation="MDKIELIATATFGLEAIVAREVRKLGFDEVKVENARVTFLASLAD
FT                   ICRANLWLRSADRVLVKMGEFPARSFTELFDQTRELPWSDWLPANANFPVQGKSIRSKL
FT                   FSVPDCQAIVKKAVVESLKGRYHQEWFEESGPRYTIEVALLKDIATLTLDSSGAGLHKR
FT                   GYRQLSSAAPLKETLAAAMIDLSRWHPDRLMFDPFCGSGTIPIEAAMIALNQAPGLKRE
FT                   FAAEKWPVIPQKHWLDARSEANDLLKRDLTLKIRGTDINKEVLSLARYHARQAGLEKHI
FT                   HFQQMPVNQLQTREKYGFLICNPPYGQRLEDLPSVEKLYRDMASVFKKNLETWSFYILT
FT                   AHKDFEHVFGRRADKRRKLYNGRIETHFYQFFGPKPPRRKHEAEMLENDFDKAGQGKGL
FT                   I"
FT   gene            34607..35443
FT                   /locus_tag="Swol_0029"
FT   CDS_pept        34607..35443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0029"
FT                   /product="protein of unknown function DUF182"
FT                   /note="KEGG: aba:Acid345_2647 protein of unknown function
FT                   DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67388"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W6"
FT                   /protein_id="ABI67388.1"
FT                   /translation="MVKKREGDEVQSELMRILAEKQERKENIALVTVISSNSPRGCRAG
FT                   EMMLVDRFGYIIGDGIGDSLLQENAQREAQICINEGISRRVILPSEEGMTEVFINAFCH
FT                   RDQLIIVGSGNVALNVYRIASIVGYSITVIDNRAETLSRERFPEAKELLLGDIVELLKA
FT                   YNIDENTSIVLLSYHHEFDEAALLTVIHSPARYIGIMGNKHKVTAYFSKLNELNIAEEL
FT                   ISRVHVPVGIDIGGERAAEIALAVVAEMQAIKYGRAGGFRILQSEITGKVERDELF"
FT   gene            35872..35988
FT                   /gene="ffs"
FT                   /locus_tag="Swol_R0007"
FT   misc_RNA        35872..35988
FT                   /gene="ffs"
FT                   /locus_tag="Swol_R0007"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            36176..37675
FT                   /locus_tag="Swol_0030"
FT   CDS_pept        36176..37675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0030"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dsy:DSY0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67389"
FT                   /db_xref="GOA:Q0B0W5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W5"
FT                   /protein_id="ABI67389.1"
FT                   /translation="MAYLALYRAWRPRRFAEVVGQEKTVTALRNAVREGKLSHAYLFSG
FT                   PRGTGKTSIAKIIAKAVNCENLSEGEPCNQCSSCQDINNGNFMDVIEIDAASNRGIDEI
FT                   RDLREKVRVLPAQGKNKVYIIDEVHMLTTEAFNALLKTIEEPPDAVIFILATTESHKIP
FT                   ATIRSRCQVYNFRRLTTAEITERLSDVAANDGIILEPEALLLLARRANGGMRDALSMLD
FT                   QIYSYKGNNSISKQDVLEVMGLVDDAFMAQLIAAVLSQDTPSIIGILGTAFSQGKEAQQ
FT                   LAREASMFLRDFLLYLVAGKEADLVVAGEESQAFFEQQKSQINMQNLLRALRIMMDTAD
FT                   KLRFSEGQKYLLEIAFMEIATLFSEEKSAQPSFLEEKKPKKKADPRAKASSNEAQDALW
FT                   NKILAAVKEKKIPTHALLVQGKLLGIKDDTVYIAYKKGYKFHKERMEERGNREILGQAL
FT                   KEIMGRDIESQFIFLDDDQYNDIIVKKALEFFGEELVEIKD"
FT   gene            37717..38016
FT                   /locus_tag="Swol_0031"
FT   CDS_pept        37717..38016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0040 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67390"
FT                   /db_xref="GOA:Q0B0W4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W4"
FT                   /protein_id="ABI67390.1"
FT                   /translation="MNKMIKQAKQVQEKIVKMQEELREREIEASSGGGVVTVKVNGKQE
FT                   LVSIQIKPEAVDPDDLEMLEDLVLAAVNEGIRKSQEMVSSEMAKITGGFNIPGL"
FT   gene            38054..38647
FT                   /locus_tag="Swol_0032"
FT   CDS_pept        38054..38647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0032"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: mta:Moth_0029 recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67391"
FT                   /db_xref="GOA:Q0B0W3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0W3"
FT                   /protein_id="ABI67391.1"
FT                   /translation="MRLARPLENLIDQLLKLPGIGPKTAQRLALYILKLPEMEARQLAQ
FT                   AIVDCRQKVFPCSRCGYLTDFDPCLICSDESRDKSLICIGEESSDVIAIERTGFRGQYF
FT                   VLNKDFNLMEDKGLEDLNLKPLEDRLATGEIKEVVLALNPDMDGEVMSRFLATVAGSFG
FT                   VKVTRLAHGLPVGGDIEFADEITLRRALEGRKEL"
FT   gene            38718..38987
FT                   /locus_tag="Swol_0033"
FT   CDS_pept        38718..38987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67392"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W2"
FT                   /protein_id="ABI67392.1"
FT                   /translation="MKICATIWDWACNYLVLKEDDESKKEVSLEDMLQDAHREVQEAEN
FT                   LFARVEDEEMIDYAILNLQAAEKRYNYLLKIMKEQGKAEESLES"
FT   gene            39030..39296
FT                   /locus_tag="Swol_0034"
FT   CDS_pept        39030..39296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0034"
FT                   /product="SigmaK-factor processing regulatory BofA"
FT                   /note="KEGG: mta:Moth_0031 SigmaK-factor processing
FT                   regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67393"
FT                   /db_xref="GOA:Q0B0W1"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W1"
FT                   /protein_id="ABI67393.1"
FT                   /translation="MEWVNVIIAALFFLAILYIILQVLFKPVKLLWKLAINSLMGLVLL
FT                   LISNYIGAYFQFDLPVNIITVLIAGFLGLPGIILLICFQLLVR"
FT   gene            39878..40558
FT                   /locus_tag="Swol_0035"
FT   CDS_pept        39878..40558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67394"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0W0"
FT                   /protein_id="ABI67394.1"
FT                   /translation="MFFFTQQNTARIVEAYVGEYASGKSEVAINRALELKKQGREVTLV
FT                   DLDTVEPFYTLRTLKNELEKKGLKVLAFTRAQSFGLGETGAMLNPAARWALKQEGDIIL
FT                   DVGYGVFGAQTLNLVEGANESPELKVMAVINYSRPMTGNRERIKSYIKNLGRVDAIVAN
FT                   THMGDESTIDLTKTGNQEIFIVAAELGIPIAYQVLDEKLKDSGEKNWEIPVKYIKRFMP
FT                   TAIW"
FT   gene            40637..41725
FT                   /locus_tag="Swol_0036"
FT   CDS_pept        40637..41725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0036"
FT                   /product="putative keto/oxoacid ferredoxin oxidoreductase,
FT                   alpha subunit"
FT                   /note="KEGG: chy:CHY_0043 putative keto/oxoacid ferredoxin
FT                   oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67395"
FT                   /db_xref="GOA:Q0B0V9"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V9"
FT                   /protein_id="ABI67395.1"
FT                   /translation="MPKIFEAGKKAFITGNEAVAWAALAAGAEIMFGYPITPQNEVMHY
FT                   WTRLAPEYGKGFLQTEDELSAGFTVCGAVQSGKKAFTATAGPGNVLMQEPFGMAEAMRL
FT                   PLFAVIQQRGGPSSGTVVYSQQEVTLTTYGGNGEGHRIVYSTATHQEIYDYTIKGFNTA
FT                   WKYRFPTFLLGDGYQAKMREPLEMYNPEDRGIEMVKTYPLVGLQGKIGEDREPQHLCNI
FT                   YSLEEELYEVVLKFAAEYEAITPELVEYEEKECEDAEIIILSHGVVSRAADDAVKILRA
FT                   QGIKAGYFRPITLRPFPQKQLREAINRKPARKLLIAESAYGQLDRLTKQEIYGETVAIE
FT                   NLFMPGVGIIDYDIINKVKSIM"
FT   gene            41746..42501
FT                   /locus_tag="Swol_0037"
FT   CDS_pept        41746..42501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0037"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="KEGG: chy:CHY_0044 putative keto/oxoacid ferredoxin
FT                   oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67396"
FT                   /db_xref="GOA:Q0B0V8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V8"
FT                   /protein_id="ABI67396.1"
FT                   /translation="MGMIAPAIPKSWYLPSKPHKFCPGCGHGIVLKALGETIDELEIQD
FT                   QVVFGCDIGCSLLSWNFFACDSTQTHHGRTTPVMVGIKRSRPELITIGYMGDGGGYSIG
FT                   SQHLLNSAVRNEKVTLILVNNTNYGMTGGQMAPTTLPGQKTETSPFGRDVDLTGYPTRG
FT                   PEFIAELTPDSAYVARATVSKYKQLRRFLRNALRNQMEGNGFSFVEVLSTCPTNWRTNA
FT                   QQTWHFLEDEMEQYFPIGEIKTPFGKGDK"
FT   gene            42502..43089
FT                   /locus_tag="Swol_0038"
FT   CDS_pept        42502..43089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0038"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="KEGG: chy:CHY_0045 putative keto/oxoacid ferredoxin
FT                   oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67397"
FT                   /db_xref="GOA:Q0B0V7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V7"
FT                   /protein_id="ABI67397.1"
FT                   /translation="MSLIKIALAGEGGQGVQSVAEILAEAAYNENKQTIYIPNFGLEQR
FT                   GGVSIAFIQVSDERIGAPKFNKADVVVALSERAIGRTAIYSDINTLYVYDSGFMAKPED
FT                   LPREARKIIGIPAVDTANRQLHPKVFNIIIMGTVIGLTNVVSFEAAKEALESKLAYKFE
FT                   KNPDLRELNFKALAIGKEMAEQSLKEGVGNNA"
FT   gene            43738..45267
FT                   /locus_tag="Swol_R0008"
FT   rRNA            43738..45267
FT                   /locus_tag="Swol_R0008"
FT                   /product="16S ribosomal RNA"
FT   gene            45511..45587
FT                   /locus_tag="Swol_R0009"
FT                   /note="tRNA-Ile1"
FT   tRNA            45511..45587
FT                   /locus_tag="Swol_R0009"
FT                   /product="tRNA-Ile"
FT   gene            45777..45852
FT                   /locus_tag="Swol_R0010"
FT                   /note="tRNA-Ala1"
FT   tRNA            45777..45852
FT                   /locus_tag="Swol_R0010"
FT                   /product="tRNA-Ala"
FT   gene            45990..49518
FT                   /locus_tag="Swol_R0011"
FT   rRNA            45990..49518
FT                   /locus_tag="Swol_R0011"
FT                   /product="23S ribosomal RNA"
FT   gene            49574..49687
FT                   /locus_tag="Swol_R0012"
FT   rRNA            49574..49687
FT                   /locus_tag="Swol_R0012"
FT                   /product="5S ribosomal RNA"
FT   gene            49802..49910
FT                   /locus_tag="Swol_R0013"
FT   rRNA            49802..49910
FT                   /locus_tag="Swol_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            50025..50133
FT                   /locus_tag="Swol_R0014"
FT   rRNA            50025..50133
FT                   /locus_tag="Swol_R0014"
FT                   /product="5S ribosomal RNA"
FT   gene            50562..52064
FT                   /locus_tag="Swol_0039"
FT   CDS_pept        50562..52064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0039"
FT                   /product="Orn/Lys/Arg decarboxylase, major region"
FT                   /note="KEGG: mta:Moth_2265 Orn/Lys/Arg decarboxylase, major
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67398"
FT                   /db_xref="GOA:Q0B0V6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V6"
FT                   /protein_id="ABI67398.1"
FT                   /translation="MWGGKISQRMSPNSLRRFGILQHKATPIYSALKSYMAENNLRLHM
FT                   PGHSGGKGFKVEELRAVAAMDLSEVPGLDDLHLPTQAIKSARSLLADAFGAGQSLFLVN
FT                   GATSGIHALFLSLLPEGTKVIVPRNAHRSFYGGMVLSGALPVYLPCRLAPGLGVALANR
FT                   SEDIYHLLKQNPEVKGVFLCSPSYYGTCSELDQISLLLREKNKLLLVDEAHGGHFPFHS
FT                   AYPRPALQSGADAVVNGLHKTLPVLNQGACLHLAAGFVEWEQVLATWSLLTTTSPSYPI
FT                   LASIDLARQLMVEEGYSLLERAACLSQNYKSRINQIKGLHCFEEEELKALPGISGVDPL
FT                   KVLISTQGLIIDGLALAKLLRQKYRIQVELAAPEIILAIMSIFHEGDDWERLYRALEEL
FT                   ARDYRARAPVSLVEGEIPPLPCLILAPREAYMATKISLPLDECRGAIAGEIIAAYPPGI
FT                   PCLLPGELIDDTMLDYLRYLKKSGLRLQGPQDPALNYVKIIE"
FT   gene            52122..52754
FT                   /locus_tag="Swol_0040"
FT   CDS_pept        52122..52754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0040"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: sth:STH3258 thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67399"
FT                   /db_xref="GOA:Q0B0V5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V5"
FT                   /protein_id="ABI67399.1"
FT                   /translation="MENKGLFISLEGIDGCGKTSVKEGLLQYFSKFPVLSIREPGGTLI
FT                   SEKIREILLDEKNQEITARTEAFLYAAARSQLVEELIRPALLQGKIVLADRYLDSTIAY
FT                   QGYGRGLDLGFLTTLNQLCTSGLKPHLTLLLDIDPAEGQRRKKKDIPDRLEKEGIEFQS
FT                   RVREGYLKIARQESERIKLLDAGKDFKEVLQEAIEYIEDIWPARGRA"
FT   gene            52898..53347
FT                   /locus_tag="Swol_0041"
FT   CDS_pept        52898..53347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67400"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V4"
FT                   /protein_id="ABI67400.1"
FT                   /translation="MKIERGKKELRGFSLLGKADSREIRRGNASSFEQELSQKREAESQ
FT                   LRMQEILKKLDKLGEQLKHKVNLNDLMLYKKLIRNFLQEATAKAYLLQKERGRNRRGRT
FT                   VLTTISIVDQEVEQLINDFIGKKKEAVDILTTLDKIRGMLVDLMI"
FT   gene            53368..54330
FT                   /locus_tag="Swol_0042"
FT   CDS_pept        53368..54330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0042"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gsu:GSU2230 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67401"
FT                   /db_xref="GOA:Q0B0V3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V3"
FT                   /protein_id="ABI67401.1"
FT                   /translation="MDIFSSIVGQERASSLLQKSLETGTISHAYLFLGPAGVGKMSCAR
FT                   AFAQAIIGRDDNDAMVFFREKIHPDLLILEKEEGRSVISKEQISQKLEPWLGLKPYRAS
FT                   QRVAIIRDSQLMSNEAANALLKNLEEPPEYAVIILIADDQNILETIVSRCQLVRFNSLA
FT                   DKDIEQILRNREVEPLKAAQAASLGQGSVATAIRFAQEKDYEKIWETSRNIITDLSGEE
FT                   IVEVYKSAERMELAPELIVNLLISLLRDINIYQQTRKEELLVLPGSSELANSIRQVQPQ
FT                   HLTAALDKIMNLKNYYRSNVNSLIINVNISYEIWQAFNS"
FT   gene            54585..55301
FT                   /locus_tag="Swol_0043"
FT   CDS_pept        54585..55301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67402"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V2"
FT                   /protein_id="ABI67402.1"
FT                   /translation="MVWVVGVRFKPAGKIYHFACEGHDLEEGDPVIVETVRGVEYGIVA
FT                   VGKRDLDGEKLIQPLRNVIRKAKPEDSKTWEKNQQKGREALDICKQKIKEHQLPMRLID
FT                   VEYTFDLGKIIFYFTAEGRVDFRELVKDLAAIFKTRIELRQIGVRDEAKMLGGIGACGR
FT                   ILCCKSFLGEFQPVSIRMAKEQNLSLNPTKISGICGRLMCCLKYESELYDTATNGENQH
FT                   GKNSSRAKNNNSGTDS"
FT   gene            55303..55524
FT                   /locus_tag="Swol_0044"
FT   CDS_pept        55303..55524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BG10097 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67403"
FT                   /db_xref="GOA:Q0B0V1"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V1"
FT                   /protein_id="ABI67403.1"
FT                   /translation="MGQLKERVTYLERDSSLGQPPQLPEPPSWPDIEVESYENLGKVYK
FT                   EGYHICPAAFGQSRNEECLFCLAFMEKE"
FT   gene            55528..56283
FT                   /locus_tag="Swol_0045"
FT   CDS_pept        55528..56283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0045"
FT                   /product="SAM-dependent methyltransferases"
FT                   /note="KEGG: pca:Pcar_2227 SAM-dependent
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67404"
FT                   /db_xref="GOA:Q0B0V0"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0V0"
FT                   /protein_id="ABI67404.1"
FT                   /translation="MDKVNMMPDDQEESLDDLVLGGMKLFQSREGYRFSLDAILLAHFP
FT                   VLDGIKQAVDLGTGNGVIALLLAYRAPSLRVTGIEIQESMIKRARKNIAFNHLEERIDL
FT                   IQADIKNIKEYLPPQGAELVVSNPPFWKKGEGKLSLNPEKAVARHELEVELADLVRAAA
FT                   YILLPRGCFCLIQRAERLQEIARLFSANGLVLRRIRPVYPLPEREARMILLEGQKGGAG
FT                   GLTILPPLFVYENPGVYSAELQKLYGFSK"
FT   gene            56294..57145
FT                   /locus_tag="Swol_0046"
FT   CDS_pept        56294..57145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0046"
FT                   /product="methyltransferases"
FT                   /note="KEGG: tte:TTE0104 predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67405"
FT                   /db_xref="GOA:Q0B0U9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U9"
FT                   /protein_id="ABI67405.1"
FT                   /translation="MKTGKLYICGTPIGNLDDVSIRLLKTLRKVDLIACEDTRMTIKLL
FT                   NRFKIKTRMISYHEHSKREKEDYLIAQLLQGQNIALVSDAGMPTISDPGEELIRRALQT
FT                   GIPLEVIPGPSALTAALALSGMDTSAFTFAGFLPHRRSRRRGELEQLQSEQKTIILYEA
FT                   PHRLRECLLDIVEIMGAERKLAIARELTKKHEEIRRGTAGELLHHFSASPPRGEICLLI
FT                   APAEDKAAETNWELIIAETEELINLGMDKKEAFKIKAKNYGIKKNELYKYFVEKKRPGI
FT                   QD"
FT   gene            complement(57280..57531)
FT                   /locus_tag="Swol_0047"
FT   CDS_pept        complement(57280..57531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0047"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: tte:TTE0106 transcription regulator AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67406"
FT                   /db_xref="GOA:Q0B0U8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U8"
FT                   /protein_id="ABI67406.1"
FT                   /translation="MLKSTGVVRKVDELGRIVIPIELRRTMGIEEKDALEIYVDSEKII
FT                   LKKYEPACIFCGNAEEVVNYKGKNLCKSCLTELSKQVI"
FT   gene            complement(57742..57858)
FT                   /pseudo
FT                   /locus_tag="Swol_0048"
FT   gene            58002..59939
FT                   /locus_tag="Swol_0049"
FT   CDS_pept        58002..59939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0049"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="KEGG: tte:TTE0110 methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67407"
FT                   /db_xref="GOA:Q0B0U7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U7"
FT                   /protein_id="ABI67407.1"
FT                   /translation="MQRKKSYYITTPIYYPSDNLHIGHAYTTVAADCMARFKRMQGYDV
FT                   FYLTGTDEHGQKIEKAAREKGMEPIKYVDGIVESIRQLWETMLITHTDFIRTTEARHEQ
FT                   LVQKIFNKVYEQGDIFISQYEGWYCTPCETFFTERQLAEGNCPDCGREVELLKEESYFF
FT                   NMSKYADRLLEHIETHPDFIQPESRRNEVVNFIKMGLEDLCVSRTTFQWGVPVPFNQKH
FT                   VVYVWFDALINYLTAIGYMDDEEKFKQYWPADVHLMAKDIIRFHAIIWPIMLMALDLPL
FT                   PKKVCAHGWIMLEGGKMSKSKGNVVDPVVLVKKYGVDAVRYYLVRELSFGQDGYYSEEM
FT                   LVNRINSDLANDLGNLISRTIAMIERYFDGVIPVSGIAEALDEDLINTAREAYREATEK
FT                   LDKLDFASYIMATRKLVSRANKYIDETAPWLLAKEVAKKERLASVMYNLAESIRIALIM
FT                   LAPCMPTLLSRANRQIEIFDLNQNLDWDEAAEWGRCKAGSKVRRGEPLFPRIDIKSLES
FT                   GEQLPMESPGEKKVEKSPPAVTELVDIEEFARIDLRVAEVIACEKMKKADKLLVLRLRV
FT                   GEEERTVVSGIAQYYSPEELLGKKVVLVANLKPVKLRGVLSQGMILAADGDKVEVLLVD
FT                   QDVPSGSRVK"
FT   gene            59940..60710
FT                   /locus_tag="Swol_0050"
FT   CDS_pept        59940..60710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0050"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: chy:CHY_2620 hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67408"
FT                   /db_xref="GOA:Q0B0U6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U6"
FT                   /protein_id="ABI67408.1"
FT                   /translation="MLIDTHAHLQDPAFNQDRKEIMQRAKTAGLEKIICIGYDYETSVE
FT                   AVQLARQFPEVYAVVGVHPHDAKTLSTGVLAQLYDLARDPRVVAIGETGLDYYRNLSSP
FT                   EEQRKAFKEQIKLAHELYKPLVIHDRDAHQEVLDIIKKEKAGKNEGIMHCYSGHLPLAV
FT                   ELMKEGFYISFAGPLTFKNAKKTQEVAARVSLERILIETDCPYLTPEPFRGKRNEPALV
FT                   VHTARKLAELRHKTEEEIAYITSQNARRIYRIKD"
FT   gene            61276..62238
FT                   /locus_tag="Swol_0051"
FT   CDS_pept        61276..62238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67409"
FT                   /db_xref="GOA:Q0B0U5"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U5"
FT                   /protein_id="ABI67409.1"
FT                   /translation="MGIVWSKQRAYLAAVLGLVLLVSLFFALQKPVSIEVDGKLIKSSV
FT                   FFSGTVREVLDKNHITLKEKDKVEPSLNAPVKKKMKITVVRAFKVKVVADGCSREVLSI
FT                   PVSIKEAIKLAGFQLGEQDIIKTTATSLTIPNQEIEIIRVTQEEQEVKEPIAFQMERTS
FT                   DNTLERGLSRTIKQGKNGVALNTFKVTYHNGKEVKREVIGSKTLLEPVNKLVALGTITS
FT                   VSRAGQRLDFREAKYMNASAYTYTGRNTATGRQPAVGLVAVDPSVVPMGSKLYIEGYGY
FT                   AEAADTGGAIKGNRLDLFMEERSQCLNWGNRTVKVYILE"
FT   sig_peptide     61276..61365
FT                   /locus_tag="Swol_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.755) with cleavage site probability 0.739 at
FT                   residue 30"
FT   gene            62406..63020
FT                   /locus_tag="Swol_0052"
FT   CDS_pept        62406..63020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67410"
FT                   /db_xref="InterPro:IPR019076"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U4"
FT                   /protein_id="ABI67410.1"
FT                   /translation="MKKKLLYLLCFSLMFMLLAGGCQKTTAKKPMAPSAKKPTQTSQMT
FT                   PSERRVLASKLSKMAEQVKGVEKATVVVADIGVANNITGNTKANAQMNRATAKNLNDNT
FT                   IGSDAGINRSEPQGMIVMVGLTLKPGNNDMNKSNQIKSKVMNKLKAGDRRISQVLVTTD
FT                   PNLVKRITDVAAGILEGKPIKTFEKDIMNIDSSLRQQKTTY"
FT   sig_peptide     62406..62471
FT                   /locus_tag="Swol_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.368 at
FT                   residue 22"
FT   gene            63394..64278
FT                   /locus_tag="Swol_0053"
FT   CDS_pept        63394..64278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0053"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="KEGG: mta:Moth_0052 dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67411"
FT                   /db_xref="GOA:Q0B0U3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U3"
FT                   /protein_id="ABI67411.1"
FT                   /translation="MKRTDSLSGIRYYMNKYGIHPRKKWGQNFLVDGNILRKIAHLCNP
FT                   GCEKLLVEIGPGLGGLTRELAGISKGVLAIEIDFGLREALAESLQGLNNIRLLFADILQ
FT                   IDLEEELSKAFGGEDISGYKVCANIPYNITTPIIFKLLETCSQMESATLMMQKEVASRI
FT                   LASPDSKEYGLLTLMTAYYAEAEYLMPVSRNCFYPRPEVDSSVIQLRPIKGKRVQVKDE
FT                   SNFKKLLRVSFQKRRKTILNICVDLFSVEKAEIHSILNSLGIDPKSRPENLSIEQFALI
FT                   SDTLVMRRLGNDI"
FT   gene            64268..64741
FT                   /locus_tag="Swol_0054"
FT   CDS_pept        64268..64741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH3248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67412"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U2"
FT                   /protein_id="ABI67412.1"
FT                   /translation="MIFNSPSKGELDLEQVVIDILNYIAEDLTRSYKLIVGSDSHPGAQ
FT                   GTCYVSAIIIHRMGKGARYYYNKIVNRRSSSLRQRIFYEASLSLDLADRLSQCLKKHGK
FT                   DDMKVEIHLDVGIQGDTKELVKEVTGMIVGSGFAAKIKPDACAASTVADRYTK"
FT   gene            64925..65203
FT                   /locus_tag="Swol_0055"
FT   CDS_pept        64925..65203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH3247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67413"
FT                   /db_xref="GOA:Q0B0U1"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U1"
FT                   /protein_id="ABI67413.1"
FT                   /translation="MNSPRAISDIKKDLESFVGSKIRLKANRGRNRIIEKEGVLESIYP
FT                   NIFVVKLDERKIERRVSYTYADVLTETVELFVYDTEDAEIRIAAANH"
FT   gene            65575..66408
FT                   /locus_tag="Swol_0056"
FT   CDS_pept        65575..66408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67414"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0U0"
FT                   /protein_id="ABI67414.1"
FT                   /translation="MGEALSIWSPVVLAELSTPRSFDHHQVYHLDERFQGLEDLRVKLR
FT                   EYIVRKQGNALETLFKLEVFCLLENMDGKMQLVKKEENLRDRVLLQEFDCNLDFDKEPR
FT                   IDFIGDIKKINWQGGLDGNQLHVILFIDYILMAIRQQVIRLLEQEAELKSSDLRVEGAA
FT                   QDETVRMEEKNLELRRQLRFYEKNIASLKKGIKKVENRNAVLSRESQQYQLLIEELRRA
FT                   IQEKEQRLSRYEARLYYEDNQDNVYEEIYSNNEGNERISGNSLGSRVKRLFLNSI"
FT   gene            66575..66877
FT                   /locus_tag="Swol_0057"
FT   CDS_pept        66575..66877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67415"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T9"
FT                   /protein_id="ABI67415.1"
FT                   /translation="MGESKFMEGKNLGILKVNTQKYQATQLAAGDDEGQFMISTAKKSS
FT                   LKAKNICPRCQERVNKQEMKSCEHCGSELCAKCLKDYQKKHLKAPVKRDSSIQGN"
FT   gene            66946..68277
FT                   /locus_tag="Swol_0058"
FT   CDS_pept        66946..68277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0058"
FT                   /product="Glycosyltransferase-like protein"
FT                   /note="KEGG: sth:STH1376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67416"
FT                   /db_xref="GOA:Q0B0T8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T8"
FT                   /protein_id="ABI67416.1"
FT                   /translation="MSNINCILYPPTVDFHYLVQRPQHLIKNFSELGVVSFFLNNPHLH
FT                   EHQRRGIERINPYLFLFNGVEPTEFLRDIRPVVYYSATAHVDMIKKYRPSLVVFDSVDE
FT                   PSDEFAGWRPYYHRAVATADIVITTSDKLYKMAKSINPRSFLVPNACDYEHFSPSTHLP
FT                   IPADMRGINNPVIGYIGAIATWVDLELLDRVAARLPHFNFVMLGPLYNVSELPQRPNLH
FT                   WLGFKDYKDLPAYAQAFDVGLIPFKLSSMTESVNPIKMWEYMAAGMPVVATALPEVYKL
FT                   QELIYYSENEEEFIENIRRALATDNPFQRKQRMELARQNSWSARAVEILDLIENALAEK
FT                   GIKKTEYRADGIMDTLLPDRAYTEFKEPFRTSLSPFQQVLVSPGSGFRYSIYPGKEYRD
FT                   RDRVRNVWSRADSAFPAGDIAVVQKSGFRYYTQRHQKELGLYYG"
FT   gene            68335..69069
FT                   /locus_tag="Swol_0059"
FT   CDS_pept        68335..69069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T7"
FT                   /protein_id="ABI67417.1"
FT                   /translation="MIVTAEKIMIGCPVRNRAWSLAYYLTSLKRLAYPESRLEFCFIIN
FT                   DCIDETPRILEDFAQRENGRVRLIYYDLGQKYGHLRGQYNFSQLARLRNCLLGAFLESD
FT                   AAYLFSVDSDILVPVDSLSLLLQDDCDIVSALVCNGEEVGDNSIYNILVKDAAGNLVHC
FT                   RDFPRDRIFPVDCTGAAYLIKRKVIASLGVRYSAEEGAEDIGFCLQAQEKGIGIFCDGR
FT                   IECIHLMREDTTLLSPKKTKIP"
FT   gene            69180..69746
FT                   /locus_tag="Swol_0060"
FT   CDS_pept        69180..69746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67418"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T6"
FT                   /protein_id="ABI67418.1"
FT                   /translation="MSRLLKCEFPEGCMLDLWAKVIKAKYIEKQVKVLDTVFCVPDEQV
FT                   GGKVSCVEDIKVKVIKAYEDLCFNKVKVFIDYEVILFVLVEGEYQIITVTDRYEQSIEL
FT                   DEFDPPLTSEEFRNEIEQSEIILKNWSFDFEIKGNCEDSSNPCKLTTPIKGTCIGLKVY
FT                   VDIIDKLGKFHDVVVYGELDPDVDY"
FT   gene            69824..70042
FT                   /locus_tag="Swol_0061"
FT   CDS_pept        69824..70042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T5"
FT                   /protein_id="ABI67419.1"
FT                   /translation="MSSIKISRQDKNLMRKQLEEILSIQKDLDKKIDNYQQESVVEEYR
FT                   GFWQELGQNNKDSIQRVSRYMVRKCNR"
FT   gene            70204..71064
FT                   /locus_tag="Swol_0062"
FT   CDS_pept        70204..71064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK1101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67420"
FT                   /db_xref="GOA:Q0B0T4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T4"
FT                   /protein_id="ABI67420.1"
FT                   /translation="MKSLGLALGGGGLKGLAHIGVLQVLEENSIPISAISGTSAGSIVA
FT                   ALYASGLSPWRMQELAMQLEVKDYIDYDIIAFAKFFWALLLPGVKASLDGLIKGDKLEK
FT                   LLYKWTRGKTLAESRIPIGIIACDIDSGQEIIFTNQNMEVTGPRLVIKEALLSEAVRSS
FT                   TSIPATFVPLQFRGMQMVDGGVKEMVPVEVQKIMGTDYILSVNLGRESYAEKVTGITQI
FT                   VSRSLNIMSYETSATAEALFADLVIHPRVKAVRLDDIGQAEKIIRAGRRAAKAKIDEIK
FT                   RGLED"
FT   gene            71484..72050
FT                   /locus_tag="Swol_0063"
FT   CDS_pept        71484..72050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0063"
FT                   /product="pro-sigma-E processing factor spoIIR"
FT                   /note="KEGG: tte:TTE2552 pro-sigma-E processing factor
FT                   spoIIR"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67421"
FT                   /db_xref="GOA:Q0B0T3"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T3"
FT                   /protein_id="ABI67421.1"
FT                   /translation="MPKKYYGIIMIAILILLGTSLYLQEKPLNKSVLRLHVIANSDSLA
FT                   DQALKIQVKDAVVEMMKKEFAGMDNMEQARQAALEDIPEIKRTAEAVVQANGYNYPVQV
FT                   SLGEYQFPTKSYGNLVLPQGEYQAVRVTIGGGEGKNWWCVLFPPLCMVSSSEQGLSLHS
FT                   PEEAKVSFKCLELIPKGAKFRTSNH"
FT   sig_peptide     71484..71561
FT                   /locus_tag="Swol_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.775) with cleavage site probability 0.415 at
FT                   residue 26"
FT   gene            72232..73089
FT                   /locus_tag="Swol_0064"
FT   CDS_pept        72232..73089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0064"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: bcl:ABC0074
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67422"
FT                   /db_xref="GOA:Q0B0T2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0T2"
FT                   /protein_id="ABI67422.1"
FT                   /translation="MRRNIILKAPAKVNLTLDVKGKRSDGYHELETVMHQVNLLDIIII
FT                   SQAAGGIQIKSNSSLIPTNEENLAYQAAEMILGEYAHKEGVEIYIEKNIPVGAGLAGGS
FT                   TDAAAVILGINQLYDLGLEEEELLEMAASIGSDVAFCLAGGSKLARGRGEILSKLPQRM
FT                   IPYIILVKPDFQLSTAEVYRELDLTQVEEFPDNAAFLAAWEAYDIINIARNMRNVLETV
FT                   SIRKYPEIAAIKAELIETGALNALMSGSGPSVMGIFMEEEQALKAREKFQTRYQEVFLL
FT                   SSYV"
FT   gene            73182..73889
FT                   /locus_tag="Swol_0065"
FT   CDS_pept        73182..73889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0065"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: chy:CHY_0189 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67423"
FT                   /db_xref="GOA:Q0B0T1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T1"
FT                   /protein_id="ABI67423.1"
FT                   /translation="MIFINTGEKRLSPVDLDSYKPLRELVLEAIREAIKNGVLKPRERL
FT                   MEIQLAEELGVSRTPIREALRKLELEGFIVMVPRKGAYVADISLKDVADVFEIRAALEA
FT                   LAAGLAAERITDEELEAMERLLVEKVEAISSNDMDKLVDVDTKFHEAIYRASRNQRLFA
FT                   IINNLREQIQRFRSTSLSYPGRMQQSMQEHRDIVEAIQSRDIQLSRQLAQEHIENAEQS
FT                   MIDSIKKNGLPWA"
FT   gene            73906..74682
FT                   /locus_tag="Swol_0066"
FT   CDS_pept        73906..74682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67424"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0T0"
FT                   /protein_id="ABI67424.1"
FT                   /translation="MQYDAVILAGGVNSSELKKIAPYDNEALIIIGKYPMIYYVYNALR
FT                   QSSQVRNIVISGPTEALRNIFAREEKLFFVEGGKNAVESLACAVKLLREKGTTERLLVL
FT                   PTDIPFITTTAIDDFANQCQNYEADFFYAITSREVNELKFPGVMRTYVKLKDGVFTGGN
FT                   LFILRSEIIDQVLEKASQIVERRKNPLAIASLFGFGLMWRYLTRRLSIAAAEKRFFKVL
FT                   GIKGKAIISPYAEVGVDVDKPSDLEIAQKYLLDLTL"
FT   gene            74850..76199
FT                   /locus_tag="Swol_0067"
FT   CDS_pept        74850..76199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0067"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="KEGG: chy:CHY_0192 UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67425"
FT                   /db_xref="GOA:Q0B0S9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0S9"
FT                   /protein_id="ABI67425.1"
FT                   /translation="MKLSAVILAAGKGLRMRSDLPKVAHRVAGKPIILHVIQAVKEAGI
FT                   EDIVVVVGHGREVVQEICSGEKIRFVLQEQQLGTGHALMQAEAVVAPEDTILVLAGDIP
FT                   LIQATSLQQLMESHRQKQATATVLSVNMQNPSGYGRILRDQQGAFLRIIEEKDANDEEK
FT                   KIKEINSGIYCFCARKVFSALHSTSTRNAQGEYYLTEALELLKNQQESIGIFLSDGEED
FT                   IYGINDRVQLAQAENILRQRKNRELMLSGVSLMDPASTFIDSDVLIGHDTIILPFTIIE
FT                   GNSRLGERCEIGPGTRISDSIIGSEVKIESSRLIQASVADRCNIGPFAYLRPETTLLEG
FT                   VKVGDFVEIKKSTIGTGSKIPHLSYVGDATIGQGVNVGAGTITCNYDGKNKYQTVLEDR
FT                   VFIGSNTNLVAPVRIGENSITGAGSTISRDVPPHTLAVERAGQKHLPRKG"
FT   gene            76275..77228
FT                   /locus_tag="Swol_0068"
FT   CDS_pept        76275..77228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0068"
FT                   /product="Ribose-phosphate diphosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: chy:CHY_0193 ribose-phosphate
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67426"
FT                   /db_xref="GOA:Q0B0S8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0S8"
FT                   /protein_id="ABI67426.1"
FT                   /translation="MQASRWRMKLFSGNANPQLADEIARYLGIPVGDARVSRFSDGEIS
FT                   CAIHESVRGVDVFVVQPTCTPVNENLMELLIMIDAFRRASATRINAVIPYYGYARQDRK
FT                   SRARDPITAKLVSNLIVQAGAQRVVAVDLHATQIQGFYDIPVDHLPGVPTLAEYFKTKG
FT                   LEEDAVIVSPDVGGVTRARDLATKLRAPLAIVDKRRPAPNVSEIMNVIGEVKDKSVIIV
FT                   DDIIDTAGTVCTAAEVMMEKGARDVYTCCTHAVFSGPALDRLSRAPLKEIVITNTIPID
FT                   ESKKLPNMTILSIAPLVGEAILRIHEDLEVSKLFEE"
FT   gene            77274..77903
FT                   /locus_tag="Swol_0069"
FT   CDS_pept        77274..77903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0069"
FT                   /product="LSU ribosomal protein L25P"
FT                   /note="KEGG: chy:CHY_0195 ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67427"
FT                   /db_xref="GOA:Q0B0S7"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0S7"
FT                   /protein_id="ABI67427.1"
FT                   /translation="MLGQKLNARKREIKNRGYLNQLKRSEQVPAVIYGKGEEAVPIILE
FT                   KRELNRIFNVHGSRGLFSLEIEGESKPMMTLIREIQRNPVSGQLIHLDFLSVNLNEKIN
FT                   SNVGVLLGGEEEVMKKGGILQAGLKEVEVLCFPQDLPEYLSADISSLEIGETLHVADLI
FT                   VPAGVEILTEAESVIASILAPSKATTGEEEGAEAAGEGEEAEEKPE"
FT   gene            77928..78479
FT                   /locus_tag="Swol_0070"
FT   CDS_pept        77928..78479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0070"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: bcl:ABC0081 stage V sporulation protein C,
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67428"
FT                   /db_xref="GOA:Q0B0S6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0S6"
FT                   /protein_id="ABI67428.1"
FT                   /translation="MKMLVGLGNPGKKYSHTRHNIGFKVLEELARRHQIEKEESRYDAI
FT                   VGHLRINQEKLLLVKPLTFMNLSGKAVRPLFNWFKLELSELLVVYDDMDLPPGTVRIRA
FT                   SGGTGGHKGMQSICESLGSRDFPRIRIGIGRPPGGAIDWVLGEFSESEKPLMQDAIEKA
FT                   ASAIECWVKSGIDASMNAYN"
FT   gene            complement(78490..78727)
FT                   /pseudo
FT                   /locus_tag="Swol_0071"
FT   gene            78850..79110
FT                   /locus_tag="Swol_0072"
FT   CDS_pept        78850..79110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67429"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0S5"
FT                   /protein_id="ABI67429.1"
FT                   /translation="MGSNPSSRCSGVLKLLRSFFRCFKKDGRRGRHMTIYYICEYCEQV
FT                   FSTVETEGQDGSVEVKGICEECAMEMGLLEPTSLGGKQYYN"
FT   gene            79300..82521
FT                   /locus_tag="Swol_0073"
FT   CDS_pept        79300..82521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0073"
FT                   /product="Transcription-repair coupling factor-superfamily
FT                   II helicase"
FT                   /note="KEGG: tte:TTE2565 Transcription-repair coupling
FT                   factor - superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67430"
FT                   /db_xref="GOA:Q0B0S4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0S4"
FT                   /protein_id="ABI67430.1"
FT                   /translation="MLLQEKFWDSLCGVLQKRQNILLTGLSGSAKAFMLSEILKKQNRK
FT                   LLCLLPEEEKAYDLARDLEAFIEPGRLFMFLARDFYFAKENLSTLEVGRILSLQHCLDH
FT                   PRQSAIIIATPGSFIYPLPAPSAMRESSLLLQQGKEKEQREILKKLVGGGYRRVDTVSR
FT                   QGEFAVRGGIIDIFPLGHKEPCRVEFFGELIESIHRFDINSQRRLGKDEGQVKILPADE
FT                   LYGDELTCSIFSYLDESSSVFFDEPREFYKQFKRSVRRYRESLKEACKDGKIIREIKLL
FT                   DSEYLKKEIEAHSVIYHAYFPSTIPQVAVTSLQHISQKEMEPFYRQYETLFARINDWQG
FT                   KGLKVILAIKSRVAREQIQQDLLEQGITGISYLDKIVEKGFSSSTLQVALLSESDIWGK
FT                   KTDPGSRKKHKHKGEERILLEDLKLGDYVVHESYGIGIFRGVSQVENSGITREYILLEY
FT                   AGTDRLYLPLEKLDLLFKYTSSGDKEPRLNKLGGSAWERTRKKVAQSIQDLAEDLLQLY
FT                   AHRESREGYAFSPDTPWQSQFEDEFPFRETPDQLKAINEVKKDMETRRPMDRLVCGDVG
FT                   YGKTEVFLRAAFKAIMDGKQVAILVPTTVLAEQHFQTFTERFAAYPAVIEVLSRFRSNS
FT                   EQKRIVEDLQKGVVDIVIATHRLLSRDVKFKDLGLLVIDEEHRFGVAQKEKIKALKELV
FT                   DVISLSATPIPRSLHMALTGLRDLSVIETPPPERYPITTYVLEYNEEIIVEAVMKEIER
FT                   QGQVFFVHNRIEDIYRVKEQLDELFPGIKIAVGHGRMKEDELSRVMMDFVNGKYQLFLC
FT                   TTIIESGLDMPNVNTIIVDEADKMGLAQLYQLRGRVGRSHRLAYAYLTYRPDWVISEAS
FT                   QKRLNAIREFNELGSGMKIALRDLEIRGAGNILGAEQHGYIQAVGFDLYCRLLEQETGR
FT                   LKGEQVQENRVDPQLDIDIDYYIPESYIPDSGSKMRIYRRLLLAGSQEEVEEIREEIRD
FT                   RFGPLPQAVENFLQIAALRLLARDKEIKSLRRKGRQIEIQTLQRLPGNLSEHLRGIRRV
FT                   NDHTLIIQKHENSSLPALAEILQML"
FT   gene            complement(82603..83700)
FT                   /locus_tag="Swol_0074"
FT   CDS_pept        complement(82603..83700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY4478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67431"
FT                   /db_xref="GOA:Q0B0S3"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0S3"
FT                   /protein_id="ABI67431.1"
FT                   /translation="MGNQTLSPQQITFMIFLFLTGSSLVFIPEILAGQSAWMACLLASL
FT                   TGLYIIIILLALFTRFPDMSITRISELALGRIAGSILNILFFFSLFLIAQGLLYNLCFL
FT                   LGLIYPAICGFILRSLVLLSAAYCIYRGPAMLGRLYESFIGLILFFFLLGIIASFPIMN
FT                   LSELKPLWPEWKPLLSGAFFVADWPFAQLVILAFFFPLVQGLKEKKKAFIGWYLLAVAV
FT                   LVFEDIQMISILGQELAEISRFPLLKVNRLTGFGEFRRVELFFFILWFIVGFTALTAYY
FT                   QGLVLNLKELLRLENPRPLILPLGLCLMVFTAYMYPSDLNYITTRLRYIPFFTMPINLL
FT                   YPTVIFIAASLSKGRLSSRHSRSEG"
FT   gene            complement(84289..85428)
FT                   /locus_tag="Swol_0075"
FT   CDS_pept        complement(84289..85428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY2110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67432"
FT                   /db_xref="GOA:Q0B0S2"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0S2"
FT                   /protein_id="ABI67432.1"
FT                   /translation="MPRRLLILIVLFLLPSYSACWDIQELNNSAVCTGAGVELSREGKF
FT                   IFSAQMVKPSAPGESGTQTSTAVVLSASGSGVADAARRFMLSLPRLPEWSSISTFIIGE
FT                   ELAREDMAMLGDFLLRNRSLRPTVNLVLSRGCTPEDILSLPMPLSPYSGKGLETILDLQ
FT                   EKQLGIYVPTNVNEFVHKLTTAGIEPVVPQVSIEEKKLFINGTAVFKGRRIVGSLNEGE
FT                   SRGYRWMNARSFNGGIIDLVSPQNPGELVILEIKQFTSKTTPTLEQDHLKMKIKVQAEL
FT                   VFYEKSKTAELLTLSGKEELERLAAQEIKQEISACIKKSQLLGSDILGWGYILQRHEPQ
FT                   LWESFSANWGNIFPTWESDIEVETLIVSSMLSQKSFRFR"
FT   sig_peptide     complement(85369..85428)
FT                   /locus_tag="Swol_0075"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.920) with cleavage site probability 0.744 at
FT                   residue 20"
FT   gene            complement(85442..85639)
FT                   /locus_tag="Swol_0076"
FT   CDS_pept        complement(85442..85639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67433"
FT                   /db_xref="GOA:Q0B0S1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0S1"
FT                   /protein_id="ABI67433.1"
FT                   /translation="MVWLLFAIYFAIIYIEVPGLLRGKMYRELGLFTAVLALGIYLSLS
FT                   QFYGWPLFNPFAPWIEVLMP"
FT   gene            complement(85752..86897)
FT                   /locus_tag="Swol_0077"
FT   CDS_pept        complement(85752..86897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67434"
FT                   /db_xref="GOA:Q0B0S0"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0S0"
FT                   /protein_id="ABI67434.1"
FT                   /translation="MKKSFLLLFLLLLGFNPGCGVTELDKASIPLGLGVDVDGEQIVVS
FT                   TELASPISPEQIESSSGPDFYVISGRGPTVVEAARKITLQIPRNPLWSHTNTMIIGEKL
FT                   ARQDMALFMDFLSRNRYVRKNIPVFVSSQSTPEEILSVKPPIEPHPSIAIKNILSLQEK
FT                   QLGIYVPIDLKEMEFRFLSPGIEPLVPQVSILESDTGKRLRLEGAAVFRGRKMVGSFNE
FT                   MESRGYRWMSPRRIQGGLFLVPSPLHSGKQISLELSRSQAQITPKLQEGAIIIQIKIKA
FT                   EGNFYEQNEVGELFTRERFRGIEELANQEIKRQILLAINKAQELNSDVFGWGQMIKQNY
FT                   PQQWEKMEGNWDELFPTVGKQIKVDFSLRRSYLADRSFKFQ"
FT   sig_peptide     complement(86835..86897)
FT                   /locus_tag="Swol_0077"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.679 at
FT                   residue 21"
FT   gene            complement(86965..88518)
FT                   /locus_tag="Swol_0078"
FT   CDS_pept        complement(86965..88518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0078"
FT                   /product="germination protein"
FT                   /note="KEGG: tte:TTE2379 germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67435"
FT                   /db_xref="GOA:Q0B0R9"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R9"
FT                   /protein_id="ABI67435.1"
FT                   /translation="MRFIKSKKPEKIDIPPGELVEQALSPVLQDNREKLKTLLTGCSDV
FT                   VMRDFMLASHSPIPGLLLYFDGLVDKEQVALHLLQPLLTEQGGDSSENLSPDEMLKRVQ
FT                   YRILSISEVKTLSNIEELLHHISSGDTVLLIDGCSSGLVAGTRSWQSRGIQTPENEITI
FT                   FGPKEGLSETLRFNTALLRRRIKSTNFKIENMVIGQLSKTDVALFYIEHIAPRSMVDEL
FT                   KKRLQAIDIDAVLDPRYLVEFVADEKRSIFTQEQYTEKPDRLCGYLLEGRIAIMVDGSP
FT                   MALIVPVSFLEHLISPEDYYINYIAASLFRLLRLGAFAIALLLPSLYVAVITYHHEMIP
FT                   TPLLLTLAATRQGVPFPAFVEALLLDLTFELLREAGLRLPRAVGPAVSIVGALIIGDAA
FT                   VRAGLVSTPMVVIIAATGIASFASPSYNAGIIIRIVRFGFLIASGLLGFLGIMIALILL
FT                   FVRMTSLSSLGLPYLAPVAPFNWQQLGDILIRRPWFNTKKRPYLEGMENQWRQGKSTGG
FT                   "
FT   gene            complement(88582..89706)
FT                   /locus_tag="Swol_0079"
FT   CDS_pept        complement(88582..89706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_2041 spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67436"
FT                   /db_xref="GOA:Q0B0R8"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R8"
FT                   /protein_id="ABI67436.1"
FT                   /translation="MFRISHFQLYCILLLLVGPVAFLETPNILIIHLGCNAWLAAIGAI
FT                   VPGILLAAMFQYIIKKSSQPFPLLLEEHLGKILGKILGFLYILAFLLASSFTLRLFVDF
FT                   IVTNVLPQTPISVFIGVLLLVGFVAIKSGLENLARCCELVVILGLPFAFLIFLAAIIEN
FT                   WNPGNLLPFARMDLTSFSLGLSSCSYVLGKMLPVLSLAFFCPRQKKIRQVMLLVIFSYV
FT                   ALMLATTLATLMTLDTTMSNIATFPTFSTIRLLHIADFIQNIDIVFIGIWILGVFGSVS
FT                   IPWFMACYTTQQLFALKDYRFLAAPSSLIIGVFSILMSKNIMELLAVSMHIIPLLYSFA
FT                   FILLPFLLFLLTLFKAYPESETLAEPEAKAESSA"
FT   sig_peptide     complement(89635..89706)
FT                   /locus_tag="Swol_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.754) with cleavage site probability 0.752 at
FT                   residue 24"
FT   gene            90252..90812
FT                   /locus_tag="Swol_0080"
FT   CDS_pept        90252..90812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0080"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: mta:Moth_0083 transcriptional regulator, AbrB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67437"
FT                   /db_xref="GOA:Q0B0R7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R7"
FT                   /protein_id="ABI67437.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDREGEVI
FT                   LKKYSPIGELGDFAKEYADSLNETIGHISMIADRDVIIAVAGANKREFLSKAIGKAVER
FT                   AIDERSTLIMNDLDAPDDDNLHVIQNDDREYTIKAQVIAPIITQGDPIGAVIIVSKEAV
FT                   KMGDMEVKLAETAAGFLAKQMEQ"
FT   gene            91283..92836
FT                   /locus_tag="Swol_0081"
FT   CDS_pept        91283..92836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0081"
FT                   /product="stage V sporulation protein B"
FT                   /note="KEGG: ctc:CTC00197 stage V sporulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67438"
FT                   /db_xref="GOA:Q0B0R6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R6"
FT                   /protein_id="ABI67438.1"
FT                   /translation="MQEKQNFLKGAMVLSIAGAISKIMGAIYRIPLARLIGGEGMGLYQ
FT                   MAYPIYTTILSLATAGVPVAISVLVSRKETQGYSGDSRKIFRVSLLILLVFGFLLTLLV
FT                   MQSASFIANSVLKEPRAYYPILAVAPAIFFAGLMSVFRGYFQGHQSMIPTAVSQVIEQL
FT                   FRVTAVLILAFLLFPRGLEYAAAGATFGAVVGGIIGLLVLLGYYYSFRKAQRRSGEMLA
FT                   YSGSTSVELGQEMVRLAIPVSFGAVVLPLVQMLDAIIVPGRLMATGYATSQATALYGEL
FT                   AGMAAVLISLPTIFTISIATSLVPAVSEALARNERKLLNDRLNYGFRAGMIISLPCAAG
FT                   LYVLAFPICDLLYATPSAGLPLEPLAFSCIVLAAFQLSSAGLQGIGKPQIAMRNLVITG
FT                   VFKVIFNYSLTGIPMLNIKGAAIGTVLAFLIGSFLNIIYLRKLTGISYEKGRMLKISLI
FT                   TVLMGLAVQFSYTTLVAADIRSHLATLIAISLGVLLYGILLFLIRELDINMLKRISGRD
FT                   "
FT   gene            93027..93794
FT                   /locus_tag="Swol_0082"
FT   CDS_pept        93027..93794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0082"
FT                   /product="MazG protein"
FT                   /note="KEGG: aae:aq_342 MazG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67439"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R5"
FT                   /protein_id="ABI67439.1"
FT                   /translation="MSKSGQAIEALLEVMDRLLAPDGCPWDREQTHESLQRYLIEESYE
FT                   VIEAIKMQDMHKLREELGDLLLQVVFHAALAEREGHFDFAGVADTVKKKMIARHPHVFS
FT                   HMDLKSSDEVMVHWESFKKKEGKKYLLEGIPIFLPALMRAEKMQEKAARVGFDWPGVEG
FT                   ALEKFKEEVEELVAATKPEEIKEEMGDVFFALVNVARLKNIDPEEALQSCNDKFTARFN
FT                   YIEKKIKAEGKDFADYGLEELDQIWDEAKTKGL"
FT   gene            93907..94179
FT                   /locus_tag="Swol_0083"
FT   CDS_pept        93907..94179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0083"
FT                   /product="bacterial nucleoid protein Hbs"
FT                   /note="KEGG: gka:GK2215 DNA-binding protein HU (DNA-binding
FT                   protein II)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67440"
FT                   /db_xref="GOA:Q0B0R4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R4"
FT                   /protein_id="ABI67440.1"
FT                   /translation="MNKTELVGQVAAKTGMTKKDVEKVVNAFFDTVEGVLKEDDKVQLI
FT                   GFGTFEVRARQARKGRNPQTGEEINIPATKVPAFKAGKALKDALV"
FT   gene            94181..94423
FT                   /locus_tag="Swol_0084"
FT   CDS_pept        94181..94423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE2478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67441"
FT                   /db_xref="GOA:Q0B0R3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R3"
FT                   /protein_id="ABI67441.1"
FT                   /translation="MRLDKYLKVSRIIKRRTLAKDFAESERVLLNGRVAKPSSEVKIGD
FT                   IITLRMGEKTVVYEVLDIKENIKAADAGNLYRIIE"
FT   gene            94606..94875
FT                   /locus_tag="Swol_0085"
FT   CDS_pept        94606..94875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67442"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R2"
FT                   /protein_id="ABI67442.1"
FT                   /translation="MAEHSIKLSNRRNMELTGIKNVNNFDEEKIILESEQGNIYIIGQD
FT                   LHIGTLNLEQGRVALEGNIDIIEYKAPGTDIKAKGKSIINRLLK"
FT   gene            94896..95342
FT                   /locus_tag="Swol_0086"
FT   CDS_pept        94896..95342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67443"
FT                   /db_xref="GOA:Q0B0R1"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R1"
FT                   /protein_id="ABI67443.1"
FT                   /translation="MEGECLLSVLLGQLKAFFLTLILGIFSGGLFHYYHLTVRKARIGR
FT                   YWLYLIDLILWVILLLIVFAFLLLINGAEMRLYVLLALACGIAIYFRYLSRYMTPILSR
FT                   AAQGSVEFSSGLARAIRSPFLHLFCYWKAQKDKGKTPPPGDSGN"
FT   gene            95394..95510
FT                   /locus_tag="Swol_0087"
FT   CDS_pept        95394..95510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0087"
FT                   /product="sigma-24 (FecI-like)"
FT                   /note="KEGG: mta:Moth_0090 sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67444"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0R0"
FT                   /protein_id="ABI67444.1"
FT                   /translation="MSVATLFNRARSKGYEVVIILPGDTLGLFKGEEEDGEE"
FT   gene            95539..95793
FT                   /locus_tag="Swol_0088"
FT   CDS_pept        95539..95793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_0091 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67445"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q9"
FT                   /protein_id="ABI67445.1"
FT                   /translation="MLVGVLCGLMLMIVAPKLKIIYQMNGQRYRLEQEKKELEMKNQEL
FT                   KARLKEMDSVVAIEKIAREQLGMVKKGEKIIIPLKEERP"
FT   gene            95874..96332
FT                   /locus_tag="Swol_0089"
FT   CDS_pept        95874..96332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0089"
FT                   /product="RNA binding S1"
FT                   /note="KEGG: mta:Moth_0092 RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67446"
FT                   /db_xref="GOA:Q0B0Q8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q8"
FT                   /protein_id="ABI67446.1"
FT                   /translation="MPTEQTNIVPGSIMEGKVQGITKFGAFIELPGGVVGLVHISEIAD
FT                   TYVKDVKDFIKEGESVKVKVLNVAGKKIGLSIKQVSPPPKSEPKAFERNYRSSRVAGNR
FT                   YSNSSVGKDNTATPISLDDKIAKFLKESDERMQPLKNKMEPRKRNRFN"
FT   gene            96525..97391
FT                   /locus_tag="Swol_0090"
FT   CDS_pept        96525..97391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0090"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="KEGG: chy:CHY_0211 Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67447"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q7"
FT                   /protein_id="ABI67447.1"
FT                   /translation="MRCAAIDIGTNSCRLLIADISPEGLRSLHRETRTTRVGEGLKNAI
FT                   HIQEDVIERNIYCLEAFKNIVEEMAVECYRVVATSALREAENQEEFLRSAWKKTAMQIQ
FT                   VISSEEEARLSYLGVSRGLPYLESPLVADLGGGSLELILEGAEPIFLSLPLGAVRAMEQ
FT                   NLKITEINAVMSPLAFHKNDLAPHPLVMVGGTATTLVAIKHSLLQYDPSLVHGQLLKRE
FT                   EIADIYNMLERMPLNLRRRLPGLQPERADIIPWGTRIVLLLMDILEKGEITVSESDLLE
FT                   GVIWSLA"
FT   gene            97799..98680
FT                   /locus_tag="Swol_0091"
FT   CDS_pept        97799..98680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0091"
FT                   /product="Formate/nitrite family of transporters"
FT                   /note="KEGG: tte:TTE0064 Formate/nitrite family of
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67448"
FT                   /db_xref="GOA:Q0B0Q6"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q6"
FT                   /protein_id="ABI67448.1"
FT                   /translation="MNFLTPAEIAVATANAGKAKCELPIIKMFVLGILAGVYIGFGANL
FT                   ATKIGSMAASDTSGGQFLFGAVFSVGLMLVVIAGSELFTGNCMFCCISSLNGQSSWGGL
FT                   LYNWVVVFLANFVGSVLLVYIIFYGGFWGDGAVATAISAHGIKALGIAKAKLSLTWGQA
FT                   FFRAIGCNWLVCLAVWVALASKEIIGKIFGIFFPIMAFVSSGFEHSVANMFFIPMGITI
FT                   AQNNPELVAAATKVGADGTAVSVFNMTADQVTAFFTYGNFITANLIPVTLGNIVGGSIF
FT                   VAMFYWFIYLKK"
FT   gene            98849..99091
FT                   /locus_tag="Swol_0092"
FT   CDS_pept        98849..99091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q5"
FT                   /protein_id="ABI67449.1"
FT                   /translation="MVVALTLRVLLVLHPAGVTIKVVAMGVSKKSDQFLGQGTCPRVPK
FT                   SSGKIAKIAFSQQILYKEKTGSRPQITKFTSISCL"
FT   gene            99163..101637
FT                   /locus_tag="Swol_0093"
FT   CDS_pept        99163..101637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0093"
FT                   /product="Phosphoprotein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: tte:TTE2396 serine phosphatase RsbU, regulator
FT                   of sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67450"
FT                   /db_xref="GOA:Q0B0Q4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q4"
FT                   /protein_id="ABI67450.1"
FT                   /translation="MLGKTEIYPYQRVAEKAGNRPRGKKHEWMQNFKERSGRGQAYLRD
FT                   FIRKEGSTVLHSLLNLENLLLAVGALILSRAFVLGDLLPFVYAYLAVFGRNEKGRAFLL
FT                   LAFASLGLASVLHGFALGSSIISLVILLAVLNRLKISPERAWWMLPLVSISVLFVCKSL
FT                   FLLGGEFTLYAEMVVVFEAVIAGVLGFVFMVAHEAIAQRKALASLNFEEFAAFLVLGIG
FT                   LVMGLNNIEIAGLSVSSIICRLGIMLAALLWGSGGGTIVGVMTGIIPSISSSIFAQSLG
FT                   MYAVSGLLAGLFRNLGRLGIVLGFMLGTMALSMFIPETQATVLGIWETAIASLLFFLLP
FT                   ESLQDKMPLQALGPLSSRLREQGEIIDKQLEESTRTRIQNLAAVFEELSSSFSGEMEVK
FT                   RKNNQVAYLNYLYEQVSQNFCEKCSRYDICWGRDSYHSSQQILELFSIVEKAELSYEKA
FT                   PRDFKRRCLYAREMISTINYLFDRLLLNEYWSDKLCESRELVATQLKGVSQLIKNLAQE
FT                   IDVKAEFDLELREQLLRESKQQGLKIKEMTPLRSNGQLLLNVVADPCREGEFCQNIIAP
FT                   AFSNILGERMEVCEKTCPRFRAWGQCKFTMSRACSYKINSGVVQVGKEAVCGDSFTIAS
FT                   LKEGKELIALSDGMGVGEKACGDSQATVRLLENLLESGFQRDVALNTINTVLLLRSAQE
FT                   SFATLDMIMVDLYSGDADFIKVGSAPSYIKRDKKVGMISAHSLPIGILENVDVVSERHS
FT                   LCPRDILVMVSDGVLEVSRQFNETWIIDFLSQVDESDPQLLAEMIMNKALGMCKGKPAD
FT                   DMTVICLRVELQ"
FT   gene            101735..103099
FT                   /locus_tag="Swol_0094"
FT   CDS_pept        101735..103099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0094"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: sat:SYN_02776 tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67451"
FT                   /db_xref="GOA:Q0B0Q3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q3"
FT                   /protein_id="ABI67451.1"
FT                   /translation="MLRKVREYIWEEKLLEPGKKVLLGVSGGPDSMALLHIMHKLTTEM
FT                   DLGLAVLHLNHGLRPEAAAEEEFVREHCRNWGIDFYSRQADIRALALQEKKTLEEAGRD
FT                   CRYRYFFEQLEELQADYIATAHHQDDQAETVLLHLLRGSGLKGLRGIMPRKGQLLRPLL
FT                   ALSKAEIIHYLDENQIPYCLDQSNNDLKFLRNRIRCELIPYLQKAYNPRIMESLNQLAG
FT                   IARDENDYLEKQLHFSWDKLLLWQEPGVIVLDKKALGEEHPALQKRLILEALARLRGES
FT                   GWELKDVQRILRLLDQSGSSKYIQLKQGLRVSSVYQELHFTNRPLREGSFCYPISVPGR
FT                   LSIPETGESYIIELGQPVTFQPGLSSCLDYDKLKQPLVLRSRQPGDRFQPSGMKGSKKV
FT                   KDYFIDIKLPLEQRDRVPLLTSGETVYAIVGYRVSRLAEVDAESCRILIIRKENT"
FT   gene            103565..105364
FT                   /locus_tag="Swol_0095"
FT   CDS_pept        103565..105364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0095"
FT                   /product="FtsH-2 peptidase. Metallo peptidase. MEROPS
FT                   family M41"
FT                   /note="KEGG: mta:Moth_0105 ATP-dependent metalloprotease
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67452"
FT                   /db_xref="GOA:Q0B0Q2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q2"
FT                   /protein_id="ABI67452.1"
FT                   /translation="MDRALKNIALYILIVLLALFAMKMVSRSDIEIKELSEPQFYQMVE
FT                   QGQVKAVRVEVAELVYNLSGELKNNSKFTATVSKESDIIKLLREKKVDYTTQPVPPPSI
FT                   WMTLLTTLFPIIILVVFLLFIMNQTQGGGGRVMQFGKSKARLMSGEDVKVSFKDVAGAE
FT                   EAKEEMQEVVEFLKNPQKFIQIGAKIPRGVLLYGAPGTGKTLMAKAVAGEAGVPFFSIS
FT                   GSDFVEMFVGVGAARVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGHDEREQTLN
FT                   QLLVEMDGFSTGEAIIVMASTNRPDILDPALLRPGRFDRHILIDKPDVKGREAILGVHV
FT                   QNKPLDDNINMEILAKRTPGFTGADLANMVNEAALLTARRNKNKIGMEELEESIERVLA
FT                   GPEKKSRVISEKEKRLVAYHEGGHALVSYFLPHTDKLHKISIIPRGRAGGYTLLLPEED
FT                   RNYITKSYLLDEVTTLLGGRVAEALVLNDISTGAQNDLERASGIVRKMITEFGMSEELG
FT                   PLTFGHKSEEVFLGRDISRDRNYSDAIAYAIDKEASHYMESSYKKAEKILQENMDKLHQ
FT                   VAARLIEQETMEGEEFEEIMSQA"
FT   sig_peptide     103565..103636
FT                   /locus_tag="Swol_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.604) with cleavage site probability 0.554 at
FT                   residue 24"
FT   gene            105539..106063
FT                   /locus_tag="Swol_0096"
FT   CDS_pept        105539..106063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0096"
FT                   /product="HD superfamily hydrolase"
FT                   /note="KEGG: cac:CAC2925 HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67453"
FT                   /db_xref="GOA:Q0B0Q1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q1"
FT                   /protein_id="ABI67453.1"
FT                   /translation="MKRVELLINDEFYTEYMRRNHEEELEPKFCQHDFQHHLNVARIAY
FT                   ILILEQNLLAYFVKESGLSGKLAGKEVIYAAGLLHDIGKWQEYRTGIDHASFGSRLARE
FT                   ILPRAHFNPLEIDLISRAVYEHRNIRQDMSFLGERLHRADNLSRVCRNCEYNEQCPKFK
FT                   NKELTISNFEY"
FT   gene            106252..107490
FT                   /locus_tag="Swol_0097"
FT   CDS_pept        106252..107490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0097"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: mta:Moth_0110 dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67454"
FT                   /db_xref="GOA:Q0B0Q0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0Q0"
FT                   /protein_id="ABI67454.1"
FT                   /translation="MQQGHHAVLIHDRREAQRLLQEIAVDSAAFVYLLPKAVFRCIKLK
FT                   EIPCIAANIIKQEMLAKGGEAAVKREALYLEGTTDILLLGTLKHYGLLLEKLKKQPFGL
FT                   KKIAAEIQAILDNLQAGERTIALAHGKELPLGQRTLIMGILNITPDSFSDGGRYMETGQ
FT                   AVERAREMREEGADIIDIGGASSRPQSQMIDEAEELRRVLPVVKSLSREGFILSLDTFR
FT                   AGVARACLDEGVHLINDIGRLQLDPGLLPVLAEKQAPVILMHNRMQLRDESGQVIDAEK
FT                   VTQDLMHYQDLISDIIKELGQSIEMAQEAGLGRNKIIIDPGLGFGKNLAQNRLLIKRLE
FT                   EFKSLGQPLLIGASRKTFIGQTLELEVGQRLEGSLAVVAMAIMNAADIVRVHDVRESKR
FT                   VAMMTDAVIRENG"
FT   gene            107483..107854
FT                   /locus_tag="Swol_0098"
FT   CDS_pept        107483..107854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0098"
FT                   /product="dihydroneopterin aldolase; RBL03201"
FT                   /note="KEGG: bld:BLi00094 dihydroneopterin aldolase;
FT                   RBL03201"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67455"
FT                   /db_xref="GOA:Q0B0P9"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0P9"
FT                   /protein_id="ABI67455.1"
FT                   /translation="MDKKVDKIMAQGLEFKACHGVLAAEKESPQSFLVDLDLFLDLKAA
FT                   AEQDDLALTIDYDKAFHLVKNIVEKQSYNLLETLAEKIARALLDSFAALQAVEVQVSKP
FT                   DAPVKGNFNYFAVKIRREK"
FT   gene            107909..108403
FT                   /locus_tag="Swol_0099"
FT   CDS_pept        107909..108403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0099"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: xft:PD0186 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67456"
FT                   /db_xref="GOA:Q0B0P8"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0P8"
FT                   /protein_id="ABI67456.1"
FT                   /translation="MKKRVYIGLGSNCGLKQENLAVARNKITELEGTRIVKSSSLYLTA
FT                   PWGRTEQEDFINQVIEIKTALEPLALLQDLQEIEIKMGRQRQEKWGPRIIDLDILLFGD
FT                   EVLDFPELKVPHPLMRQRLFVLVPLQEVNAELIFPDDGAKIKEVLISVLAREGNKKIKR
FT                   V"
FT   gene            108526..109422
FT                   /locus_tag="Swol_0100"
FT   CDS_pept        108526..109422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0100"
FT                   /product="NADP oxidoreductase, coenzyme F420-dependent"
FT                   /note="KEGG: mta:Moth_0140 NADP oxidoreductase, coenzyme
FT                   F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67457"
FT                   /db_xref="GOA:Q0B0P7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0P7"
FT                   /protein_id="ABI67457.1"
FT                   /translation="MREKIGIIGAGVVGTAVGVVLKNKGYEITGVQDIKSESTQQLVER
FT                   IGCTAYPSPQDVSHSADIIFVTTSDTAIASVVGQIADKRAFRPGQIILHMSGAQSSQIL
FT                   DQAKEFGALVLSVHPLQAFASIDRAIEILPGSVFSIEGDEEAYALGGRIVEALEGEYFF
FT                   IDRRAKPLYHAGACVVSNYLVTIIDFGIKLLEATGIPRNMAAKALLPLISGTVKNIENI
FT                   GIPKALTGPIARGDLATVADHLHCMEEMAPELMKLYSWLGFYTASIARGKGSIDEKSLE
FT                   EFQKLFLRELARIESAS"
FT   gene            109519..110349
FT                   /locus_tag="Swol_0101"
FT   CDS_pept        109519..110349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0101"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: sat:SYN_02773 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67458"
FT                   /db_xref="GOA:Q0B0P6"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0P6"
FT                   /protein_id="ABI67458.1"
FT                   /translation="MARVTVSVLKDKKKRKEKISMLTAYDYSLAGMVDEAGIDMILVGD
FT                   SLGNVVLGYDNTLAVTMDDMIHHSKTVVRASKNAMVVGDMPFLSYHISKKEAVRNAGRF
FT                   IQEAGCSAVKLEGGSERVDTVKAILDAQIPVMGHIGLTPQSVHQFGGFKVQGKDLETAK
FT                   KLVEDARALDQAGVYCIVLECVPSELARRVTEEISVPTIGIGAGPYCDGQVLVINDMLG
FT                   MFRGFTPKFVRKFANLEPLIMEALKNYKAEVEAGTFPAEEHCFTIKEEVLDRLY"
FT   gene            110511..111359
FT                   /locus_tag="Swol_0102"
FT   CDS_pept        110511..111359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0102"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: mta:Moth_0141 pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67459"
FT                   /db_xref="GOA:Q0B0P5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0P5"
FT                   /protein_id="ABI67459.1"
FT                   /translation="MQVFENITKMQEWAREQKKQGQSIALVPTMGYLHEGHLALVKEAR
FT                   RQCDKVVVSIFVNPIQFGAGEDFEQYPRDLEQDSALLEKERVDALFSPGIRDMYPGSFQ
FT                   TFVEVYGEITEKMCGASRPGHFKGVTTVVSKLFNICQPDRAYFGQKDAQQLMIVEKMVR
FT                   ELNFPLEIIRVPIVREKDGLAMSSRNVYLSPEERAEALVLYRALKMAEEEIKNGEREIG
FT                   IIRQKMEEMIKACPRAAIDYIAINNANDLSELQTCAGKVLIALAVKFGKTRLIDNLIVE
FT                   V"
FT   gene            111363..111719
FT                   /locus_tag="Swol_0103"
FT   CDS_pept        111363..111719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0103"
FT                   /product="L-aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: bce:BC1542 aspartate 1-decarboxylase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67460"
FT                   /db_xref="GOA:Q0B0P4"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0P4"
FT                   /protein_id="ABI67460.1"
FT                   /translation="MLRHMLKSKIHRAVVTDANLNYVGSITIDRDLMDAADILENEKVT
FT                   IVNNNNGARFDTYVIEGERGSKVICLNGAASRLVQKGDVVIILTYTVLQDEECHNHKPR
FT                   LVFMDGNNNIKELG"
FT   gene            111759..112670
FT                   /locus_tag="Swol_0104"
FT   CDS_pept        111759..112670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0104"
FT                   /product="quinolinate synthetase A"
FT                   /note="KEGG: chy:CHY_2374 quinolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67461"
FT                   /db_xref="GOA:Q0B0P3"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0P3"
FT                   /protein_id="ABI67461.1"
FT                   /translation="MLAELEQYVLRRKKEINAVILAHFYQLPEIQDIADFVGDSLQLAI
FT                   QAASTQAQVIVFCGVNFMAESAKILNPDKTVLLPDIRAGCPMADMVGAEALRKKKAEYP
FT                   GAVVVCYVNSSAEVKAESDICCTSSNALNVVRSIPEDRTVIFVPDKNLGAYIQSQTGRE
FT                   MMLWEGYCPIHHALSWAEVEKQKELHPQAQVVVHPECPPEVTRRADAVRSTAGILEYLR
FT                   SSNGAEFIIGTEEGFLYTLQKNCPGKKLYLARESFHCPDMKYITLEKLAGSLEKMEQQV
FT                   EVPPEISRRARRSLERMIEIKG"
FT   gene            112791..114392
FT                   /locus_tag="Swol_0105"
FT   CDS_pept        112791..114392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0105"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: chy:CHY_2373 L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67462"
FT                   /db_xref="GOA:Q0B0P2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0P2"
FT                   /protein_id="ABI67462.1"
FT                   /translation="MIITRYIGVLHKDTPVETTDFLIVGGGIAGLFTALKASQYGKVIV
FT                   LTKKTIEDSNTGLAQGGIAAAVHEEDSPFLHLEDTLEAGAGLCNIEAVDLLVREGPERV
FT                   RELIQAGASFDMKDGNVALTREGAHSKARILHAADTTGEAIRVALVKKCEESSDIRIIE
FT                   DQFLVDILGHDQRKECYGALVYDAKTRQQLAYLAKATIIATGGAGQLYRYTTNPSVATA
FT                   DGMAAAYRAGCRLSDMEFIQFHPTVLFSYSNQRFLISEAVRGEGGLLYNHKGERFMPAY
FT                   HSLAELAPRDIVSRAIVNEMNCNGSEYVYLDMSGIKQVEKRFPNIYRTCRESGIDITRE
FT                   QVPVSPAAHYIMGGIETGTYGETGVYALYSCGEAACTGVHGANRLASNSLLEGIVFGQR
FT                   IVDRAEEIMYRRRISIDEVFRHFDQSWVYSPQEQRIDPPEAKNRLQAIMWEKVGIIRDE
FT                   EGLKVANRELEAIYSHIAQGEDPFAYYEIVNMLTVARIIVQAALWRQESRGGHFRSDHP
FT                   ARDELRWLKHLSFINC"
FT   gene            114412..114680
FT                   /pseudo
FT                   /locus_tag="Swol_0106"
FT   gene            114916..115746
FT                   /locus_tag="Swol_0107"
FT   CDS_pept        114916..115746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0107"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: pca:Pcar_1972 nicotinate-nucleotide
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67463"
FT                   /db_xref="GOA:Q0B0P1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0P1"
FT                   /protein_id="ABI67463.1"
FT                   /translation="MNDWMVKEIIKRALEEDLGNGDITTRNLIAETQEGQGLFLAKASG
FT                   IVAGLEVSATVFSCLEPAVQFTAFIHDGDEIKPGDRIARVEGKMSTLLSGERVALNFLQ
FT                   RLSGIASKTRNMAESIKYQHAVLVDTRKTTPGLRLLEKYAVRVGGAKNHRFGLYDGVMI
FT                   KDNHIQAVGGIQKAVSTLRQKVPHTLKIEVEVENLQQLQEALEARADIILLDNMDSESM
FT                   RKAVEIVNGQALLEASGGVNEENIVEIAKTGVDFISCGALTHSAPSLDISFKIL"
FT   gene            115822..116418
FT                   /locus_tag="Swol_0108"
FT   CDS_pept        115822..116418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67464"
FT                   /db_xref="GOA:Q0B0P0"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0P0"
FT                   /protein_id="ABI67464.1"
FT                   /translation="MRISTREMVLAAMFTALLCVLTILVRAFQPVMVMPFSLQPLVMLL
FT                   AALLLSPLAASLSMLAYLLLGLIGLPVFSVPPYGGPAYVLLPSFGFLLGFPLAAYLQSW
FT                   FLRHVWGKQHYHNAITGGKASILLKFSLSGLLGIIIYYLLGLPYMYLILNFYLGHTVNV
FT                   GQIIKLGFLPFVFFDLIKIAIAAIIAEQFCRRMET"
FT   sig_peptide     115822..115905
FT                   /locus_tag="Swol_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.953 at
FT                   residue 28"
FT   gene            116519..117286
FT                   /locus_tag="Swol_0109"
FT   CDS_pept        116519..117286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0109"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="KEGG: gka:GK0063 transcriptional activator,
FT                   putative, Baf family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67465"
FT                   /db_xref="GOA:Q0B0N9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0N9"
FT                   /protein_id="ABI67465.1"
FT                   /translation="MILVFDVGNTNTVIGVYDREKLLNHWRIRTNPQRTCDEYGILLRS
FT                   LLENDKLNLKDIKSVVISSVVPTLMMELEWMSRKFFACRPLVIGPGVKSGLAIKYENPR
FT                   EVGADRVVNAVAAYDKYGGPLIIVDFGTATTFCVVSAKGEYLGGAIAPGIIISTEALVS
FT                   KAAKLPRVELQRPRSLIGKNTVSSMQAGIMYGFVGQVEGIITRMKTEIETTPQVIATGG
FT                   LAAVIARETDVIDKVDEFLTLDGLRLIYEMNRG"
FT   gene            117402..118358
FT                   /locus_tag="Swol_0110"
FT   CDS_pept        117402..118358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0110"
FT                   /product="putative TIM-barrel protein, NifR3 family"
FT                   /note="KEGG: chy:CHY_2369 putative TIM-barrel protein,
FT                   NifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67466"
FT                   /db_xref="GOA:Q0B0N8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0N8"
FT                   /protein_id="ABI67466.1"
FT                   /translation="MFFIGKQKMENRVCAAPMAGVSDKAYRVLARDFGCGLVCSEMVSD
FT                   KGLVYGQGRTSKIADSSGEKRPVAVQIFGSEAESMATAARIVEEMGADIIDINMGCPTP
FT                   KIVKNGEGAALMLDITKSRGIVREVLRVVKVPVTVKMRKGWDENSINCLELAQKLEEEG
FT                   VAAICLHPRSRQQFFSGSADWNLIKEMKKELKIPVIGNGDIWSADDAQRMIDFTGCDAV
FT                   MIGRAALGNPFIFRETFELLENNRRIPPPSREERLQTATRHLNLVCQFKSEAVAVREMR
FT                   KHFAWYIKGLPGATRVRQEINRAASRDELLFALDSLL"
FT   gene            118748..119278
FT                   /locus_tag="Swol_0111"
FT   CDS_pept        118748..119278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_2368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67467"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0N7"
FT                   /protein_id="ABI67467.1"
FT                   /translation="MEIFRIQDKIISWQKIENTLRKALQMRARGLSQQETADRLAIDRT
FT                   FISRLEGIGEIRKGQSIACIGFPLQNKKEVQDILEKEGVDFILLMSEKERLDFVNQRSG
FT                   KELLNELMDLTARVRGYEIVIGIGSDERLKLIEGVLDGQFIGVEIGASPITEDKWVDPQ
FT                   EIRKILRSIRTAR"
FT   gene            119531..120445
FT                   /locus_tag="Swol_0112"
FT   CDS_pept        119531..120445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67468"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0N6"
FT                   /protein_id="ABI67468.1"
FT                   /translation="MKRIVSVSLGSSRRDHSFETEFMGVKFHIERIGTDGDWNRAIDLI
FT                   RELDGKVDAFGMGGIDLYVYIAGKRYVIKDARRLMNEARKTPMLDGSGLKNTLERKCIM
FT                   DIQRDGIMDLKGKRVLMVCAVDRFGMAEAFEEIGARLTLGDFIYTVGVPIPMHSLRTLR
FT                   ILGSVAAPFIVNMPFDKLYPTGKEQDVIIPKHSKYYYLADVLAGDFLYIRRYLPEKLNG
FT                   QVIITNTTTREDMQMLKKRGISKVITTTPDMGGRSFGTNVIEAIMVTLMGRPIDKITPA
FT                   DYFSMLQELNLKPGVVNLEEFSA"
FT   gene            120438..121346
FT                   /locus_tag="Swol_0113"
FT   CDS_pept        120438..121346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67469"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0N5"
FT                   /protein_id="ABI67469.1"
FT                   /translation="MLDLDFAFFNLRKQDRRGLIYRKSILDRLAPLFFSPRVEKLIHLD
FT                   GLNSQGCNILLPLGPGNLRLLDAEKQENISQRSTEILEDYQLPAMAVDRLHKEQLRLLF
FT                   PSLPLVFGDNFIKALASVFIREIHSRRGIKKVIITGETEYFPEFVAETAALGIPVSLQS
FT                   THPSRYEILAYHLLYEKGQAVSTSYLKPEKWERGELVLMFDPDMRQMAISSPRAFCIKF
FT                   NDQVKGLSREMENHLAGNGIDPVLHNLAPILEISLLAKAGFFGPNAEQDNAREEEGRKF
FT                   LLLQELGNQTGLWELFLDKAI"
FT   gene            complement(121335..121520)
FT                   /pseudo
FT                   /locus_tag="Swol_0114"
FT   gene            121571..122050
FT                   /locus_tag="Swol_0115"
FT   CDS_pept        121571..122050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0115"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: mta:Moth_0151 GreA/GreB family elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67470"
FT                   /db_xref="GOA:Q0B0N4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0N4"
FT                   /protein_id="ABI67470.1"
FT                   /translation="MAEEKEVVLTKEGLEKLENELEHLKSVKREEVAERIKQAIAFGDI
FT                   TENSEYEDAKNEQAFIEGRIISLEKTLKKARLMEDEDIRTDVVSLGSRITLKEMKSGRE
FT                   VTVTLVSSVESKLKDGKISDESPVGKAIMGKKVKSTVSVEAPAGTIKYKIIKVEK"
FT   gene            122440..123921
FT                   /locus_tag="Swol_0116"
FT   CDS_pept        122440..123921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0116"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: chy:CHY_2365 lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67471"
FT                   /db_xref="GOA:Q0B0N3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0N3"
FT                   /protein_id="ABI67471.1"
FT                   /translation="MSESELNISELKKVRLEKLAELKEMGIEPFGRRFERDSMAQNIKE
FT                   AFSELEGKTIAIAGRIMSKRRHGKAGFANLADLSGSIQLYFRQDDLGPEKYELYKKLDI
FT                   GDILGIQGEVFRTQKGEISIHVRDLYYLSKSLTPLPEKWHGLKDVELRYRQRYVDLIVN
FT                   PEVKEVFVKRSRIIKEMRNYLDDRGFLEVETPMMQPIPGGATARPFITHHNALDMELYL
FT                   RIAPELYLKRLIVGGLEKVYEINRNFRNEGISTRHNPEFTMLEIYQAYGDYEVMMQLCE
FT                   DLISAVMLKVNGSMQIDFEGEQLDFTPPWRRVTMLDAIKEAAGLDFSLIKSDEDACQAA
FT                   WQLGLEVKAGASRGELINEIFEQFVEDKLIQPTFVYGHPVEVSPLAKRNLETPEFTDRF
FT                   ELFIMQREIANAFSELNDPIDQKERFIKQVEKRAGGDAEAHMMDEDYINALEYGMPPAG
FT                   GMGIGIDRLVMLMTGSPSIRDVILFPTLRPRSSEA"
FT   gene            124105..125559
FT                   /locus_tag="Swol_0117"
FT   CDS_pept        124105..125559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0117"
FT                   /product="alginate O-acetyltransferase, putative"
FT                   /note="KEGG: bat:BAS0845 alginate O-acetyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67472"
FT                   /db_xref="GOA:Q0B0N2"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0N2"
FT                   /protein_id="ABI67472.1"
FT                   /translation="MLFNSYEFIFLFLPLTILGYFFLNHQGWKGAAKAWLVVASLFFYS
FT                   WWNVIYLPLILFSMLFNYIIGSSLAKLSSSPNPTRRLLLIAGISGDLVLLGYFKYADFF
FT                   IGNINLLFSTHFSLLRLTLPLAISFFTFQQIAYLVDAYQAKAQEYDWLNYALFVSFFPH
FT                   LIAGPIVHHREMMPQFASPENKSWNYENVSRGLFLFFTGLFKKVVIADTLAGWASFGFD
FT                   QASSLSLLEAWMVSLSYTFQIYFDFSGYSDMALGAALMFNIRLPINFNSPYKARNIQEF
FT                   WRRWHMTLSRFLRNYLYIPLGGNRHGEAKLYRNLIITFLLGGLWHGAAWTFVFWGFLHG
FT                   LALVIHRLWQKTGLRMNQVLAWLVCFNFVNFSWVFFRAQSWPEALKVIKGMLGFSGIVL
FT                   PAGLAGKLGFLAPAGVLFGEFTLQSPARAALLLAVSLALVLFWRNSMELEKDFTPGLRQ
FT                   AVWVGAMALVAILSLTGISEFLYFNF"
FT   gene            125691..125984
FT                   /locus_tag="Swol_0118"
FT   CDS_pept        125691..125984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67473"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0N1"
FT                   /protein_id="ABI67473.1"
FT                   /translation="MSTVIQQVQKRMLVSLAQVARNLNIHEGDHVLLEERDGGIFISPV
FT                   GWHEKNQEYFWSEEWQNMMKKSAEDLAQGRVQRFQDIKSLMEKLGGEEDDNA"
FT   gene            125959..126234
FT                   /locus_tag="Swol_0119"
FT   CDS_pept        125959..126234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67474"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0N0"
FT                   /protein_id="ABI67474.1"
FT                   /translation="MGKRMIMPEIILTDTFLEGFRKLSPSEQKQARKAIRFLSENPRHP
FT                   SLQVHIIKGTDFWEVYVNMDVRMIYLPESNVYTLMAIGHHDILKNY"
FT   gene            126513..127499
FT                   /locus_tag="Swol_0120"
FT   CDS_pept        126513..127499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67475"
FT                   /db_xref="GOA:Q0B0M9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M9"
FT                   /protein_id="ABI67475.1"
FT                   /translation="MISYKKWLWMTLSIILLPLIAIAGFNFYIDPLWNFGHAHRYNRIQ
FT                   ASFDERQQKTNRVTFGSFDYDTLILGSSRTTYISQYDFPGCKAYNYSVSNMLLDEYYDY
FT                   VEYAKARKGREFELIIIGLDFYASNQSIKREFHEPSFYMEQANEFGYRYKTLLSRDVLR
FT                   YSWQNFQASRQGQPQNFAYDRCNVKTLNLVPAGEKQKKIDATVDKYRRDIYANYHYVDV
FT                   KGILSHLKESNPHTRFIVFTTPISQPLYELMLEEGLYPYYQRWLSDCVEVFGEVYNFMG
FT                   PNSITTDLDNYYDASHIYPHIGTLIAHRVMNSPDPRIPEDFGVLIKK"
FT   sig_peptide     126513..126584
FT                   /locus_tag="Swol_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.908) with cleavage site probability 0.884 at
FT                   residue 24"
FT   gene            complement(127489..129531)
FT                   /locus_tag="Swol_0121"
FT   CDS_pept        complement(127489..129531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67476"
FT                   /db_xref="GOA:Q0B0M8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M8"
FT                   /protein_id="ABI67476.1"
FT                   /translation="MRNRWLVLGWFFLLLTLLLAGGGLWLRVSNENQNRAVITVIDYRE
FT                   FWKTADAADMELDEVLKQLKESGVTHVGIKDTSLRDLAYSGEIYLSPWGEFMAFNRNYA
FT                   PELEAAARRAVGEQVISPDKLVLCSDRPDTIRFLQKQLASRFQPEELLTFKAGGQSYFI
FT                   INAELLPLDKPKDPKKPANEFVEVDARLGFDDRVLDRLKAGGFNIVLRPDNSMGSNDAY
FT                   LQEYEELVGKYDVKYLVFGNEVSGAPDRLEVMEDLVKKYGLIIGIIETPVQLKYVEQKG
FT                   LDELMVAAAYPINRLYSTTNDEFVQTTDERYYRWVRAVVDRGIRILYVSPFKDRKVSYS
FT                   ENITNTLEVIERFHATIEGKGFTIDQPLPHLSSEKPGCWQQLALSMSLLLAGTLYLFYL
FT                   FRPGRRFIILLLGLGIAGCLLCNLVVGMDLAKVYALAAAILYPSLSSLLLLIYLRNHRE
FT                   QALASKLLAGLAIILGVNALGMLTVVSSLADIRYIMNVKVFSGVKLAFIMPLLLFVVNY
FT                   FACFAGEEGFKEKVMGFLRMNPNYLVLFTLGIAVLALYYYLGRSGNNPQIAVSSLELRF
FT                   REILESVFLARPRFKEIIIGYPSLFALVYLYHRYKEEVILLVLGFGVVMGSISMVNSFC
FT                   HVFTAVTISASRTLAGLLVGVFFALLALLGIGILEWILRRCGVIS"
FT   sig_peptide     complement(129469..129531)
FT                   /locus_tag="Swol_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.552 at
FT                   residue 21"
FT   gene            complement(129671..131161)
FT                   /locus_tag="Swol_0122"
FT   CDS_pept        complement(129671..131161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0122"
FT                   /product="uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="KEGG: tte:TTE0176 uncharacterized membrane protein,
FT                   putative virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67477"
FT                   /db_xref="GOA:Q0B0M7"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M7"
FT                   /protein_id="ABI67477.1"
FT                   /translation="MKNKTGKNFIGVSILIFFSKLLGFARDIVFASVFGTTILTDAFQV
FT                   IFSFPSLLFSSIGMALSSVNIPDLTYFVKSRSREERNRYIASLYAQITIWGSLIALLGI
FT                   IFAPALTQLIAPGLSGEVTGIATLLTRIMMPTLLFVSLTYLTTGVLQVHGYFMLSAVIS
FT                   IPFNLLIIGALLLRGADITILGYVTTAGWFLQFLIQIPVLVKEKYRFLGKIEFKNEKII
FT                   NLYKNLLPILLGNSLLQLCLIIDRSFATHLSEGTTAALAFGSNLFITATSIFIVAMSTV
FT                   VFPRLSEYCLQLDYERMRGMLAAVFKVLIFILLPYLLLVVAYNREIVALVYERGAFTSK
FT                   STAMTSLAFLLYSLAVVGYACQEIFNRVFYALKKFHIPMRASLLCLLINLLLDFLLFRR
FT                   TGIAGISLSTSFCLLLYGVIMSFMVRQEIGSFVGREFLLFAGKLSVPAGAMLGVVYAGK
FT                   CFSPGGPVYAFLLPLLLSAGAYLGAAWVMGLRKDLLLK"
FT   gene            complement(131269..132339)
FT                   /locus_tag="Swol_0123"
FT   CDS_pept        complement(131269..132339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0123"
FT                   /product="polysaccharide pyruvyl transferase"
FT                   /note="KEGG: mta:Moth_0215 polysaccharide pyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67478"
FT                   /db_xref="GOA:Q0B0M6"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR019896"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M6"
FT                   /protein_id="ABI67478.1"
FT                   /translation="MRIALSGYYGFDNAGDEALLSAITSTIKKLEPAADFVVFSGHPRR
FT                   TSFLHGIRAVYYLHPGQLLRELFRADLLISGGGSIFQDITSARSLPYYISVVALAKFLG
FT                   KPVIFYAQGVGPINRSLSKFLMRLVGNRVDLITLRDYDSAVYLERLGVSRPPMIITSDP
FT                   VFSLQPEPGEREDMDNLLQEMGLRGQVLIGVAVRQWLALEGYQEALARVLDEVAERGCR
FT                   ILFIPMAYPEDIPAARKVMNLMKNDAWLLERHLGAREHLALIAHLDIMIGMRLHALIFA
FT                   ASQGVPFVGISYDPKVEAFLKLFAMKPLPLAYEGMKAEIERVLEDDEWREQIRKRAGEM
FT                   REKSVENARLALSLLR"
FT   gene            132556..133671
FT                   /locus_tag="Swol_0124"
FT   CDS_pept        132556..133671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0124"
FT                   /product="glycosyl transferase, family 4"
FT                   /note="KEGG: mta:Moth_0218 glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67479"
FT                   /db_xref="GOA:Q0B0M5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M5"
FT                   /protein_id="ABI67479.1"
FT                   /translation="MNLVLKMGVCNIMSAPVYIIVLLSAFFIAYLSMPGVIKIAYRIGA
FT                   IDQPDQRKVHSAKMPRLGGMSIFLAFIFSMIILQKYSGPYLGIILGASIVFLVGLLDDI
FT                   FQLSAGVKLLGQSLAAAVAIYFGVMVHFVTNPFDGLMALGYFSIPLTFLWIVGISNAIN
FT                   LIDGLDGLAAGVSAIAAVTMGVVSLLQGQVEVALVAFLLLASILGFLPYNFNPARTFMG
FT                   DCGSNLLGFILGCLAILGTAKSATLISLLLPIVILGIPIFDTFFAIIRRINKRTPIFKP
FT                   DKDHLHHCLLAMGMSHRNCVLVIYGISGFFGLVAITFSFITSPKASLLLGLLLILVVLG
FT                   ASKIGMFSGSSARMARQVIEPNPSAKISEHI"
FT   gene            133865..135007
FT                   /locus_tag="Swol_0125"
FT   CDS_pept        133865..135007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0125"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: chy:CHY_2591 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67480"
FT                   /db_xref="GOA:Q0B0M4"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M4"
FT                   /protein_id="ABI67480.1"
FT                   /translation="MAKTKSYLKYIFIAGLIFGVFFGIGSGLSHILYADRDSDPAVEEE
FT                   ETADKPKDGKRTKILVLGVDARPGETNSRSDTMILVTIDPRLDKAAIVSIPRDTRVQLK
FT                   GGAVDKICAVNYLGGPKYAVEVVEKLMDTKIDYYVEMNFKGFKEIVDTLGGVTINVPQR
FT                   MYKPTEDIDLYPGTQKLNGRQALAFVRYRDYVMGDIQRTAAQQEFLKALADEILKPKTL
FT                   TKLPTLVRQLDKHMDTDLKKSDMLRLASWAPGFSTDSIVTQTLPGYFYDECDEYGNLIC
FT                   SYWIADKKNLAGLLDNMLAGETVAVIQSSTNSQKKAIATKNDNNNDEKEHNDGIYSNRD
FT                   IERSKLPSPGHAGSWNPAPSNNKPETSNPSLDPTGPAGYI"
FT   sig_peptide     133865..133969
FT                   /locus_tag="Swol_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.938) with cleavage site probability 0.570 at
FT                   residue 35"
FT   gene            135120..137843
FT                   /locus_tag="Swol_0126"
FT   CDS_pept        135120..137843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0126"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: mta:Moth_0517 N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67481"
FT                   /db_xref="GOA:Q0B0M3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M3"
FT                   /protein_id="ABI67481.1"
FT                   /translation="MKKALHIFNYTVLFSIFFSLILILAWAQSSPAATAVIKGSVVNIR
FT                   QGPGTGHEIAGTLYQNTEVAILESKDGWKKIQHGSLNGWVADSLLQVKKEEIRLQVTAD
FT                   KANLRSGPSTSSSQVGQLRQGDSLILLDVEGEWYKVQVPGGSSAYIASFLVSKTAVAAN
FT                   SSSTPAAGSQPETAATVPASSPAPAVTRQVEVISGPINIRSGPGESYPKLGSIDEKTVY
FT                   PVISKEGEWYKIRLANGSDAYVAGWLVKESSMASSTVIPPAAASGSSAATGGTAAGSTA
FT                   PRVFLDGQALSFEVPPIIENDRTLVPLRAIFEALGATVDWDNATRTVTSRKGSTTVVLA
FT                   IGSLAPTVNGQVRQLDVPAKIVADRTLAPLRFVGEAFGSTVDWEGSTRTINIKSPPAPG
FT                   APSVGSGKKAVAVTVNKEIINLRSGPSTGHAQLDQARSGERMQVLAAQDGWYQVSRGGK
FT                   IAWVSGEVVDVAWQENEPEAVPVTTSPGTPGNSSSELPPPASPENIRILSSKDETGLKI
FT                   IIGSGVELKGRLEESGNNLRYYFTGRSIEGNTIIRENIAGEILEVKAEQQGEDAVIYIS
FT                   IPANLKYRSASEEGGKKETIIISNFITGIERKTFGSKGERIILKTVLPLDYSSEQQGTQ
FT                   MKIKLPFLLKGSAPSEYSFDSQLMQHLQLSESEVNGTQGMVLAIETKNPAKFAFGKSAE
FT                   GNQLHILFVDQSDVQQLGSAIVIDPGHGGKETGTIGSWLKEKEPNLDISLKVAALLRQR
FT                   GMEIVLTRDDDSYVSLEERADIANLYNARLFVSIHNNASQNNPAAQGSETHYYAPLDNP
FT                   ELFMQSAERCRLATCIQEQLVSKLRRVDRGVKTGPSSNFSVLRNTRMPSALAEVVFLSN
FT                   TEEEQLLQQDYFRTLAAEAIADGITQYCGGSAEIKL"
FT   sig_peptide     135120..135203
FT                   /locus_tag="Swol_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.379 at
FT                   residue 28"
FT   gene            138176..140713
FT                   /locus_tag="Swol_0127"
FT   CDS_pept        138176..140713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1253 O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67482"
FT                   /db_xref="GOA:Q0B0M2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M2"
FT                   /protein_id="ABI67482.1"
FT                   /translation="MAKKKKQQQKNIKGNSIKDTLREQSPTRGLSPSLKLPRVEAWYYT
FT                   LVFIAVGFLIFYPPYFRGLFFSEDMFLYHILTGLVFILLGIEKIKRREFSFIETPLDWA
FT                   ILAYAGAYLLSLIGAVHIGEAFYGFLKALNYFMVYWMVSQVVHDYRRYEDILRVILASG
FT                   VGVALIGILAAVGISDYPSAFDPNTIRILSTLQYPNTTAAYLAVISLLGVTLWIREKNP
FT                   LLKLIYGSCIYLLLLVVLAAFSKGAWVILLVGAALLLIGMPGLYRLKSLYILGLAGVAA
FT                   LATYGKFMAALPVVTQQEPAVALQKLLLGFIIVLAGQAVWDLGILLQRKWGGRALAAYA
FT                   ASLLVLLMLLVIRLPEIPQLAQQILPENLTARISQIKDTTGTSYSSRMDYAHWGLAIVK
FT                   DYPVVGAGAGGWNALYHQYQDYLAWTTETHNHFVQVWVEAGTIGFIAFISIWIGLLLAL
FT                   WKIYRGKRERGQAAGDSWILNWGTATAALAFGLHAAMDFDLSLGAMAILLWTLFALLNA
FT                   GSRLEARTEGKRLLQLKPAVNISLAAILALVIIITGSSFSLAHSSAREGDGLLQEITRE
FT                   QQLHEEEKETKILRARSLYQKATQFDPLNANHHAGLAQACALQFIQAAQSKNPMAREYF
FT                   ELTRQEIKKAGELSPYSIKLRNTLANLCIGLNDLEGAIEEAQWAIRCNPNDINAYEGVI
FT                   QLALKAVELHLNNKQAEKAAFYAESIVEQNRELQIKKEAIDPVKAAYPYWSGQPLELSP
FT                   AAQLSLGKAYYLLGQYPEARATIEPLLPMVQDGSLQSPETPAWHLAALYRSGEQEQAEA
FT                   LALGLHSSNPQLSALYRSLLQLQALPAKSEAGK"
FT   gene            140787..142694
FT                   /locus_tag="Swol_0128"
FT   CDS_pept        140787..142694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67483"
FT                   /db_xref="GOA:Q0B0M1"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M1"
FT                   /protein_id="ABI67483.1"
FT                   /translation="MTYWLRLILMLLFDSCLINLSIGFSLWLRFEGEGGIPANYLEAFF
FT                   TLIPWYTFITLGALYAMRLYHRMWKYASIGELFGIVKAVTTSTAIVIILIYTIPLSYLP
FT                   RSVYIMSWVFMIIFIGSSRLSWRLLRDLIIKESNKKAKRTLIIGAGDAGAMVARELNNN
FT                   QSLNLLPVGFVDDSPLKQKLSIFGIPVLGSREQIPFLTASHGIEEIIIAMPSAEGRTIR
FT                   EIVNICQATGVRLRIFEGTDDLLHSRSKIRDVQLEDLLRREPVKLDLEEIAAYLQGKTV
FT                   LISGAGGSIGSELCRQVCRHRPQRLILLECSENNLFDIDNELRESFPEQALEAELADVR
FT                   NREKLQAVFEKYFPQVIFHAAAFKHVPMMEMHPEEALNNNVLGTRNIAEMADKYGSETF
FT                   ILISTDKAVNPTNVMGASKRIAELIVKDINRSSQTRFAAVRFGNVLGSRGSVVPIFLKQ
FT                   IQKGGPLTVTHPDMTRYFMTIPEAVELVIQAGAIARGGEIFVLDMGEPVKIADLANDLI
FT                   RLSGYDPELDIEIKYTGIRPGEKLYEELFSGYEEMAATRHQRIFISTKELDERYNGIKN
FT                   NITAWINNLSPERNEIIRFIQELIPEYCGSEANEEPVPRGEVIYLEKRGNRIKKSSGIK
FT                   "
FT   gene            complement(142720..143175)
FT                   /locus_tag="Swol_0129"
FT   CDS_pept        complement(142720..143175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0129"
FT                   /product="small multidrug export protein (QacE)"
FT                   /note="KEGG: afu:AF1696 small multidrug export protein
FT                   (QacE)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67484"
FT                   /db_xref="GOA:Q0B0M0"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0M0"
FT                   /protein_id="ABI67484.1"
FT                   /translation="MEHSIFMVIIAAMTPVVELRGAIPLGLALGIPPAEVFLLSLIGNI
FT                   LPIPFILLGIRWLLNEIKKIPRLHNWIDRKGKKGAGLLNEKIRRWGWLGLMIFVAIPLP
FT                   GTGAWTGALAASFLSLKFWPSLLAIVGGVLIAGLLVTGASLGVISFL"
FT   gene            143770..147465
FT                   /locus_tag="Swol_0130"
FT   CDS_pept        143770..147465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0130"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="KEGG: mta:Moth_2364 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67485"
FT                   /db_xref="GOA:Q0B0L9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017313"
FT                   /db_xref="InterPro:IPR034058"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L9"
FT                   /protein_id="ABI67485.1"
FT                   /translation="MILLRTVHLYQQNKQKKPGRSLKNKTIALILLFLLLFPGPVLAGP
FT                   DEASSETELLNDRTADIIASNILLAPGLLTPSGLSGKGQIIGIADSGLDKGSISDLHPD
FT                   LQSEAGKMPRVAMLKSYAGRSLPDDPIGHGTHMAATIAGSGNASAGKYRGIAPGASLYF
FT                   QALLDQAGQLKLPEQIGELFRPAYEAGVRIHVNGWGGGSNTYSGRSAQIDQFVYRFPDF
FT                   LPVFGAGNNGPGKASLTTEANSKNALTIGCSQLPRPAFGPEARYAEHIAASSSRGPAAD
FT                   GRIKPELLAPGSAVVSACSRLLESNYAPNPNYTLMGGSSMAAAVVGGALALLSEYLELD
FT                   QQMSRPSSALMKALLINGARTPVGFPSNEEGFGILDLAGTVLALQEGSFQIIDNDNGIH
FT                   NGESVRYQARLTEGGRGFKVTLAWVDPPAALASKQTLVNNLDLSVEDPQGRIFYGNDFR
FT                   GQGQTDTANNVEQIHIKDAVPGEYKITVRGTRLDRSQKFALVYGQALEHDIIRKQQGQI
FT                   LKLSQGEQKDTSGLQLFKLSNGRMQEQTAEIPEGSDYYSIGQKIYIVSRSWLARGVQVL
FT                   SEGLEHTEKLLLEMNKQLREGGFFIDPSFTGEGGVFLNQTPINDSTKIPPGSEVNALIN
FT                   PSQQTIWQLKAAFEEVDGFIETLNTEQRELKLLHDERNYRIAEHVVISYLDRFLDCDPV
FT                   DAPYGTEQVARLENLAPGLKVTLTLSPSNQEIQYIKVERDLALGQVAEVDAKEGEIKLE
FT                   SGQSYRLFPGNTIIKDQQAGKLEEVKTGDHIAALLLNGTNNILHLLVSSEVYYGRVLFY
FT                   SEREKMLYIQESKANSSSFRKVPLDTQTEIFHSGLQAGVLSLLPGTWVRVINCPDQDKA
FT                   WRVDAVYSAREDSSYFSTYDPVRQTVNLQDGSILSISRYTQIIKGSYNISPQMLIPGEK
FT                   VNIVTLAIAGSSNEFLARLEVEVAPGTASPQLEAKAYVLNGILILQGWSSSPLVYIYRS
FT                   DVGCIPLEVGADGSFSQLFKMKEDEHEVTLLAIEHSGGAIKGLSLPLLSFAPEEAGKEF
FT                   SDLAGHPWEHEIKKLLEAGIISGYEDGCFKPEKSISRAEFICLLARAQGWDIGESREQN
FT                   YFSDNREIPWWALGAVYAAQEQEIIKGYPDGSFRPWRNVSRAEMAVIMAALQCSEKKND
FT                   KQEEQTLPELPFLEVPSWAREAFQHLYHTQQLNYLDYVRGNYIDAERPLSRAEAAAIIA
FT                   KMWSEE"
FT   sig_peptide     143770..143901
FT                   /locus_tag="Swol_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 44"
FT   gene            complement(147519..148562)
FT                   /locus_tag="Swol_0131"
FT   CDS_pept        complement(147519..148562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0131"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: mta:Moth_2363 putative transmembrane
FT                   transcriptional regulator (anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67486"
FT                   /db_xref="GOA:Q0B0L8"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L8"
FT                   /protein_id="ABI67486.1"
FT                   /translation="MKCNEAREFFSPWIDHEMEDAEREALQLHLDSCPDCQHELADWER
FT                   ISALLRESLAEAAEERTAPPELTRAVMITLREQGQPKRLAGWKKAAAGIAAALALYLGS
FT                   SGLLWTPLWQVANKDPAVNTDPVQQTTKQQIAEQPGEKTPGNNAITPAGKQDNKSSPMA
FT                   PQGMSKPAVKNNPTAPAGPENPNIATVDTGNPTAAPVFLSKERVLVSTIYKLVPYDADQ
FT                   AKAQQEAQKIAAAAGASVQLLGQQLDGQRSATVLKFSCPVETAEQLKQELLGLGSRLSL
FT                   EENRQDLTSRFNDSLEQYRMLSAQAATVHDKEQSKELEIQIKALEKQLNNWDKEAARES
FT                   IVLWLEI"
FT   gene            complement(148552..149136)
FT                   /locus_tag="Swol_0132"
FT   CDS_pept        complement(148552..149136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0132"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: mta:Moth_2362 sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67487"
FT                   /db_xref="GOA:Q0B0L7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L7"
FT                   /protein_id="ABI67487.1"
FT                   /translation="MMSIKELVEKAGRGDLRAFEDLLVHYQDRVFSHCLRLTANSDDAQ
FT                   DLAQEVFIQAFRAIKTFRHEADFGTWLHRITVNSWLNWQRRNKKLLIFSLDNPVNTSNG
FT                   EVIRELAAGEDSPLEAVERQELSAAVRTALDRLAPEYRTVLILREMEGYSYEEIARMLD
FT                   CSLGTVKSRISRGRRDIKKEIIKLRCEWDEM"
FT   gene            149800..152025
FT                   /locus_tag="Swol_0133"
FT   CDS_pept        149800..152025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_2343 copper amine oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67488"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L6"
FT                   /protein_id="ABI67488.1"
FT                   /translation="MRLPADFDFGLTVGNDYTLTQIANTDTFGVNGAASTLQIRIPTQA
FT                   NAFSASNSFGNAGITVDVIAKNEIKIKVASDGTQNASLANAVVSDEKTGYFYIQMTSVF
FT                   VDSSSPSTIEATIEGRAGSPFGDAKIAIAQYGTGITNLTIDSVKTITSAATACDIIRLK
FT                   EDRPGAFRAGDTIEIKLPSGYKWDTLPTITKSDGPSVYTVPTASTADDGRTLVLTSNQT
FT                   SNVVTYLLLSGQRVKVDDESIAKFGDVEATVGGTASSAPGSFLVVKYGDYSVKAEAFGD
FT                   PLTVTAGRVEQEIGKFVIEEGIKESLLGGRTINATLVGGAKWGDLSKIRQDTSNSKNWM
FT                   APMNASWAAVGNNGDTIKLTLTANTASTDAIKAVFEKAEIIVSPTAEEEIKIVFSGSAN
FT                   VTGEAVVAKVVKPVTVGIEGTPAQFITGKRSLVLPDIVITESKKEAIDAASTTSTNTNG
FT                   YTKHTVGATDYYFIDLNGNGTYDPATERLVPAKDALTSTTTANNWLFLEFPVGTACTVP
FT                   TKVEVVEGDLVLDPSSVSRSVTADGRWYVQVKIKSTSSKPSKVKFSGIKLDVDRTVPEG
FT                   DVKVYVKGGAVLQTTAAFPGATSIANAVVAQIITPADTVTTSEAKFVIGDSKYTLNGIE
FT                   KTMDVAPYIKDSRTYMPLRFVAEAMGVTESNIIWDAVGQTVTLMKGDKVVQVKIGSNVL
FT                   LINGAAVNMDVAPEISNSRTMLPIRFVANAFGADAAWDEATQTVTIK"
FT   gene            152151..153335
FT                   /locus_tag="Swol_0134"
FT   CDS_pept        152151..153335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_2342 outer membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67489"
FT                   /db_xref="GOA:Q0B0L5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L5"
FT                   /protein_id="ABI67489.1"
FT                   /translation="MDKKWPHIMGDRMVSMLKRKILALLLVITMLLGLSSTACAADANS
FT                   PDQENKMQLTIEQAVNMALNNSKTIAISNLNIERGEEVRDLASDRVKYTPMGPAPTAAT
FT                   LAYNGLLASDIAWNMAKKSKTVEEDKIVYSVFNDYTTVLKAVKGLKYAQDAMKSAQANW
FT                   NIACLSYQQGVISTYQRDGAEVHYKVAQNALKLAEIELENSYQALNKTLGINITERPVL
FT                   IEQPGYSILKVDSLETAVTRTMEDNPAIWLADQKTYLAQINRDLYDWTNPAREPYEAAN
FT                   IDINKAQITADDLRQTMRQAIRIIYNNIAKIEEGYASKEQAVKLAEETRRVTKVKYDIG
FT                   MATATELQGAELDLQKQQNELDALVYQHELLKIAFQKPWAYSASTSSSSTAEQK"
FT   sig_peptide     152151..152273
FT                   /locus_tag="Swol_0134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.978 at
FT                   residue 41"
FT   gene            153787..154245
FT                   /locus_tag="Swol_0135"
FT   CDS_pept        153787..154245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67490"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L4"
FT                   /protein_id="ABI67490.1"
FT                   /translation="MKIYMDVCCYNRPFDDQNQDRIRLEAEAVMVILFNCQKGEWNLVS
FT                   SDIVDIELRKTQNPIKKQKASLLASIADSRVYLNEGIELKSNEYQRLGIDLFDSLHIAC
FT                   AEESRADIMLSTDDVLIKRAQKSKIIKVRIENPVKWLMEVTDNNENND"
FT   gene            154568..155278
FT                   /locus_tag="Swol_0136"
FT   CDS_pept        154568..155278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0136"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: dsy:DSY3375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67491"
FT                   /db_xref="GOA:Q0B0L3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L3"
FT                   /protein_id="ABI67491.1"
FT                   /translation="MLRGINRQIIFEDDEDYQNFMGTIKETQEKSGYEVYAYCLMSNHV
FT                   HLLLKEVTEDLGIAFRRIGAIYVYWYNWKYSRRGHLFQARYKSEAVETDSYFLTVLRYI
FT                   HQNPYKAGIVKNIADYPWSSYGEYVGEPRICDVEFGLNMFSTNRTNAVKLFEEFNLAEN
FT                   QDQCLDYNQDVRLNDTEASNFIRSISDVQSPTEIQGFEKDKRNEVIKKCKSKGLSIRQI
FT                   ERLTGVSFGVIRTI"
FT   gene            155343..155618
FT                   /locus_tag="Swol_0137"
FT   CDS_pept        155343..155618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67492"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L2"
FT                   /protein_id="ABI67492.1"
FT                   /translation="MVGQGDRSLCVAWEPELNLIMLKQENNILGINVKDNTITLNGRLA
FT                   YVMDTAIEISESGYTMLPIRYVAQALGANISWNPGNNSILLTVPGT"
FT   gene            complement(156221..157441)
FT                   /locus_tag="Swol_0138"
FT   CDS_pept        complement(156221..157441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH3985 transposase (13)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67493"
FT                   /db_xref="GOA:Q0B0L1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L1"
FT                   /protein_id="ABI67493.1"
FT                   /translation="MNIRQGYVFSFEDAINLQPRSRLEIVLATLDFDDVITVLDKENKQ
FT                   HRGPTGYPFESKLNALIAMRVYNMATFTELVERLTHDPVLRYNCGFDVFGKVPSIATFS
FT                   RFYERLTQSEVLRELFKKQVTTAESMGLIDTSSIAIDASKVDANEKSVPRKNIKDDGQS
FT                   ANWGSKLDTNGNQITWFGYKLHIATDVKSELPVALSITPASTNDGIMAESILEECSNNL
FT                   NSKPQYYLMDAGYDQKSIYELIRKDYKAQAIIPLNHRGAKEPPEGLDWDATPICSAGYR
FT                   MAYWGGSNGVNKFRCPHVMGKCDCPFGSSWCSDSNYGMVVKTRARQDSRLFIVPHRGTS
FT                   NWKLLYNKRTSVERCFGRLKEHLGLETGLNVRGIKKVKTHAYLSVITMIASVIAINKDK
FT                   SSTDIAA"
FT   gene            157626..159902
FT                   /locus_tag="Swol_0139"
FT   CDS_pept        157626..159902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_2343 copper amine oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67494"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0L0"
FT                   /protein_id="ABI67494.1"
FT                   /translation="MDAYLWKVLKTLGLLLIFSILLLLPSGYAIGATNYRVQGELPKYP
FT                   DSDFKEEEQTRALATVKITASTKDAFTAAGESYWAEFRLPRNFYITSAGIYGQGQQMDV
FT                   ELARGKGFEDQKRKVEINPIAEDRNNPGHYRGFEIVVENIKYPDDYPELVLYFNRVVVP
FT                   RGFKGNAELSIDSAGAGFSSGTITIANILSARLTVEASEVQFIVSREQVLGPIKVTENM
FT                   SGTFEYLKMTLPGGYQWIKEKCYIDPMLGFRVDHNGDGRYDENDFLISVEVDKYGQSTL
FT                   RIETMFRTTTIGKMEIECPVQLTDRQSSYGELNLQLNSNAELNVSSLKAGSYSQQKTDL
FT                   SVQNSREAYGGLCAQKIGNIIISENAPETMVRNRYITLTLPKGAKWAKLPSVKLEGDNY
FT                   LDIGPLLLNSEKDQISFEIEDCSRERPGKIILEEGKVDLATDFRGDLAVEVTGSAGASG
FT                   AIIVARVKPAFTVSSSKPALVIGKQEQSAGELEISESAGRVFLARELWIDFPSAIKLVR
FT                   SPKVEITAGDMILSRTVLKQEGDRERLVIPIQNSSSSAAKLLIKDIVYNLNNMLPDGDL
FT                   QIKLGGPAVNEVNAGPNPIFPSHDWVCEVANASISKEIIQPAKKDALSPIPVAGSIIFK
FT                   IGEKTYQVNGQATPMDVEPYILEGRTFVPIRYAALAAGINPDDIHWDQTAARVTIHSRD
FT                   NIIIQLKIGDQVIYRNGNEISMDTAAHIKDGRTMVPLRALAEALGRTVKWDAASSSVSI
FT                   ELPGT"
FT   sig_peptide     157626..157721
FT                   /locus_tag="Swol_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.984 at
FT                   residue 32"
FT   gene            160000..161118
FT                   /locus_tag="Swol_0140"
FT   CDS_pept        160000..161118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH2256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67495"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K9"
FT                   /protein_id="ABI67495.1"
FT                   /translation="MKTKKFLSIILFALLFMFSSQPVPAAEYGVMKNTVVLPGTVNELG
FT                   GIAGHYIAGQLQQGDILTFRLPLNSFWTKAPIDTDESTAMTCLQSSAEWSTTTMLDAAN
FT                   MRYGTDCNYILVPEAHAGNPNGLFNAANPTLAVSSLTKGEVLLEVIALPDNSQDCYLYI
FT                   YSNRVYIDDSIEGDVCIDIDSPSNQALKAILPGGSIPATLQADKSPGNNQSQKEPVQDN
FT                   KTLEKDSGGSSDADKEDKAQAAVRIELRIGQKKAEVNGEEKEITLAPYIKQDRTYVPIR
FT                   FIAEALGIDDIRWEAESKMITLKQESKILGIDVRNNTISVNEQLAYVMDTSIETSESGY
FT                   TMVPIRYIVQALGAIVDWNADNNSIILTLPGV"
FT   sig_peptide     160000..160083
FT                   /locus_tag="Swol_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.553 at
FT                   residue 28"
FT   gene            161868..164144
FT                   /locus_tag="Swol_0141"
FT   CDS_pept        161868..164144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1459 Ig-like, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67496"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K8"
FT                   /protein_id="ABI67496.1"
FT                   /translation="MRKRSHLSWLVLAVFTMTIFFGSGLTAVAAPGLSDVQGHWAADTI
FT                   QKMVDAGVVAGQPDGTFKPDNNISRAEFATLVVKAFKLEEKAGKVFTDTSDHWAKAFIS
FT                   TANANGIVSGYSDTEFGPNDPITREQMAVMIVKAAGWKAEGAAKVFPDDASISAWAKEA
FT                   VSTASAQGVIKGRPDGNFDPKANATRAEAAVVISGTLDVKAAPEKPVDISTLDKAGTYG
FT                   PASGSQEINGNVTISASGVILQNAVITGDLLIAEGVGSGEATLKNVTVKGTTTIKGGET
FT                   VNFENCKLGKVNIKKAEGKSNVVLSGTTSISELLANSAVKVSGQGTIDKAVVYVANVVI
FT                   EMKPTAYEVASGITANIGGVAVTGTTAVTSGGGGGSSDDSNRVKPVNVTPPAGEVPAGT
FT                   QVTLSTATAGATIYYTLDGSVPSSNSTKYTAPITINAATTIRAIAIKVGQTQSLVATYA
FT                   YSVSVPEASASVDVAVGSGAMSAFKTITVKSTTGLSGAAKYKVSDGTTTSAVKDLGVSA
FT                   AYMTSAESVTVTILASDGTTVLGTGTLNVTAAASTSIAITAVQPPVGDKTADCTVAVGS
FT                   GAMAAFKTITVTSTTVSGGAKYKVSDGTTSSAVKDLGVAAAYMTSAESVTVTILASDGT
FT                   TVLGIGTLNVTAAASTSIAISGSETPPEPADKKAVCTVAVGSGAMAAFKTITVTSTTVN
FT                   GAAKYKVSDGTTSSAAKDLGVAAAYMTSAESVTVSILASDGTTVLGTGTLNVASAASDV
FT                   SIDIQ"
FT   sig_peptide     161868..161957
FT                   /locus_tag="Swol_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 30"
FT   gene            164192..164581
FT                   /locus_tag="Swol_0142"
FT   CDS_pept        164192..164581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67497"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K7"
FT                   /protein_id="ABI67497.1"
FT                   /translation="MKKTAKVMFIACVLVMIYATVAVAAVPSDSVIIGNKAFAIAYLTD
FT                   PTHASEIQEALDNADPGSIWYSIDGITTGWTGIFTGSLATASEIAAFPEIQYRDAQGSL
FT                   ATYAAGNGDVIPGGGDVAFEVVDIY"
FT   sig_peptide     164192..164266
FT                   /locus_tag="Swol_0142"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            164860..168912
FT                   /locus_tag="Swol_0143"
FT   CDS_pept        164860..168912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC00465 putative S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K6"
FT                   /protein_id="ABI67498.1"
FT                   /translation="MIKRRNYKVIALTLTFLMLFASVASAAIPTDSVIIGDKAYSIGYV
FT                   TNPANAAEIQAALDNLGTGQLAYNIDGQTSGWTSIMEGTPLTADQITALPPITYKNDAG
FT                   EVSNYAAGDGDLIPSGLAVSNVVADNGNITITVTGEGTPVEGDFTFVSRIGDAAKADLA
FT                   VSNFNWTEATKTVTFTFAPFAATDTAQSIEIGWQYKDSKGWAAAFTVPAAEGLEITNLS
FT                   AINTTTIKVTFSGEVTAEQMAVANYTVSKGTIESVAKTGDENKAVVLTVAGLNYEDALT
FT                   VTVVKPAYTKDIKVPKISDLYELKIICDAPGNTIKSDGASMTMLTAQIIEKANNEPVKR
FT                   DAQIQFSATLGSLSQPQVALQDGKASTQLRSIASPTSVTSVITGVVASAPGAEAFVGLN
FT                   GQLIVNFTPEGVDPGSTTMVSAVSAGADQGDRFFVKFSGKIDATAYKAVVTSPTWIAAG
FT                   KSIYGIKYVDGANAKQVIAIKDVYNLTDDTLMFVLDTDSPGSVQPTSNMLDAAYAGAGA
FT                   PNFLRDNVNHTIVIPDNVTDLVVNSSNITFMMSDVTKPFVYGVEATTCMNVKVRFSEAI
FT                   AEDLSEGAAGAINGKFTIDGKQLRYIAVPTQANIDAAKLANEIIVTDLKVGSWSGHDKE
FT                   IANDNSRNMVYISIHKDFKLPSGTHGIQIANVGDWAGMTDKPQNIVTTQTFTFEVKPDT
FT                   EAPTVTVEVQSPEQYLITFSKPVDTVTGKTVVDAVKIYTKEGYTASTKTALTQNVNSLA
FT                   GDYVITIVDEEGMAVGAHLATTAPLTGVKRLLVECNRDWSVRQQGQATEKDNYWKSGLN
FT                   PFTFVISNVESQTGVAMAETAIDKTLQYDGTSPNIDTAIDLYEKSPKKAYRGLTANTSG
FT                   QFVFVKMTEPVQLVNSNGTAVSDPVTPNLQQDPTPAAYGATTGLPRQTYRFIFDANPDK
FT                   VVVGSVALGTLAEDDTTFIIAPNSQLDAGTWTLYIEQISDDHGNTSATINRKVTVPQTA
FT                   PTTTDTKVAWAAFDNNAALGATDYDYLYVKFTKVMKAYTANGVDATTNYKFRGYDLPEG
FT                   SQVFRGIDNVTDDWDGVTIRMPKTAWDGLAGNFSTNMAVASNFQSSGDEALSGPFQFEL
FT                   TNNAGGSIADKDGLTGANKFEAVYINAGTALVGGKIVIQSVAKDDDPAPNADGDIDTIV
FT                   VTTDQNSTTVAGDYIMVNGKKFITGGAAAAATQTFVANGAVTTGSVGPEEIAGTTSNGL
FT                   VIKAANGSIITNLGKVVDAAGPAITVIGCVYGSSTITVTFSEAIDDSTVIPGDFNLGGT
FT                   GLTGGTTISSVNTGTTANDNIIVLNLSAAQTPAVGQTLTVALSAPGVISDRKNVVSTQT
FT                   VAISKTY"
FT   sig_peptide     164860..164940
FT                   /locus_tag="Swol_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            169349..169623
FT                   /pseudo
FT                   /locus_tag="Swol_0144"
FT   gene            169699..170094
FT                   /locus_tag="Swol_0145"
FT   CDS_pept        169699..170094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1397 DNA polymerase, beta-like
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67499"
FT                   /db_xref="GOA:Q0B0K5"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K5"
FT                   /protein_id="ABI67499.1"
FT                   /translation="MVTAANQVNSIVWAFVAAVEAQGITVERALLFGSQARGDARKDSD
FT                   FDLIVISPDFAAMPGWRRWEVLGKAAAKVMEPIEALAYSPEEVANALQRDGNFLRHMHT
FT                   NKGTVLCLSTNKGTVLCLAAELLYFII"
FT   gene            170637..171968
FT                   /locus_tag="Swol_0146"
FT   CDS_pept        170637..171968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0146"
FT                   /product="RNA-directed DNA polymerase (reverse
FT                   transcriptase)"
FT                   /note="KEGG: mta:Moth_2231 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67500"
FT                   /db_xref="GOA:Q0AU52"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AU52"
FT                   /protein_id="ABI67500.1"
FT                   /translation="METGLVRIAEIARQNPKERFTALIHHINHETLKECHLEISGSKAS
FT                   GVDQVTKQAYEENLEANIADLIGRMKRQAYKPQPVRRVYIPKEGSNKRRPLGIPSYEDK
FT                   LVQKGLARILNTIYEQDFLDCSFGFRPGRGCHDALKVLNHIIERKKVNYIVDADIRGFF
FT                   DHVDHEWMMKFLELRIADPNLLRLIKRFLKAGVMEAGIVYDTPKGTPQGGIVSPILANI
FT                   YLHYVLDLWFEKVVKKRCQGEAYLVRYADDFVCCFQNKSDAEWFYANLRERLNKFNLEV
FT                   AEEKTRIIAFGRFADKESKKQGRKKPDTFDFLGFTHYCSKSKKGWFRVKRKTSQKKYRS
FT                   SLLKCKTWLRKHLISPTDYVIEMLQIKLQGYYRYYGITDNSTALRNFCDKVRRMLFKWF
FT                   NRRSQRKSMNWDKYVRFLNKHPLPKGRIYVDIYDVRPELLSYLK"
FT   gene            172219..172644
FT                   /locus_tag="Swol_0147"
FT   CDS_pept        172219..172644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67501"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K3"
FT                   /protein_id="ABI67501.1"
FT                   /translation="MKIQNPHDRFFKETLGKVEVAKDFLNNYLPGNIIKVIDVDTLEPQ
FT                   KDSFINKELQEGFSDLLFKANINNREGYIYFLFEHKSYTRKDIAFQLLRYMMEIWETKS
FT                   KKEKADELPVIIPLVVYHGKSNTRGQFYCVVIFILPC"
FT   gene            172715..173425
FT                   /locus_tag="Swol_0148"
FT   CDS_pept        172715..173425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0148"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: dsy:DSY3375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67502"
FT                   /db_xref="GOA:Q0B0K2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K2"
FT                   /protein_id="ABI67502.1"
FT                   /translation="MLRGINRQIIFEDDEDYQKFLWIIKDTKEKSGYEIYAYCLMSNHI
FT                   HLLLKEVTEDLGIVFRRIGASYVYWYNWKYSRRGHLFQARYKSEAVEMDSYFLTVLRYI
FT                   HQNPYKAGIVKNIADYPWSSYGEYVGEPRICDVEFALNMFSTNRVNAVKLFKEFNLVEN
FT                   QDRCLDYDQDARLNDTEASNFIRSISGVQSPTEIQGFKKDKRNEVIKECKAKGLSIRQI
FT                   ERLTGVSFGVIRTI"
FT   gene            173928..174617
FT                   /locus_tag="Swol_0149"
FT   CDS_pept        173928..174617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0149"
FT                   /product="phage terminase, large subunit, putative"
FT                   /note="KEGG: bca:BCE0397 phage terminase, large subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67503"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K1"
FT                   /protein_id="ABI67503.1"
FT                   /translation="MPMDTWEKCAHPVDPDLLKGRVCFGGLDLSSTTDITAFVLVFPPV
FT                   EGDDKYYVLPYFWLPEETLDLRVRRDHVPYDIWRQQGYLLTTEGNVIHYGFIKKFIEDL
FT                   GQDYNIQEIAFDRWGAVQMVQNLEGAGFTVVPFGQGFKDMSPPTKELMKLALEKRIAHG
FT                   GHPVLSWMMDNIHIRTDPAGNIKPDKAKSTEKIDGAVAMIMALYRCIRHKGVSEKSVYD
FT                   ERGLLAF"
FT   gene            174687..174998
FT                   /locus_tag="Swol_0150"
FT   CDS_pept        174687..174998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67504"
FT                   /db_xref="GOA:Q0B0K0"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0K0"
FT                   /protein_id="ABI67504.1"
FT                   /translation="MAKTTSIFARVEPEIKEQAEMVLNKLGIPMSNAINIFLRQVVLQN
FT                   GLPFEVKITHNRPLAVEDLTPEEFNNEIEKGFNDLRAGRVVSADKVAERINREYGHEL"
FT   gene            174982..175320
FT                   /locus_tag="Swol_0151"
FT   CDS_pept        174982..175320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67505"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J9"
FT                   /protein_id="ABI67505.1"
FT                   /translation="MGMSYKIIYTEESEQDLVNVYRYIAMNLLVPETAKKQIDRIMNAI
FT                   KGLDELPLRHKLYQDEPWHSKGLRVLPVDSYLVFYIVIEEEKTVAIVRIMYGGHNIDLQ
FT                   LSNTKIVD"
FT   gene            complement(175574..176536)
FT                   /locus_tag="Swol_0152"
FT   CDS_pept        complement(175574..176536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2242 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67506"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J8"
FT                   /protein_id="ABI67506.1"
FT                   /translation="MQAILKECAVIPSSKLGLLGNPDNLAISGDGSPVRTGASPRGKKL
FT                   CQCPAQGIYHCQCERSFTDPTANWGWDSYHEQWFYGHTLYSITSADSFNDLPIYLRFVQ
FT                   GSRHDSVTFVFAWVELLKLYPEFKFSKALLDSAHDVYDIYRLLNANHTQAFIDLNKRNK
FT                   GHNIYSGPLTVNDNGVPICIANLPMLNWGFNNDRCRIKWRCPHYKDRSKCPKSPECSPS
FT                   KYGRVVYTKPDWDLRIFTPIPRGSKAWKAIYARRSTVERTFKRILVDYKIENARCRSNK
FT                   RWFWQATIAALNQHLDAQVALLKPSILSEVGIKTISKAA"
FT   gene            177292..177561
FT                   /locus_tag="Swol_0153"
FT   CDS_pept        177292..177561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0153"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="KEGG: bca:BCE0398 phage portal protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67507"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J7"
FT                   /protein_id="ABI67507.1"
FT                   /translation="MKIPILWNLFKSRASPKNSFWQNTYTFFFGPTPSGKTVNERTAMA
FT                   TSAVYACVRVLSETIASLPLQVYYGARQCGRARLHHITGGNPVR"
FT   gene            178013..178423
FT                   /locus_tag="Swol_0154"
FT   CDS_pept        178013..178423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0154"
FT                   /product="RNA-directed DNA polymerase (reverse
FT                   transcriptase)"
FT                   /note="KEGG: mta:Moth_2231 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67508"
FT                   /db_xref="GOA:Q0B0J6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J6"
FT                   /protein_id="ABI67508.1"
FT                   /translation="METGLVRIAEIARQNPKERFTALIHHINHETLKECHLEISGSKAS
FT                   GVDQVTKQAYEENLEANIADLIGRMKRQAYKPQPVRRVYIPKEGSNKRRPLGIPSYEDK
FT                   LVQKGLARILNTIYEQDFLDCSFGFGYLYNFV"
FT   gene            complement(178656..179882)
FT                   /locus_tag="Swol_0155"
FT   CDS_pept        complement(178656..179882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67509"
FT                   /db_xref="GOA:Q0B0J5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J5"
FT                   /protein_id="ABI67509.1"
FT                   /translation="MQNLPNANREALARNIAKDCRTVEDIQSMIKALFKDTVQVVLEAE
FT                   IDEHLGYEKHSIEGNNSGNSRNGYSKKSIKTNYGVTELNVPRDRNGQFEPQIIKKYQTM
FT                   ANGIDEQVIAMYAKGMSTRDIEEHLKAIYGIDISPSLVSRITDKIMPQVSEWQSRPLDR
FT                   LYPIVFLDAIHFKVRKDNRIINKAAYTVLGINTEGQKDILGIWIGENESASFWLGVCND
FT                   LKSRGVDDILIACKDGLSGFSEAINTVFPQTEIQLCIIHQIRNSLKYVPYKERKQLMVD
FT                   LKKVYQALTLEEAKFSFEEFKEKWGKKHPIIIRSWEQNWLELTTYFAYPNAIRRLIYTT
FT                   NTIEGFHRQLRKVTKTKTAYPTDDALRKIIYLAIQDISKKWTMPIREWKQCISQMAIHF
FT                   GDRFSLERI"
FT   gene            179940..180268
FT                   /pseudo
FT                   /locus_tag="Swol_0156"
FT   gene            180425..181370
FT                   /pseudo
FT                   /locus_tag="Swol_0157"
FT   gene            181479..182750
FT                   /locus_tag="Swol_0158"
FT   CDS_pept        181479..182750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afu:AF1423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67510"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J4"
FT                   /protein_id="ABI67510.1"
FT                   /translation="MIKKYEIRDPLYGFIELDSWERDIIDHPAFQRLRRIRQLAWTDMV
FT                   YPGAVHTRFEHSLGVMHLATEMYEKIVEKKRGYLVNKLGFNDSGFDIDKKFIRLACLLH
FT                   DVGHSPFSHAGEELMDEKPNTDKRYKHEDYSPAIVEYKFKEIIDEHPQNENYHITVKQI
FT                   SDFLRGSAGVGRRLLWRNLVDGQIDADRADYLLRDSYHIGTNYGSYDLKRLLVTLTISE
FT                   HPETGAPLIAVEEGGLHAAEALIIARYLMFTQVYFHHTRRAYDHHIAETMKVLLLQEIN
FT                   RETFLPPTSAENIDNYLSWDDWKVLGLLSQGKGGKDGCALRERKHHRRVFYTSEVPTEA
FT                   ELDQSKAVLEKLSGLIQFVDEPEKSWYSTGEKDIMIERNVAPGLKETLPLSSFSSVVRG
FT                   LLPIRQRRIYVSLQDKSKADALLN"
FT   gene            182766..183296
FT                   /locus_tag="Swol_0159"
FT   CDS_pept        182766..183296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67511"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J3"
FT                   /protein_id="ABI67511.1"
FT                   /translation="MPIQFTEKWDQYGLMAELALKLEGVSPQFGKTVLQKLVYILQEIY
FT                   RVPCGYDYILYNYGPYSEALADDLSFFASMDGVKVEWNRRLGYEIKKAERTSHFRERGK
FT                   DFLTQHASQIDEVIKEFGSMNAKELELRSTILYVSKEEPLDKSDLLDRVKDIKPHFTVG
FT                   EIDNAYQELERWL"
FT   gene            183726..184463
FT                   /locus_tag="Swol_0160"
FT   CDS_pept        183726..184463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0160"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="KEGG: bur:Bcep18194_B2094 filamentation induced by
FT                   cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67512"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J2"
FT                   /protein_id="ABI67512.1"
FT                   /translation="MFHLMFHLIDEKKRQLDKKRPLPVNSLNSLKEALAVEWTYHSNAI
FT                   EGNTLTLAETKVVLEGITVGGKSLREHLEAINHKQAIQYIEDIVTHEEEFSEWQIKNIH
FT                   QIILKGIDDENTGVYRHENVLIVGAKHFPPEHFRVPDLMEQLIQWYKTEAQELHPVERV
FT                   ARLHVLFVGIHPFVDGNGRTARLLLNLELMKAGYPPLIIRKEDRLAYYESLDLAHTEEK
FT                   YNDFHLLVAEALNRSLDLYLRVV"
FT   gene            184735..186915
FT                   /locus_tag="Swol_0161"
FT   CDS_pept        184735..186915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0161"
FT                   /product="Alpha-tubulin suppressor and related RCC1
FT                   domain-containing proteins-like protein"
FT                   /note="KEGG: gsu:GSU1251 BNR repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67513"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J1"
FT                   /protein_id="ABI67513.1"
FT                   /translation="MGRYHLKRSGGAVTLVLLLSLLLSLGMVMPVAAQDSMVRSCSPVK
FT                   GTDLIEPQVAAGEATSFALREDQKLWGWGIDNYGQVGNGKIIVDGDERNGQETPYLLTE
FT                   KGFNEGFKQVAAGRWHTLAVKNDGTVWGWGNNEKGQLGNLPLGPHSTPQQIPNLQNMKA
FT                   VACGEFFSLALNNDGTVWAWGNNDGNELGRGATGPFYNNPEKVKGPGGTGYLDNVTAIA
FT                   CGRFHGLALKSDGTVWAWGDGSWGTLGNGEDFSEEVYPVRVLNLTGVKSIDAGDYFSLA
FT                   LKNDGTVWAWGGRGIGGQLGDGEVDDFVNIPQQVKGLNGLGNLNNVEAITCGINHSLAL
FT                   KDNGTILAWGENYGRLGDGDATSSESPVPVLTQDISGVVAIAAGGEHSLARKNDGTVWA
FT                   WGSNHHYQLTGDNDSGVPVQVEGIPLLAKPLISLSVKAADGGPELLTCFISKTTGYKMT
FT                   VENPLEAVKITPVPVSGATASVKLNGVVQNDGIVNLAVDPEQNKVEVVVSESGKDDLTY
FT                   NIDIRRLRLADPLTDLSVRGKADGSGNEYLTGFSGTSYAYNVAVENNIDAVKVVPTAVS
FT                   GATTVIKLNGVPQNGGVISNLAIGWDNRVDIVVIQEDRTDRKYTIEIGRKPNWKQGYEN
FT                   WPVEVQKTWTIKFNQAVKTTEAAKYIYVKDAQGTKVPLKDFIWSDNNTTVKVQAQSAYN
FT                   TGAKYTLHIETALESAQGTPLNAAIAMPFKIE"
FT   sig_peptide     184735..184836
FT                   /locus_tag="Swol_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.978 at
FT                   residue 34"
FT   gene            187457..189187
FT                   /locus_tag="Swol_0162"
FT   CDS_pept        187457..189187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0162"
FT                   /product="fervidolysin. Serine peptidase. MEROPS family
FT                   S08A"
FT                   /note="KEGG: gka:GK1517 subtilisin-type proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67514"
FT                   /db_xref="GOA:Q0B0J0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0J0"
FT                   /protein_id="ABI67514.1"
FT                   /translation="MGVLLITCQAGDILAANLSIDNKDGLIVQYRDNDAAADMLKTMDF
FT                   QVYRKQNLAANVDLLKLIPGTNRQEMMARLKKTGRVKYVEENKRIRLHRAPNDPYYIQQ
FT                   WALPVIRAEAAWEVVGTTARPVVVAVVDSGIDDKHDDLINRIDSRGYNFVEDNQDIFDW
FT                   EGHGTAVSSIIAAQTDNRLGIAGVNGQNPVKILPLKTIDIDGYGYISDIIKAIDYAIEA
FT                   EVDVINLSMGSDRYSDIENEVIQKAINCGITVVASAGNEGDSRYDYPASYPGVISVGAI
FT                   DRQGNPANFSNHNDQVDVVAPGVEIKACRPGNSYDCLNGTSFSAPMVTGTAAMLKSLDQ
FT                   SLQPDAICKIIQETSYDLGSPGRDNYYGYGVVDMGRAVLQVLPVRVKAIQLEPSQAQIT
FT                   MGETLQLKATFDPANSNNRNLAWSSDNEQIAVVNNQGMVRAVGVGQVSITAVSEDAGRA
FT                   ATCSITVVAPPPSREFITWKSREDVASNRCWHIRFSLPVNISSINLKTIYITDRQGNLL
FT                   PVQYLISPEQDASVVTIAPVSNYTPGERFTLWIKNVVAGDGRILQHGIKMDFVITVPDT
FT                   "
FT   gene            189634..192804
FT                   /locus_tag="Swol_0163"
FT   CDS_pept        189634..192804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_0241 glycosyl hydrolase, BNR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67515"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I9"
FT                   /protein_id="ABI67515.1"
FT                   /translation="MKNRLQSILALMLTVALLFSGLCLPQTAWAADDKTPEELEITWRI
FT                   KANADHAWSSESARENGKVYARYNLNDSFMLDLAGTTVLSRTGISWGGNPYFQPITENE
FT                   YSRSCAGGGTYTTWYLSELQRWTEKGSEKKDFESTTVENWQYRWPGKEHEGADDNPIPW
FT                   LEIIPPESDNEPIRYRICLEPFFFIDYDTADEYFETTGTIHSNWTDWEGSHSETGELGN
FT                   HAGGITPSLANQAWYDRVETNLDGSCAKGELTYSGGKYRGQGTVQHTFYDEDGKSSIEI
FT                   TYEINRKPSAKAIQPIQVLGRYEYNNDNDYVPATDFVAGKDTVIQVILPDDIKAEDQSN
FT                   ARVEIYHEGNKIATLSKFKKDKENNSLIFIPSSRSSCGNWKAGRYKFVATIGESEELTL
FT                   DDVLFQEQRKLKVLAVPVKANYAGTIETADSQWKNGGAFMRRVYPIAYNNITYKQGSLF
FT                   DASDASYDITTDAGRLKLWQALNELQKNGGPYDLIVGFIEKGILLSNGSILQGYTYGEP
FT                   SNIVVNSDQDMQATVAHEIAHIYKVGDEYQGESYNLGINSPPLGYQGSDWHDPNKTVTA
FT                   SDPKVQPFPGAEGALISKKLHPYDTGGRGLLEDSICFMGSGASQSKNWITPSVWKHLFK
FT                   ALAAPTTAASDSSIRVLQSTEGETRVIEASGWVSRSGVVELSQPWHSYYTTQPLVNQTG
FT                   TYTIQAVDTQGTVLASNGFTPSFFVRSNPPRQLERAPFAQVLVPFPAGTDKFVVLDQDN
FT                   TLLAELPVTANKPTVAITAPAAGQNLTGTSTITWTAEDDDKDNLSYEVEYSPDGSNWEL
FT                   LAYDIRDTQWVQDFSQLPGGNQAQIRVTAHDGINSTAAVSGIFSVALKAPEVFIEAPVS
FT                   EASYSTAEGGVVLQGSAYDPQEGQIYDDNRLVWTSDQAGELGRGPSVFTNLLSEGKHLI
FT                   TLTATNIAGLSSQVSISLNITSSAVVNPGTYTELIEKTFTDASQRKVLFNKPVNAATLQ
FT                   NNIRIMDSANNMVPIRIEAGDDGVSALIYPSTGAFSPGNYTIYIEQGIMSADGQPLNAG
FT                   YKMNFKMK"
FT   sig_peptide     189634..189726
FT                   /locus_tag="Swol_0163"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            192896..193759
FT                   /locus_tag="Swol_0164"
FT   CDS_pept        192896..193759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0164"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: pca:Pcar_2264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67516"
FT                   /db_xref="GOA:Q0B0I8"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I8"
FT                   /protein_id="ABI67516.1"
FT                   /translation="MGRRLRVEYLGAMYHVVQRGNNREFIFGRPDERDYLIEQVGNAVK
FT                   VDGVTVFAYVVMSNHYHLLLRTDGEFLSKVMHRVNTRYSRFFNCDSGRDRTGVVFEGRY
FT                   KAILVQNDDYLLSLVRYIHRNPLRAGIVSRFCDYRWSSDACYRQQGNGPGGGDFVNCDL
FT                   ILRMFSDKKQIALREYKRFMENDDGKDWENIPCIGDDSFAQLAEPRKEKAGRVSLDEIL
FT                   INTGVDNEEFQLIKQGSRKRLLQKYKIAFTGEAIGQGYTMREIGQHIKLSHVAISHLFN
FT                   SKQDSK"
FT   gene            193994..196540
FT                   /locus_tag="Swol_0165"
FT   CDS_pept        193994..196540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0165"
FT                   /product="WD40-like repeat protein"
FT                   /note="FOG: WD40-like repeat protein; KEGG: mac:MA4287 cell
FT                   surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67517"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="InterPro:IPR028059"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I7"
FT                   /protein_id="ABI67517.1"
FT                   /translation="MIGKKISKTASVLTLVLVFLGVAAFPTMAKEWNQYLNGPQHRSYI
FT                   NITGLQNEPELKWQYEITGEPGNPVIADDGTVYVSSARNYYGEENAAAKNISDLHLYAF
FT                   DKNGTLKFDKVLLTMTSNTDVFLSAAPFKLSIGNNGAIFAVSYDPNNRKGYIYSFDASG
FT                   HINWEKTYDNISLSGEPVIGTNNTIYVTAGTNMIYAFNGNNGTEYWNTDIGGGYLYGCT
FT                   LSNDETVLYAGNEWGTVKAIDAANGNIIWSNNHMHTDKTPVVAHDGSLLIANHYYNLLC
FT                   MLNPATGLMLSPAELKQGAGLGGEPAVNQNNQAIALEWKDGKVSCYNIPNGQQNWTVSD
FT                   IGTPYRSPIVDANSNIYFGAQSNIYALNAAGQLLWQKSIIPNNDGYRYMASNMIMNQSG
FT                   SIYFAACDSYNGKNYFVCYGAGGVNPPVESVEAPVFSPAGGTYAAPQQVSISSATSGAT
FT                   IRYTTDGTEPSDNSIIYTVPIQVGHSLTIKAKASKIGMNDSITTSASFSINIPVDPDAI
FT                   VLANHWISGAAFDFTKGKAFSFWEGNPEQYSDDLEIVGNPAAVMLRGNLIDMGSTTLEQ
FT                   LITPPASGYEGEIPAVSGHAYWAKVGDNYYKFVITNIDLTTDANGNVTSMTFKYQKYSA
FT                   VPEVKAPELKLAEITTKGDLSLIFDQVMANPSGTHNQFAVEVDGSKVPVTTVENTNTPT
FT                   KIKLVLQNKVIGARKVSIKYTRGEAAGEQIKSLDGRIVDSFIETWEEWTGPGSKSSYQP
FT                   WTIKFSLDVDPSSVNDNNIYILDKTGIKLAASLSIPDNKTVTLTPKTPYTSGESYILYI
FT                   SKSVRSAVGVRAYLKENIHMKITAVPGSAAELGCII"
FT   sig_peptide     193994..194083
FT                   /locus_tag="Swol_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            197015..198346
FT                   /locus_tag="Swol_0166"
FT   CDS_pept        197015..198346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0166"
FT                   /product="RNA-directed DNA polymerase (reverse
FT                   transcriptase)"
FT                   /note="KEGG: mta:Moth_2231 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67518"
FT                   /db_xref="GOA:Q0AU52"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AU52"
FT                   /protein_id="ABI67518.1"
FT                   /translation="METGLVRIAEIARQNPKERFTALIHHINHETLKECHLEISGSKAS
FT                   GVDQVTKQAYEENLEANIADLIGRMKRQAYKPQPVRRVYIPKEGSNKRRPLGIPSYEDK
FT                   LVQKGLARILNTIYEQDFLDCSFGFRPGRGCHDALKVLNHIIERKKVNYIVDADIRGFF
FT                   DHVDHEWMMKFLELRIADPNLLRLIKRFLKAGVMEAGIVYDTPKGTPQGGIVSPILANI
FT                   YLHYVLDLWFEKVVKKRCQGEAYLVRYADDFVCCFQNKSDAEWFYANLRERLNKFNLEV
FT                   AEEKTRIIAFGRFADKESKKQGRKKPDTFDFLGFTHYCSKSKKGWFRVKRKTSQKKYRS
FT                   SLLKCKTWLRKHLISPTDYVIEMLQIKLQGYYRYYGITDNSTALRNFCDKVRRMLFKWF
FT                   NRRSQRKSMNWDKYVRFLNKHPLPKGRIYVDIYDVRPELLSYLK"
FT   gene            198584..198691
FT                   /locus_tag="Swol_0167"
FT   CDS_pept        198584..198691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67519"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I5"
FT                   /protein_id="ABI67519.1"
FT                   /translation="MGRRLRVEYLGAMYHVVQRGNNRELIFGRPDERNY"
FT   gene            complement(198928..200622)
FT                   /locus_tag="Swol_0168"
FT   CDS_pept        complement(198928..200622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0168"
FT                   /product="C-terminal processing peptidase"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: dsy:DSY3259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67520"
FT                   /db_xref="GOA:Q0B0I4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I4"
FT                   /protein_id="ABI67520.1"
FT                   /translation="MILMLSLLLMVGPLGAANPEDGFKPAAIIELQSHRLAAYSSDSTP
FT                   EEQVRYWLQHAYMDPVPERVLYAGSIDEMIRSLNDPYTSFMTPEEYDSFVSPGVIGIGI
FT                   YIESVPQGILVKSLIPGSPAEEGGLQSGDIIIRVKEHQEENWISLAGLSTDQGGSLIRG
FT                   PAGSQVDLTIIRGEQLLQFTFTRKKVEIPPVVTSLPDPATACIDLNTFLNSENQPSTAS
FT                   LFAEALQDMESQGAQGYILDLRDNGGGYVYNALDISGFFIGDKPAMQVRPLVTSDTALK
FT                   HELLITKPVVVLINQNTASASEILSGALKDYNCALFLGQTTYGKGCMQSAYPIFNQGKL
FT                   YGYLKMTTARYFTPLGYVVDQTGINPDITINQSDPLLAARLLLSATVPSSSGSNSSMVK
FT                   LINGNQEYRIDINRAQQQEYWPVYNEIIDHAGSTRLMLPDSSAWTQASPEQLQAKWPLY
FT                   YPGYHPFPTVNKHPGESITISFSHDVDPASIYNQAIELREKESGKSIDLNFQLKNEKEL
FT                   QLTPQKPLQPDQEYWLIVHPGANGVRSHDQQIPLSTGYITIIMVPGT"
FT   sig_peptide     complement(200572..200622)
FT                   /locus_tag="Swol_0168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.943) with cleavage site probability 0.851 at
FT                   residue 17"
FT   gene            complement(200860..202749)
FT                   /locus_tag="Swol_0169"
FT   CDS_pept        complement(200860..202749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0169"
FT                   /product="Uncharacterized protein"
FT                   /note="KEGG: bcz:BCZK1807 possible murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67521"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I3"
FT                   /protein_id="ABI67521.1"
FT                   /translation="MTKSYLRAGIIISLLTLFLLGNLLPAQAESSGPVAQSWVWVNPMN
FT                   VGESIEHPTMVRTLAATSSSTASNLQELKTLLRSGLENRQTSINILYTGNNSDLNKGLD
FT                   TGAAGLTEIYESLLGEDDYLNFNIKSTKYGYNGYEGQVNVYFTMVYQTTLEQENYVNEQ
FT                   VAAILSTIIIPGMNEHQKEKAIHDYIVKNVAYDESYSPSSHSAYAALYNKKAVCQGYAL
FT                   LAYKMLSEAGVSARCVVGTGHDESHLWNLVCLDGNWYHLDCTWDDPIPDTPGKIRYNYY
FT                   NLSDQEMAVDHIWTAGDYPACSSSYYHELNNKLGSDTNNQALWQSLLIETELYLLSPEK
FT                   TAENAAALEEKIHNSLLLYEPALKLRFHSAGADPGSLLNSLLESALTGTDCSGYSCQYS
FT                   NYNRDGQTGYYLLEFTFTYHNNTGNANLNSLTLSNGTLSPAFDPGITSYTVNVDNTVSS
FT                   ISITPTAAAAQAAIKVNGSPVSSGSLSQAIALNPGNNTIAILITAQNAATRTYTITINR
FT                   ALPLPSVVWTSWKEEKTISQNHPYWTITFSQDVDDSTVNSQNFFVGTNPEGTTPLPGVP
FT                   VPQLVTAKQIRLSPPSGSEHWSPGTYYLFIRPDVKSTSNKTLGQGIRMKFTVQ"
FT   sig_peptide     complement(202663..202749)
FT                   /locus_tag="Swol_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.993 at
FT                   residue 29"
FT   gene            203170..205131
FT                   /locus_tag="Swol_0170"
FT   CDS_pept        203170..205131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC13101 outer membrane protein with alpha
FT                   integrin like repeat domains"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67522"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I2"
FT                   /protein_id="ABI67522.1"
FT                   /translation="MLNCMKKVVLLICCLFLLGSVFCVNQVVYGIGGAPPAGAGLQLEL
FT                   NPSTLTAGYNQTSMLITNNTGAALWQAGDRLGLQVMKLTQSGQPTVAIPNFRPEEVLDK
FT                   TIQFTLSGGLEAGDYIVGIGTQDGIQLGYAMLSIKGAGSEDFAIKTVSPGQGAAQVSRY
FT                   TTVEIEFSGPADDNTLNNSSITITNQNTGGTISNFSVNYDAANYKAIIFFATPLDMNSS
FT                   YAVQAGTGVKSLDGIALKTPFTWSFSISSEDLPPGLFTIEVKNGHGNWIPASNLAESSL
FT                   GVYYYFPGQSIELRLKAKANATLPPDYSLSADLSSIIPSLSQPLNYDMASGYWQLSYRI
FT                   PANVSISGPCEIIISTQWQGEPFPAAIMMAIMNINPKDFNMGLAGDTTDWSTIKDFTCI
FT                   PGLVFERWDNGMRIARLELGDAQHPINLCEIDDKGNPTTAAATQELGKNMELAYGKMSM
FT                   DMAVEGMAAMNQPATITMHNIQSKGAPGVKYTDSDGLSQVAIRPGDSNPSDLSGKISDY
FT                   SWDSANGTLTIKVNGWSAYEIIPVLEPPSGSFKSRYDTPKTAPNRNHSWTVKFSAPVDF
FT                   TSLNALSADAGILVLSEAKQQQMVSFAPAGQDCIKIIAPNGGYSPGTYTIYIRDILRSA
FT                   AKPAQALKEPVKFTFIVY"
FT   sig_peptide     203170..203247
FT                   /locus_tag="Swol_0170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.641 at
FT                   residue 26"
FT   gene            complement(205370..208723)
FT                   /locus_tag="Swol_0171"
FT   CDS_pept        complement(205370..208723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_0738 VCBS"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67523"
FT                   /db_xref="GOA:Q0B0I1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I1"
FT                   /protein_id="ABI67523.1"
FT                   /translation="MLYQLKYRDKRILPFLLVLFLVSAVLVFSFADNAKAQVPYIYQWE
FT                   DDSSGTGINHLNIGFDYPIETVDNDLIVIRQKGSGSNQVALDSKAIDPDYTIINNNNSL
FT                   IISFPSIAVDTVNGNIEMLQVSARYPDIAEWELYIPVGALEFTAASQYTQLIDIVIPFY
FT                   IWEAEPGFRSTFMTTAAEDINVRIFQNNPMRNIKVYQPADYITALKTIHRFEGVFHDDN
FT                   LTPPQLSNIDITAKTGVEQVHVKVGANPERRLSLDPVAKCFTVGYAGLEAGLRDDENGD
FT                   NINIKAYDPYGKLLEERNFKLKVGEANSNVSSDFIVEDYLVKAGTSTLKNEYTLYDLVS
FT                   DPALAQIILASIPAGELDKLKIFYPNKPNMLIIKDLNTMAAALAKQQLSPKLLILASSL
FT                   SSCPTLNIKNALTLDGKGNGLSFTQGNKLVIGDGTEDLDVTLRNLTITGDLDVNAGPNG
FT                   SVVLENVTVNGTTTIISGGINSVYLRNFKTTTLRINNTHEIRIIAQGTTSLSSTYLNAP
FT                   GQSITLVLDQNSGNPSFGNINGNCDTLTWGAGDEFSMPFTAPNIDIQGNLVIDIGVAGS
FT                   VNLNNVFYSGTITNTSGGDIQALQLNTSSISESAKNDGSIETTLIVTQNKGIFNNVVAI
FT                   ETDPALPNNLTPSVLRNSASQITITFSGKALDHQAADSVKSVKIIIRAGNIDGVSSDLI
FT                   SAPFAINFLDNTAPNNQDTVFKKDVTVRPNTEVTIASSGNEANEIWFAPIGTTTFTPGL
FT                   AMTQANSGTATTISAPANEGFYKLYIIEPSGKISRPSLATLTVDNTSPGFTLTSSATQL
FT                   PGSKKVEFLVEADEACTAYYVILANGAAAPAPEQVMAGKDKAGATPLDSGNANIDANIE
FT                   KSFISKALPEDNTPYDVYVVMKDAAGNVSVAAAMLDITTPIAKAVTGINIEKQPTVMSY
FT                   VYGQKLALNGLSVKLSYNDYTSEIVAFTTSSFSNKNITASPAHGTILIKNDHNGIPISV
FT                   SCNGITKNTTSALTVEEASIASTNPTDLNEATTNDGSLANGDIVVTIANGILQSIAKAD
FT                   VTANNLPAGLNYGITRKSTTQLMIQITGRATNHASTDSISNVSFTIKQAKVTGATSDLT
FT                   TDNISINFND"
FT   sig_peptide     complement(208619..208723)
FT                   /locus_tag="Swol_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.661 at
FT                   residue 35"
FT   gene            complement(208788..209984)
FT                   /locus_tag="Swol_0172"
FT   CDS_pept        complement(208788..209984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xoo:XOO4475 hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67524"
FT                   /db_xref="GOA:Q0B0I0"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0I0"
FT                   /protein_id="ABI67524.1"
FT                   /translation="MGKVLTRTPGLIMKKNFTHNYSHIFMSLLIVAAVLIIGIVFKISP
FT                   AQAALSEAASVKYIKKWTIRFNQPVDPNTVNGNNIYVVDANDKRINNIELITEDNIVYV
FT                   SLKGNHTYAEGNYRLVITDKICSQNQICLQKDIIKPFQVMGRNYFTFDDANLPSALTGA
FT                   SYSINLGVGNINDGTWACVPGSLLPDGLSLNPKTGTINGSPTKEGTYKFTVKKTKDKAS
FT                   EEKELTITILPGNYDSYKLTLPNTTPGEHMPLGQAELSYPAGIKKQIEILWNPPASSEL
FT                   GSQQFSGYLGGSDRQVQETGSISYLKDVDFTYFYWPNYNWRTVAVNVNGVVREVWMDAK
FT                   YKDGKRTRKMDLMIDSSLKAAGNVFGINTNSLETDNQVTFRLFNAYGKLLETREMTVK"
FT   sig_peptide     complement(209838..209984)
FT                   /locus_tag="Swol_0172"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.953 at
FT                   residue 49"
FT   gene            complement(210317..213652)
FT                   /locus_tag="Swol_0173"
FT   CDS_pept        complement(210317..213652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0173"
FT                   /product="ATP-dependent transcriptional regulator-like
FT                   protein"
FT                   /note="KEGG: sth:STH810 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67525"
FT                   /db_xref="GOA:Q0B0H9"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H9"
FT                   /protein_id="ABI67525.1"
FT                   /translation="MQRELIHNSIVQGLLNRKDMHMAMVSLVNSQLTPPHIKNSIKRDR
FT                   LQELGLSILSHRVTTITAPAGYGKSVWVASLLQEEEWPPTAWLSLERYNGDPSFFLYHL
FT                   IHAFKKINPEYGSQSLRTLNSLRNLKQDYFIAASAIIQELPQDQEMVLVLDDYHLIDQN
FT                   QLLPKIMEYLIRRLPLRTHIIVISRTPPKLNLHQELLKGELLEISSQALLFTPEEIREL
FT                   LSLEGLVLSTEDCTYIHHCTEGWAAGVRLLGLSLKQFGGNWRNNLSSLTGKHTALYIYL
FT                   SHELFNYLTRELQDFLLDTAILPYLEPILCQEVLGDTRSEEKIHELHLMGLLSQVESNT
FT                   TIWRFHHLIREFLLERALNIRSPEYIVSLRRRAAFHLEKNGHIDQALEQLAACADWSKA
FT                   ADLILAYAEPYFLENGCHNALYSWIKTLPVDYLNSHHQLLYYKGICLRDNHPQKAQEIL
FT                   SRAAARARDKGDVKGEIRSLMAILAVHIFGNDSTRSEAVAGRIPVIASSLKDSWAQGFA
FT                   LVAALGKAVSEDDLKQGLYLSRLVAKTPLEPEWQFYYLLLSGVVHYRLGNLDTARQLAE
FT                   KALALPLVQKSDRWLGVAYVLLSGIYCAKGEIRPAIEISRQLIQLGHKYNIPHQIAYGH
FT                   RRLAQVYLLQGKLVEARYESELCSELWLEANNGAMARHADLETIFFRIITGENAKNSFQ
FT                   EKQDFIKIILNKQSGYGSKDYSLSIAGVIAREAGQMEQARQWLEESAASSEKKGAKQLL
FT                   AGTLLNLASLYLLLGDESNADHKLHKALGLAQANKIDTFWDWHPETVYKMCHRALLKSI
FT                   YPQWALHILQRWFSERICEEANLFLVNNDENTHNAITTLVQNYAQFKGVPIIHANFMGG
FT                   FQVFVNGVIIPATHWKTKKAENLFKYLILDRRPQSKEKILSLIWPKTDDPASDANLRMA
FT                   LTHIRQALNLSPNSNDSIVLRRGMIYLNPEIKVFTDYELFVSLSKKILYPIGRDTNSLE
FT                   QLHLMENAARLYQGELLPDNIYEDWTSSQRHKLHDLYIQIQLKRIEAYIQSAQPSRALE
FT                   IYQSCLAIDPMDERIVKISMELLISNGQRHKALQLYKDFAQGLAQEYGLEPSAEIKSLY
FT                   ERIF"
FT   gene            214164..215480
FT                   /locus_tag="Swol_0174"
FT   CDS_pept        214164..215480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH1184 hypothetical protein,
FT                   aspartate-rich"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67526"
FT                   /db_xref="GOA:Q0B0H8"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H8"
FT                   /protein_id="ABI67526.1"
FT                   /translation="MGEGVQISNVKYTGTNVSAGTFTATDSSIIGFNEGVILSSGNIRL
FT                   VDGPNVSPGITHVNGLQGDEHLDLLIPGYETEDATILEFDFIPSKNTFSFDYVFSSDEY
FT                   NEFVNSRFNDVFGFFLNGKNIALIPNTDIPVAINNVNNGMNSQYYRDNEYDYVNDPQIM
FT                   TEMDGLTTVLTVTAAVQVGQKHTIRMSIADAGDNILDSNVFIKGSSFTSVESDVIQFSQ
FT                   ATQQVNENDGTATITVTRSGNAQNSVSVEYYTKDGSAKAPNEYLASNGALVFEPGVTSK
FT                   TIPVTIVDNNVAGDIKYFYVYLKNVTGNAIIGDNIRSRILINEDDSTAGQVQTILWEEK
FT                   TEKQTDKNYIINFSAELDPKTVTSEYFYIKDGAGQIINEIIPELTFNKRSVIMKASGGV
FT                   YSYQPGETYTLFISPEVKSLAGKPLGKQIIMHFTINDLQ"
FT   gene            215647..216789
FT                   /locus_tag="Swol_0175"
FT   CDS_pept        215647..216789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67527"
FT                   /db_xref="GOA:Q0B0H7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H7"
FT                   /protein_id="ABI67527.1"
FT                   /translation="MKGKGKGQYFLLIFLILISMLATGCGKEKELVKESALTVNTAPAV
FT                   KCDIAKSMRYSGMVRGHNEVYITPKMPARVTAIHVQPGQRVRAGQLLLSLDSKDLNVAV
FT                   KQAEAALAGARAAQVANELSLENARKNFERNEELHKAGAISDSQFEAEKLRYESLNSGA
FT                   VAASVAQAEAALASLQNQMENCNLTSPIDGIVGSINLSLGETASPQMPAAIVTDTGELE
FT                   IELLVSEAEVSYIKMGSAVDVSIEAASEKPFTGQVKSVSVVPDPVKRSYAVKVSLPNPE
FT                   GLIKSGMFAEARVDTQSKKDVLAIPVNAVVPKSGRQVVYVLEMKDKENRAREVEVETGI
FT                   KNENYIEISKGLKPGQEIITRGNTLVSDGTLVRVVAGGSK"
FT   sig_peptide     215647..215721
FT                   /locus_tag="Swol_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.793 at
FT                   residue 25"
FT   gene            216789..219893
FT                   /locus_tag="Swol_0176"
FT   CDS_pept        216789..219893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0176"
FT                   /product="acriflavin resistance protein"
FT                   /note="KEGG: mta:Moth_2369 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67528"
FT                   /db_xref="GOA:Q0B0H6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H6"
FT                   /protein_id="ABI67528.1"
FT                   /translation="MKIVEFAVKRPVTMSILVAVVIIFGFFTLSKIPLDLYPEMKFPYA
FT                   AVMTSYPGAGPEEVESQVSEPLEGILNTLSGVKEIQSQSTSGNSLILIKYDWGTNIESA
FT                   LMDIREKIGLIEKSLPSGVEKPMVLKMDPTMMPIIQMGIRGGDKISLGQLQSIAEDVIE
FT                   PRLSRIPEVASVVITGGLEREIKVEVDPVKLEDYGLTLTQVNQVLQLENFNLSGGKARE
FT                   GEREYYVRSLQQFENLDDIRNVAILTPSGNSVYLNDIAMIEDAYKDDTQITRVNGSKAV
FT                   GIHCLKQSDANTVKACAAVREEMEEIMTELDLDLDYQVVMDQSSFINQSLDITKRMMVE
FT                   GALLAILVLFLFLRNGRSTLIVFTAIPLSIIATFILMYVNNSTLNLITMGGLALGIGRM
FT                   VDDSIVVFENIYRHRSLGLPPMEAALTGASEVGNAVIASTTTIIAVFFPIMFAEGLASV
FT                   LFKPLAITVSFAIFCSLMVALTIVPLLASRMLSDKAMQPLDPEKGRVSRVVFNFGNWLD
FT                   NLGERYKIILRWALGHRRHVVALVTLLMVGALALVPFIGAEFLPAMDAGEISITIENDK
FT                   GTLLKDTEQVVEKVEAQLREVPEVFTIFSSVGSSASMFFDSGTKADQATIYIKLVPKNE
FT                   RKRSGDEVAEDIRSRLSGIAGSKIKVSMMDLTSTGPSGGGPVSVQVRGDDMQVLREISE
FT                   EVAEIVRKVPGTREVISSLSDGIPEIQVKIDRKRAAAYGLTPMQVASDIKNAMQGNVAT
FT                   RYRVGGDEVDVRVRYSPQNHKELEYLENLAISTSRGGVLRLSQIASFEMAPGPIQITRV
FT                   DRVRRAEINAYLLNRDLSVVMKDIQNEVDKINLPSGYSIEYGGQNKDMMESFTSLGIAL
FT                   ILAIILVYAVMAIQYESFFNPFVIMFSVPTAFIGVVLGLLLTNKAFSVSAFIGVIMLVG
FT                   IVVANAIVLVDYLKQLRERGMERDEAIVEAGRVRLRPILMTAFATILAMFPLSLGIGEG
FT                   AEADAPLAIVIIFGLLVSTFITLILVPVVYSIFDDWGQKLKLRRG"
FT   gene            219971..220543
FT                   /locus_tag="Swol_0177"
FT   CDS_pept        219971..220543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0177"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: mta:Moth_2368 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67529"
FT                   /db_xref="GOA:Q0B0H5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H5"
FT                   /protein_id="ABI67529.1"
FT                   /translation="MKKGKRELILEAAVHVFSSKGYHNARMEEITAVAGIGKGTIYEYF
FT                   PSKLQLFQDMLNKSLQVYYQNFNPEEMKQLPVEQRLRIIFETHIKFCRDNKELTRLVFW
FT                   DSDVFDQELREWIYTQRQEKEERVVEIIEEGMARGELRELDPMLVKVLLTGSVAAMWAP
FT                   ITLDGWEIAPEVLARDVTDILMNGLKK"
FT   gene            221066..222397
FT                   /locus_tag="Swol_0178"
FT   CDS_pept        221066..222397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0178"
FT                   /product="RNA-directed DNA polymerase (reverse
FT                   transcriptase)"
FT                   /note="KEGG: mta:Moth_2231 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67530"
FT                   /db_xref="GOA:Q0AU52"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AU52"
FT                   /protein_id="ABI67530.1"
FT                   /translation="METGLVRIAEIARQNPKERFTALIHHINHETLKECHLEISGSKAS
FT                   GVDQVTKQAYEENLEANIADLIGRMKRQAYKPQPVRRVYIPKEGSNKRRPLGIPSYEDK
FT                   LVQKGLARILNTIYEQDFLDCSFGFRPGRGCHDALKVLNHIIERKKVNYIVDADIRGFF
FT                   DHVDHEWMMKFLELRIADPNLLRLIKRFLKAGVMEAGIVYDTPKGTPQGGIVSPILANI
FT                   YLHYVLDLWFEKVVKKRCQGEAYLVRYADDFVCCFQNKSDAEWFYANLRERLNKFNLEV
FT                   AEEKTRIIAFGRFADKESKKQGRKKPDTFDFLGFTHYCSKSKKGWFRVKRKTSQKKYRS
FT                   SLLKCKTWLRKHLISPTDYVIEMLQIKLQGYYRYYGITDNSTALRNFCDKVRRMLFKWF
FT                   NRRSQRKSMNWDKYVRFLNKHPLPKGRIYVDIYDVRPELLSYLK"
FT   gene            222632..223636
FT                   /locus_tag="Swol_0179"
FT   CDS_pept        222632..223636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0179"
FT                   /product="secretion protein HlyD"
FT                   /note="KEGG: mta:Moth_2328 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67531"
FT                   /db_xref="GOA:Q0B0H3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H3"
FT                   /protein_id="ABI67531.1"
FT                   /translation="MARKKYAVIIFLVMLLLVAMGIFYAYFYQQQKALADRRESLAATG
FT                   TIEAKTIMTSFKVPGRIETLLFDEGATVEKGQELAVLETQEIEARLLQAEGSCQAAEGL
FT                   AGQAEKAVSLTSQTVEAKIAQAEANLTNYQQKFDRVKSLHESGAIADSQFDEAANALKA
FT                   AQGQLDEARAGREKVEVAQQEHLAAVGKAQQAQGVLQEAQTAMNNTRLKSPISGYITQK
FT                   VIEEGEMLNAGTPVFEISDLKHPYVKVFIDERKIGRVYLQQAVEVRVDAFPRKVFPGKV
FT                   VWISDAGQFAVQKAINEQYSHDIRSFEVKIDLPNDDLALKTGMTASVQFAEGK"
FT   sig_peptide     222632..222697
FT                   /locus_tag="Swol_0179"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.898) with cleavage site probability 0.390 at
FT                   residue 22"
FT   gene            223639..224355
FT                   /locus_tag="Swol_0180"
FT   CDS_pept        223639..224355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0180"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: mta:Moth_2329 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67532"
FT                   /db_xref="GOA:Q0B0H2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H2"
FT                   /protein_id="ABI67532.1"
FT                   /translation="MEEQAKLVEVKDLVQKFLLKRVLDGISFNLLSGEALGIFGLRGSG
FT                   KTALLHILAGVERFSSGQVEVLGCDIRKDQSFKQGIGLVTQEPSLFQDLNVLENLDFIA
FT                   SLKNAGPPDIERVILQLELKDYLRYPVNSLEAGVYQRLSLACAILNSPRLLILDEVIKD
FT                   IDIYSRHLILQGLEPFLASGGGVICGFSNIEMSAYFNHVAWLEKRQMEILSSGEARDKW
FT                   IQLLESFKKPGDWDAE"
FT   gene            224345..225493
FT                   /locus_tag="Swol_0181"
FT   CDS_pept        224345..225493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0181"
FT                   /product="ABC-type multidrug transport system permease
FT                   component"
FT                   /note="KEGG: mta:Moth_2330 ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67533"
FT                   /db_xref="GOA:Q0B0H1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H1"
FT                   /protein_id="ABI67533.1"
FT                   /translation="MRSKSGFKIMRREFNYMWRDRGLRKILLLGPILGLFLFMAIYQTQ
FT                   TVKDIPTAIVDLDGSSSSREISEKIKHAEHLKLRAYPQSYEDLEQSIRRGEIVVGVVIP
FT                   ENFGRDVARHHPTRVLVIVDSSNTVYATNASTAVLGVIRSISAEAGVKTLLARGMDPSQ
FT                   ARKAFLTVDYREEGWFNPTLNYAYFLVLAMALNIWQQCCTMTASMNVIGETGMKSWLQV
FT                   KASGVSRFKYFFSKSLAHLITFMLLVIPVYILALGIFKLPLSCGLGMLLLFTLVFAVSL
FT                   HSVGTLMSSLANNAVDSTRFGMMVALPSFVLCGYTWPIEAMPGFLQSLVWILPQTWFFQ
FT                   GFNYLSFKDPGWSFMLPYFGGLLVISLVCYSMAAMATAWMER"
FT   sig_peptide     224345..224479
FT                   /locus_tag="Swol_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.879) with cleavage site probability 0.743 at
FT                   residue 45"
FT   gene            225504..226751
FT                   /locus_tag="Swol_0182"
FT   CDS_pept        225504..226751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0182"
FT                   /product="ABC-type multidrug transport system permease
FT                   component"
FT                   /note="KEGG: mta:Moth_2331 ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67534"
FT                   /db_xref="GOA:Q0B0H0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0H0"
FT                   /protein_id="ABI67534.1"
FT                   /translation="MKQLWNISHYEFLHILKDPILFIIVFIAPLFYCGLFGVVYFSAIL
FT                   EDVPLAIVDQDQTVLSRELLAAFANDSSFRLVEGVDSYEELEEGMRSGSLRAGIVIPRG
FT                   FEQKLYQRSPSELLAVYDASNLIWGFNSRKFIREVINDFTTRHAAAYLLSAGCSPREME
FT                   ALINSVECNISPWYNPNFSYTNFLFMGLMMIAVHQLSIFGVCLSVTREKERKSWVHFVY
FT                   TMVPAWKIALGKTLPYLIINFFNYALVLFVSSRFVQVKIEGSVGLLILLGVLYLLAITF
FT                   AGFIVSVHAPNSLQATRYLMLLSLPLIMISGYTWPKAYMPDIINLVAALFPSTWMTLGF
FT                   RLVSIKNLGLDLMWPTLLVLSGMALLAIFFALSFKKESVIRVDDALSINGGYSYPRKVN
FT                   RLRALRQQIGAKHLSC"
FT   gene            227040..227483
FT                   /locus_tag="Swol_0183"
FT   CDS_pept        227040..227483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A1957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67535"
FT                   /db_xref="GOA:Q0B0G9"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="PDB:3IN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G9"
FT                   /protein_id="ABI67535.1"
FT                   /translation="MLESVRKEWLEIMDRELLEKARSLINANYISTTLSTVDRNYEVNI
FT                   AVISVLEMIGDDTIICARFGADKTYANLKETGKGVFMVLLTDNDKSKDGIRVYVELSAD
FT                   LQEGEYFDRIKKRLDNTTYKNFPLKNCLVFKIVKILPVSLLRK"
FT   gene            227640..228773
FT                   /locus_tag="Swol_0184"
FT   CDS_pept        227640..228773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0184"
FT                   /product="UDP-N-Acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: chy:CHY_2554 UDP-N-acetylglucosamine
FT                   2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67536"
FT                   /db_xref="GOA:Q0B0G8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G8"
FT                   /protein_id="ABI67536.1"
FT                   /translation="MRLGKVMTVFGTRPEAIKMAPVIKELKKVKDIETVVAVTAQHREM
FT                   LDQVLQLFDITPDYDLNLMEEKQDLYSITTGVLNGMKGILAKEQPELVLVHGDTTTTFA
FT                   AALAAFYQRIPVGHVEAGLRTRNKYSPYPEEMNRTLAGRLAELHFAPTDTARENLLNEG
FT                   TGSFKIWVTGNTVIDALLDTIRPDYEFGSELEEIDLSKRLLLVTTHRRENWGRPMREVY
FT                   QALIDLVDEFPDVAVVFPVHRNPVVRDVAREMLEGRERFYLIEPMDYEPFAHLMNCCYM
FT                   VLTDSGGMQEEAPSLGKPVLVLRDTTERPEALQAGTVKLVGTVREKIYNEARLLLSSRG
FT                   EYEKMARAINPYGDGQAAIRIVDVIKDFLYVRIGAQG"
FT   gene            229071..230258
FT                   /locus_tag="Swol_0185"
FT   CDS_pept        229071..230258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0185"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: mta:Moth_0974 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67537"
FT                   /db_xref="GOA:Q0B0G7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR008595"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016381"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G7"
FT                   /protein_id="ABI67537.1"
FT                   /translation="MAGNRGKAKSEEKQPIQLGHLENILGQLVGTLEKGRNDIYDIAEK
FT                   CYQECNRLELEREEVNREASRTIVEVEKYEKLERYARLRLAEVSRNFLSFSENDIKDAY
FT                   DKARILQLTLLDLRQKEMYLRRRRDQLDLDIKQFKAIALKADGFLSSTGVALKILQGNV
FT                   ERIGESIEEFQRQQQLGMWIIESQEAERRKIARELHDGPAQNLVSMLIRLDLIAQLGYE
FT                   EKERISDEINNIKDMARESLADIRSIMFDLKPLLVHEHSFCQTLREFFSEYEAHYNFTT
FT                   DLIVLGDDRDYDFSMEIALFRLIQEAITNVKKHAGVNHAMVKIENTDKCLRLVIKDEGR
FT                   GFSVEGARANKESYGIIGMKERVEIFGGEIEIISSPGSGTQVIVRIPWEEEGNNG"
FT   gene            230251..230892
FT                   /locus_tag="Swol_0186"
FT   CDS_pept        230251..230892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0186"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: mta:Moth_0975 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67538"
FT                   /db_xref="GOA:Q0B0G6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G6"
FT                   /protein_id="ABI67538.1"
FT                   /translation="MDKARVVIADDHVLVREGLRKLLELDSNIKVIDEVGDGQGAINIA
FT                   RKEKPDIIIMDVNMPGTDGIVATRVIKRELPSVRIIALTVYEGEEVVDMVKAGASAYIL
FT                   KDVAGSELVDTIHRVMNGEVVIYPRVANRLVRELRQSENRKSEIRLTKREKDVLTLLVK
FT                   GNTNKEMAEVMFISEKTVKNHLTSIFRKLGVKDRTHAAIYALKNRIVSEE"
FT   gene            231130..231393
FT                   /locus_tag="Swol_0187"
FT   CDS_pept        231130..231393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67539"
FT                   /db_xref="GOA:Q0B0G5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G5"
FT                   /protein_id="ABI67539.1"
FT                   /translation="MAKYVSVLNKPSSCILCTNMLEGGCFVLVLLKSLSLALWLFIMLA
FT                   VVIAYRGNNPKKVKRFNMKLDEDYYRKKRDRYFCLLLNQGTS"
FT   gene            231711..232430
FT                   /locus_tag="Swol_0188"
FT   CDS_pept        231711..232430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0188"
FT                   /product="phosphoribosyltransferase"
FT                   /note="KEGG: mta:Moth_0225 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67540"
FT                   /db_xref="GOA:Q0B0G4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G4"
FT                   /protein_id="ABI67540.1"
FT                   /translation="MIDLIMDILFPQTACYICREPGRYSCRYPWCDACEDEMDRLKKCL
FT                   SLCDHCGKYLGEGENLCVECRQNPPSFNIARAVGPYEEPFRIAVKVFKFLGRKQLAKKM
FT                   GDMMAEVVEREPRFWPLDIIVPVPISQGNLRQRGFNQTELLARQIGRRLKIAVEPGILV
FT                   RIKETPSQRELTREEREKNLLYAFKVTQPQKVLGKKILLVDDVYTTGSTIRECTRVLLE
FT                   AGAERVSVITWAIGKGF"
FT   gene            232575..232994
FT                   /locus_tag="Swol_0189"
FT   CDS_pept        232575..232994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0189"
FT                   /product="flagellar protein"
FT                   /note="KEGG: tte:TTE0491 flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67541"
FT                   /db_xref="InterPro:IPR022258"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G3"
FT                   /protein_id="ABI67541.1"
FT                   /translation="MSNLRNCSKCGRVFPYMGRNICPRCLEKEEDEYQVVRRYVRDHPG
FT                   AGVIEVVEETGVEEDKILQFLRDGRLQAKGLTASLRCERCGQSINSGRFCESCINEVNA
FT                   EIQGHLPQKAKSEEPKRPPRGKVKDKMHIKDRGFF"
FT   gene            233196..233489
FT                   /locus_tag="Swol_0190"
FT   CDS_pept        233196..233489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0190"
FT                   /product="anti-sigma-28 factor, FlgM"
FT                   /note="KEGG: dvu:DVU0523 negative regulator of flagellin
FT                   synthesis FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67542"
FT                   /db_xref="GOA:Q0B0G2"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G2"
FT                   /protein_id="ABI67542.1"
FT                   /translation="MIISKTQLLNVLKIYNKGDNKVEKAQAARGAARADELAISRESKV
FT                   KQKAMHAVRQADDIRLEKVAELQEQISAGTYTLSDDEVAEKMIERVLVDRLI"
FT   gene            233615..234127
FT                   /locus_tag="Swol_0191"
FT   CDS_pept        233615..234127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67543"
FT                   /db_xref="GOA:Q0B0G1"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G1"
FT                   /protein_id="ABI67543.1"
FT                   /translation="MEKLLQDFIETIAKQNQVLERLAALGQEKQELIIAGKVRELDSLI
FT                   QKEGITVSNLDKMEGARFKLQENLAVQLGFKAEEFSAKKLLAWVREGCPELYPALEEVI
FT                   NQLDYCLIRLKAINSHNHELIDQSLVFIGEIQSLFNGDVAGIYSDKGLQSDEFESRPRL
FT                   NLLDKKI"
FT   gene            234210..236726
FT                   /locus_tag="Swol_0192"
FT   CDS_pept        234210..236726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0192"
FT                   /product="Flagellar hook-associated protein-like protein"
FT                   /note="KEGG: mta:Moth_0746 flagellar hook-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67544"
FT                   /db_xref="GOA:Q0B0G0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0G0"
FT                   /protein_id="ABI67544.1"
FT                   /translation="MSNFFGLEIGKRSVLMHQTALNITGHNIANANTPGFARQAPSIVT
FT                   TSPFHAPMLNNANRVGQLGTGVDIAQVKRIRDEFLDSQIRNETRVSGYWQSMQETLDRV
FT                   EAILNEPSEDGLRGVMDMFWEAWQDLSLNPESESVRSVVVQRGMALAEAFNHTYSQLQD
FT                   LRVDVNDQIKIKAHDVNSIAQQIAALNRQIAAVSCAGKQPNDLKDKRDLLVEQLSEIAE
FT                   VRIYNDKNDMVAVQLADRMLVQGVDYIELAEEKDNQGMYMLVWADSRTKARISGGQLGA
FT                   LLDARGQTNLPEENQPSEYKEIIPNMIEDLNMLAKTIMVNTNELHRGGYSLANKKSQVP
FT                   DGSNFFKMPEYADTYENWAKFMAVTREIQDDVKKIAAASRRTWDTEGGNKENFGDGGNA
FT                   LKIAQLKHSLNSPQFKVKTEGLNIDFSSHDPLRLLVDGGAGIKEIEIPPPYSYPDMQRL
FT                   AQALQKELDINDIVANVRCEGGEIVFYSTTNRKLEIIYPGSAISDLKAVDLQNGEYQIK
FT                   TWVGTGEAQNAKLSLLQSYNQKPASSIFGDGRLQQPSDPNLAINASIEITISSVNNFSG
FT                   QVNYTYVSHEYDLDGNYNKVTGSFTLNYGGAAEQSITIGSLTTTISGLDGLSSEKSGVA
FT                   ELKVGDKGILALTAAREVAIPYQQVDINFNFNSDRKVLQSNCFVFNNGVLDPQAPDTVK
FT                   TNELHFFTMNDNRNSNLFGRSYDGYIEITNGILVTAEPAAYLSYYEGDSGNSDMVEDAT
FT                   TDDFWRSITANTGVVSQEAQRMVKNQEILLSELQNKWESISGVSLDEEMTNMIKFQHAF
FT                   NAASRFITGIDEGLEVIINRMGLVGR"
FT   gene            236758..239370
FT                   /locus_tag="Swol_0193"
FT   CDS_pept        236758..239370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0193"
FT                   /product="Flagellin and related hook-associated
FT                   proteins-like protein"
FT                   /note="KEGG: chy:CHY_0972 flagellar hook-associated protein
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67545"
FT                   /db_xref="GOA:Q0B0F9"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0F9"
FT                   /protein_id="ABI67545.1"
FT                   /translation="MMMRVTNKMLVNELNRNLTNNMLRMDKFQRQLSTTRKINTPSDDP
FT                   AGLVKSLRLRTNLIEGEQYLTNINESLGFLDTTDAAFGNINEILHEAREMAVKASTDSN
FT                   VKPDFAAMAKKIREMNEQLKMIANSTYGSKYIFAGSNVTETPYENGNWRGNSEAMETEI
FT                   GVGVKIPFNIDAREFFVGRLDELQVDPASGINAEKVVGKNLQEGNYKVNYSLVSNAARG
FT                   TARESGNMLTADNNTGMFFFYDNAGTPANASIAIGTAAGLTASVYSGFLNIKVTTVDEA
FT                   TDTLTVDISGRIAIEGETGYQDINIAGVSLNMAAANGDAIGSISAAQLQAGGLAGASED
FT                   LVLWNNSGAPLAGITDGAPEFAAGDKSQISLSLESSSVQESQSYLSAVPNAGSFFYEGM
FT                   GTAATLGVGVDNGLTMANNSPYSGSILVEAAEVAPDNTQVAVSLKGGSVKGSASLVLDK
FT                   PLYLESGGTYTAIADGFDLTNYFTYQREDGTTVSGAISSATYNAATREIDFQFNIEDVQ
FT                   GGDIIKWNNDWDAVTGTTVSSSGQSKLYYQQIKGSIPVYEEFKRVDEDGQATAPLEMRF
FT                   DNSVSSWKHNDNYLPQQLTVNIKAHLYTNGSDGKLHHKYVELDNVVIDPETARGQKIFK
FT                   ISAKDINNTNFTEDLVIWNNGAPLGGIDPDSPQLKAGDKTVISFSAQGRAGAQNANIDF
FT                   SYTSAKGEKVNGSSSFRFDVKTFDYETTELKFFTLNEETGLAYSGEIALETGVFAASDP
FT                   AVSFSWRDGLFGYMDDLARKIEAGKVSETSLQIGGDDRRMEELLLYRSTVGARVNRLEL
FT                   QQSRLESIQETFTSLLSKTEDADMAEVIMQLQLQENVYRASLAAGARIIQPSLLDFLR"
FT   gene            239517..240080
FT                   /locus_tag="Swol_0194"
FT   CDS_pept        239517..240080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_0973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67546"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0F8"
FT                   /protein_id="ABI67546.1"
FT                   /translation="MDLRISQQAGLIGLNIDKPGVRLSISPPRLSVNAQVSEINIHSPR
FT                   AELEIDQSQCWTDLGARKPVEYGKECASQAYQQGLEGIARRVAEGESQAAIEKGGSVVN
FT                   LIASRFKAEAECPYTIAFIPEHPPQVTVKAGEMEAEASEGGISTSLQPGRVENHTPWAK
FT                   VGVYLQQKPAIEVKWVGSYFDGVM"
FT   gene            240324..240794
FT                   /locus_tag="Swol_0195"
FT   CDS_pept        240324..240794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK3134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67547"
FT                   /db_xref="GOA:Q0B0F7"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0F7"
FT                   /protein_id="ABI67547.1"
FT                   /translation="MKIVSTLLGELEFEEEDIIMFPAGIPAFEQEKSFLLIAMGEGVPF
FT                   YYLQSALNPELCLVVANPFAFFPRYSIEIGQEELQRLDCSQREELLLYVILTVPQDFRE
FT                   STANLVAPLIINQESKKGLQFIATNSDYTTRHPIFQPTQAEEQTGIAAAEEG"
FT   gene            240798..241028
FT                   /locus_tag="Swol_0196"
FT   CDS_pept        240798..241028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0196"
FT                   /product="carbon storage regulator"
FT                   /note="KEGG: lic:LIC13448 carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67548"
FT                   /db_xref="GOA:Q0B0F6"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0F6"
FT                   /protein_id="ABI67548.1"
FT                   /translation="MLILGRRKGESILIGDDIEITIVDIQGDYIRMGIQAPREVSIVRK
FT                   EIKEQIREENIKAAEKPEGLPALLEEMKKFI"
FT   gene            241052..243733
FT                   /locus_tag="Swol_0197"
FT   CDS_pept        241052..243733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0197"
FT                   /product="Flagellar capping protein-like protein"
FT                   /note="KEGG: tte:TTE0505 Flagellar capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67549"
FT                   /db_xref="GOA:Q0B0F5"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0F5"
FT                   /protein_id="ABI67549.1"
FT                   /translation="MSSLRIGGIASGLDTENIIKEMLKAQRSKIERKVQEKTILEWKRD
FT                   DFRTVNTKLLALRTATFDLKLGDTFNAKKAASSNESILTATAKSTATPGTYDVRVKQVA
FT                   QKATLTSQQSLGSKENVSSVAAQFGIEENTQIDFTLAGKNGEIPFSFTAGATSLADIVR
FT                   IINDEDMGIRAYYDANVDRVFLMSTEFGENAAIKVKMDGMRDSGGNLLVNGEGKALSFL
FT                   GDYLKLNIDMKSLNETAPASGRKITSNSALIIHDPAAITLSQMYEGGTAPASVSFTLKG
FT                   EKDSKDFTFDTAISLQEMINQINNERLTTGLTASYDSSSGKVIFSSGGQVTISGDTDNF
FT                   LRDKLNMTIGSQQGTLSSNTAVRVYDAANIKLNSLYTCEDLQFTLEGGLGSHKFSFNAS
FT                   SISATTVQDMIDSINLWRNTTGITASYDGASGKISLWDSCPLAALEAGSTATNATLDFN
FT                   EALYSSSDGTPSGTLSALANGQDLTASFIYTGSGSLTSATYKSDGSIDFVAAGAADGDT
FT                   IVLNGGGLDNLFDAEGNQYLPVSMTYDGTAGTWKYTSRSNDERMIAIRYDNEGFLADEL
FT                   NINMYEMKGSKAIIDFNDAQNLEFDTNEITLMDSINLNLQAANPSQTVRITVTNDIDGA
FT                   IEKIEAFVEAYNTAIVYMNTELTERRYNARDKYGGSFPPLTAEQRKDMSEDEIKAWEEK
FT                   AKSGMLRGDSILFTAYSSTRCAATDPVQGLASTNTYKSLASIGISTPTFVRGSIEGGKL
FT                   EIDEDKLRAALEADPDKVMELFTLDKVITNEEGKEILDWNGNPLRNRGIAIRLYEAVNE
FT                   NITTITEKAGLPSAKIDNSLLTKEIGRIDDRIKSYEERMQEMSERYWKQFAAMEKMVNY
FT                   YNSMSNWLSQQVAQMAGQNQQQ"
FT   gene            244130..246940
FT                   /locus_tag="Swol_0198"
FT   CDS_pept        244130..246940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0198"
FT                   /product="Flagellin and related hook-associated
FT                   proteins-like protein"
FT                   /note="KEGG: mta:Moth_0760 flagellin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67550"
FT                   /db_xref="GOA:Q0B0F4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0F4"
FT                   /protein_id="ABI67550.1"
FT                   /translation="MIINHNVSALNAYRNLTITDRNMSRSLERLSSGLRINRAADDAAG
FT                   LAISEKMRAQIRGLNQAISNAQDGISLIQTAEGALNETHDILQRMRELSVQAANDTLTA
FT                   SDRQNIQQEIDQLITEIDRIGNTTEFNTKKLLDGSSSALTTTDKLTTRVFMRDGLRVVD
FT                   QFGQKAPGGGNYKLNIEAQAGIAQVQKTDIMRVKHGETTTNIDMGYNQAKVQLAVTTVF
FT                   GADDANDIYEFNFEFEDGVNTSVEVTLTGGTTAGQFSTKLADAVAAHSVLKNRITIQAT
FT                   TGATTGNFDIQSLTKGAAGNFALTVNRTDVNAATGTGRFNIDGTNAIGDGELQTDSVDT
FT                   SITSTSTTLLKGTDVAQSGLQNFQVTGLKQGTYKITTDVSAAATLVSAANLDLVAQYRQ
FT                   SGTGDLVESISATTASAGTTLSTAGSTVNAQMVFDVVGKNGNNITLNITSYQMGLDGKR
FT                   SVHTLEGVVIQTTAADTVNSFTVGDVHFNTFAMATANVTVGDKFLMNVKPVTVVPDDLV
FT                   TITQTTDENGKSVSRSFTYYKAQATNWDNTTTTVDYLTLDDTNGAVSHSEIQLTFGTLA
FT                   DYTANGGTFVQFDRSAGVGELATKGTALRDIEAFWDKSGNFLLESAQKISIIQGDGQKA
FT                   EITLFGTDTIGSVVQKLNDAIANQLGQAQLAGIGATHSDKFVSFVTEGGKQDSGLETVA
FT                   GTFVIRSAITGDAGELTFVGDENVIKALSLTNLKDAKENTFTVNVTDAHTGNYIAKDVN
FT                   IEGNMLVGTVHQNVDVEFDNMTGIKLEWNTATKNFDLKGGFANREDTYVHIADNTMVFQ
FT                   IGANPLQDVGAAIGDMRARALGVNNILVTDRDHATASISKLDAAIQRVSSERSKMGALQ
FT                   NRLDHTINNLGVASENLTAAESRIRDLDFAKEMMSFTRSQIMLQAGTAMLAQANMKPQS
FT                   VLQLLG"
FT   gene            247061..249076
FT                   /locus_tag="Swol_0199"
FT   CDS_pept        247061..249076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_0762 protein of unknown function
FT                   DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67551"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0F3"
FT                   /protein_id="ABI67551.1"
FT                   /translation="MSKKTKNKNKRKSNKNTGDKSSVRLVRVDNTYNNNDIYQNNMQAL
FT                   KEHYPELACTVEKSTSSKRYQLVNMGAKPIPNLLVKDGNYYYYDSNASQQDVANQIKAL
FT                   NLKNARIAMFLGMGLGYELLYYMHEEAVKQNTSYILVIEKDMEIFKLALQSVNLVAAIK
FT                   NPGISFMVGIDESEIYTKLWTYLYENNRFMLLKAIKPVYHPSSLKLNKDYYLQTLKSLR
FT                   DAAAQVLLHFGNDPYDSLLGIEHMLANIDEIVSNPGINLLFNKFKGRPGIVVATGPSLN
FT                   KNKHLLKGLENKALIVAADASLKVLMAMDFKPHLVVSLERNLPVKALMEGFADDEVKDV
FT                   YYAACPVIHPEVFPSYPGPRIIVYRDFDHFKWLGIDKGIVPIKVSAGNMAYKIAEVLGC
FT                   DPIILIGQDLAFSRDGKTHAIGTAGTVDGNQDAIHRQDKFDVMGNDGIPITTNAGWYQC
FT                   IKAYETDLAGYKGTCINSTEGGAYINGTQVLPFKEAIDKYINEDFFPLENIKKHLSAFT
FT                   EEIKEEDIGKLLDLIERTIVNMTEIVNYCKTGLAIYEKYKVKLGDCLRNPQKMDSMRKK
FT                   LNAMENEIFTPQNNCSKNYETYQLFFAHVFQSYAINFQIDTNAVPEKYDDRDFARIEVM
FT                   LRSGEWYAVIGDLASICVNSILQAKTRLESKAAKIL"
FT   gene            249200..249754
FT                   /locus_tag="Swol_0200"
FT   CDS_pept        249200..249754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0200"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: pmt:PMT0101 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67552"
FT                   /db_xref="GOA:Q0B0F2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0F2"
FT                   /protein_id="ABI67552.1"
FT                   /translation="MEYRHFIEGKGIYLREVRPEDVNDNYYHWMNDDDITCYTESRFYP
FT                   YSKEQLHAYVAALDGMADSVFLAIIEKSSERHIGNIKLGTINWIHRRADIGIIIGDKHY
FT                   WGKGYASEAIDLLSEYAFSKLNLHKVWAGCYIDNIASIKAFEKAGFEREGIQKRHVYYA
FT                   GEYVDVVLLGKFCETCDSFGG"
FT   gene            249760..250563
FT                   /locus_tag="Swol_0201"
FT   CDS_pept        249760..250563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcu:pc1566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67553"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0F1"
FT                   /protein_id="ABI67553.1"
FT                   /translation="MNFVIVQARMGSTRLPGKVLKKVCGKHLLELQNERIQMVPGIDRI
FT                   VIATTMAAGDDEIVRLCSKNGIECFRGSENDVLDRYYQAAISLGCKPEDTILRITADCP
FT                   LIDPQVVASVLKLYDKAGVDYASNTDPPTYPDGLDVEVFSFAVLARTWQEAVLPSEREH
FT                   VTPYIRKHPEFFIRVNLENDIDLSNLRWSVDEPEDFQLLRLIYENLYSRKKDFLMNDVL
FT                   ELLNQNPYYKEINRNFARNEGYQKSLLEDARLINTIKAVDNNGKS"
FT   gene            250550..251458
FT                   /locus_tag="Swol_0202"
FT   CDS_pept        250550..251458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0202"
FT                   /product="oxidoreductase"
FT                   /note="KEGG: fnu:FN1688 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67554"
FT                   /db_xref="GOA:Q0B0F0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0F0"
FT                   /protein_id="ABI67554.1"
FT                   /translation="MVKAKLCLGTVQFGLDYGINNKTGKPAEEQVFTMLDLAVAKGIEY
FT                   FDTAAAYGNAEEILGRYFESRNLQKQVKVISKLRPNLITDDNYKAEAIVENEIRKSLAR
FT                   LKLDCLEGYLLHTPTDFYNQSIMNGLFLAKEKGLIRNLGVSIYETEHALDVAKSGIVDY
FT                   IQTPYNVFDQRLDKTGFFSMAKAHGVTVFARSPFLQGLLFMEGDDIPAHLERARVYLHD
FT                   FDEIIAKYSLKRVEAALFLSCLNPGIDYVVFGVDNMGQLTEDIEVFKQNSDIDFSCIGE
FT                   LKKHFINIEKEIIFPSLWARK"
FT   gene            251477..252766
FT                   /locus_tag="Swol_0203"
FT   CDS_pept        251477..252766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0203"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="KEGG: pmt:PMT0103 aminotransferase, class III
FT                   pyridoxal-phosphate dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67555"
FT                   /db_xref="GOA:Q0B0E9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E9"
FT                   /protein_id="ABI67555.1"
FT                   /translation="MSERYHNSELLLERALKSIPLGTQTFSKSKTQYPYGVSPYFIKKG
FT                   KGSHVWDVDDNEYIDFINGLASVTLGYNDHDVNAAVLEQLDNGVTFSLPHPLEFIVAEK
FT                   IIEIVPCAEMVRFGKNGSDATAGAIRLARAYTHRDHVAVCGYHGWQDWYIGSTARNLGV
FT                   PESTRRLTHIFTYNNIESLRLIFKQWPEQLAAVIMEPMNSTEPKNDFLLMVEELTHQNG
FT                   ALFIFDETITGFRYANGGAQEFFGITPDLATFGKGMSNGYPLSAVAGRADIMQLMEEVF
FT                   FSFTFGGEALSLAAANATMTKLQEEPVLETMKNQGLKVIKGVEKLLAENGLQDVISITG
FT                   HPSWAFLNFCDIPSYTLWELKTLFLQEMFSRGILILGTHNMNYCHSDEDIAILLHAYSE
FT                   VLAIIREAIDNKSLDKLLRCKPLVPLFRLR"
FT   gene            253067..254251
FT                   /locus_tag="Swol_0204"
FT   CDS_pept        253067..254251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr0507 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67556"
FT                   /db_xref="GOA:Q0B0E8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E8"
FT                   /protein_id="ABI67556.1"
FT                   /translation="MRIESIRTKNFKILKDTTIRNIPAMAIFLGANGSGKSTFFDIFGF
FT                   LHDCLTDNVRAALLKRGGFKEVVSRGQSGPIEFEIKFRSAPGEPLVTYELHINLDDKGL
FT                   PIVSKELLKYRRGQKGRPWHFLDFSNGVGHAIVNESEYGKPGVQEAREQQTLDSPDILA
FT                   IKGLGQFQKYKQIASFRRLIEGWHVSDFRIESARSTNDAGYAEHLSATGDNLALVTQFM
FT                   HEHYSDRFQQVLEKIAQRVPGIKSVEAKETADGRIVLRFQNEEFKDPFISRYVSDGTLK
FT                   MFAYLILLYDPTPHPLLCIEEPENQLHPDLLLELAEEFRAYASNGGQVFISTHSPDFVN
FT                   AVQLEELFWLCQGNNGFSKVVRASDEPLLQSLVAEGDLPGSLWKQGFFEGAGPL"
FT   gene            254251..254796
FT                   /locus_tag="Swol_0205"
FT   CDS_pept        254251..254796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr0508 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67557"
FT                   /db_xref="InterPro:IPR025455"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E7"
FT                   /protein_id="ABI67557.1"
FT                   /translation="MELYFMLEEPSMKELLKMILPKVLPEGVQYHLIKHEGKQDLEKSL
FT                   PRKLRAITHDARFIVVRDQDSADCYEIKKRLCDICSFSGRTDTVVRIACHEMESWFLGD
FT                   LQAVEKAYNISGLSRRQQQRKYRNPDGLNNAAQELKKLVPGYQKISGARTIGQHMDINR
FT                   NCSASFRVFLEGVYKALG"
FT   gene            254898..255179
FT                   /locus_tag="Swol_0206"
FT   CDS_pept        254898..255179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0206"
FT                   /product="DNA polymerase, beta-like region"
FT                   /note="KEGG: mhu:Mhun_2721 DNA polymerase, beta-like
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67558"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E6"
FT                   /protein_id="ABI67558.1"
FT                   /translation="MRLSTHEINSIKDTIKSVDQDARIYLFGSRVDNKKRGGDIDLLIF
FT                   SHKLKEEERFRIKRDLWEQIGEQKIDIIIVRDESDPFTRIALRGAVLL"
FT   gene            255176..255376
FT                   /locus_tag="Swol_0207"
FT   CDS_pept        255176..255376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67559"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E5"
FT                   /protein_id="ABI67559.1"
FT                   /translation="MKKDEPELFAKELKLLDEAVKILAYSYEACREIGIKESYELEELD
FT                   KFEALTSRFARTSDMLIQRIF"
FT   gene            255678..256892
FT                   /locus_tag="Swol_0208"
FT   CDS_pept        255678..256892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0208"
FT                   /product="Methionyl-tRNA formyltransferase-like protein"
FT                   /note="KEGG: mhu:Mhun_3097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67560"
FT                   /db_xref="GOA:Q0B0E4"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E4"
FT                   /protein_id="ABI67560.1"
FT                   /translation="MEDIDIFLTSLNTALRKIENKYFNVPNHNRHYPVFRERIYCYELY
FT                   HQLRNNLPEGFPFTIHGELDKVVNISIHELLRTKKPDFVVHEPGSNYNLIVMVVKSINN
FT                   TENDIINDCYKLINFKNHANYTQPIMIVFGEKEREKDEELIHNVKSTLIRDGKCGNNFL
FT                   LIWHKSFDKIKYWHINKDVVLENQKDKLNITVVSDLNSWLNIYIPLLLKELEKKNHIIR
FT                   WTNDVKTVLYGDLAFYLGCRQIVPSDILEKNKHNLVVHESDLPWGKGWSPLTWQILEGK
FT                   NDIPIVLFEAAEKVDSGVIYLKETMHFTGTELVEELRATQADTTFKLCLEFIDNYPDII
FT                   DKAVSQEGESSYYRRRTPEDSRLDPDKTIREQFDLLRVVDNKRYPAFFELNGEQYLLKV
FT                   LKKGN"
FT   gene            257041..257829
FT                   /locus_tag="Swol_0209"
FT   CDS_pept        257041..257829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hdu:HD1050 possible ubiquinone/menaquinone
FT                   biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67561"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E3"
FT                   /protein_id="ABI67561.1"
FT                   /translation="MEEILKLKASDTASLEARGEANKKYGIQDFDTWVKRILSRINCSS
FT                   VLDVCCGTGNQLTYYIQMPCTTNILGVDISKDSLKIARQRCEYLLSTNKKLTLKCCKME
FT                   EMFDDKEIDRQYDLISCFYGLYYAEDVDVIVERMIDHLNHKGVFLIVGPYGKNNASLFE
FT                   IIQKHCMIPELVIKSSTTFMQEDLILKLVTLPGISVDTETFVNPILYPSPQAVMDYWQA
FT                   STFYVPQYHSTIQQELEKRFENHDVFVVEKHIMAIIASKL"
FT   gene            257850..258899
FT                   /locus_tag="Swol_0210"
FT   CDS_pept        257850..258899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0210"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="KEGG: mhu:Mhun_3098 N-acylneuraminate-9-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67562"
FT                   /db_xref="GOA:Q0B0E2"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E2"
FT                   /protein_id="ABI67562.1"
FT                   /translation="MNNISLPGIIVGKGYRPFIVAEMSGNHNHSLKRALAILEAAAGAG
FT                   AHAVKLQTYTADTITLDISDGDFFIEDKDSPWKGRSLYDLYNEAYTPWEWHEPIFKRCR
FT                   ELGLMAFSTPFDETAVDFLETLDVPCYKIASFENTDLPLIRKVASTGKPMIISTGMASV
FT                   AEIDETVRVAREAGCKDLILLKCTSSYPASPEDSNLLTIPHMQKLFNCPVGLSDHTIGI
FT                   GAAIASVALGACMIEKHFTLSRADGGVDSAFSMEPEEMRQLVIETERAWQALGKISYGP
FT                   GEQESKSLKFRRSLYISKDMAAGEVLTQENLRIVRPGYGLEPKYYDVFLGKKINQAVKK
FT                   GTLLSWDLI"
FT   gene            258911..259594
FT                   /locus_tag="Swol_0211"
FT   CDS_pept        258911..259594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0211"
FT                   /product="putative LmbE-like protein"
FT                   /note="KEGG: par:Psyc_0661 putative LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67563"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E1"
FT                   /protein_id="ABI67563.1"
FT                   /translation="MNVLIIAAHPDDEVLGCGGTIAKHVENGDEVHVVILAEGVTSRDL
FT                   RRERESRAGELSQLAQAAQEAGRILEVQSVELHDFPDNRMDAVDLLDVVKVVETAIDKY
FT                   KPDMVYTHHAGDVNIDHRIVHQAVVTACRPLPGQCVKTLLFFEVPSSTEWQIPGSAPAF
FT                   LPNYFVDISDCLDKKFQALKAYESEMRPWPHPRSLTAVEHLARWRGSMVGVEAAEGFML
FT                   GRKLS"
FT   gene            259616..260611
FT                   /locus_tag="Swol_0212"
FT   CDS_pept        259616..260611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0212"
FT                   /product="glycosyltransferase"
FT                   /note="KEGG: cac:CAC2186 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67564"
FT                   /db_xref="GOA:Q0B0E0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0E0"
FT                   /protein_id="ABI67564.1"
FT                   /translation="MSEIIAIRVDGNSEIGFGHLMRMKALAREFDKLGAEVIFLSRNPE
FT                   NIEGYRVMQLERRTGDEEDLRVEEMLMEMQAGMFIIDSYEYNQERLDRAGQLALFTVYV
FT                   DDLNLQPFNTDFVVNGNLYAPGLPYRGRARFLLGSKYLLMREEFAGVPLRLPHPDVEHV
FT                   LITFGAADMENVTPGILPVLKSYKHFEDLHWHVVIGPVFRNAAEVEAVVRECTNVTLHY
FT                   NPDIKMLMDFCDISISAAGSTTYELAACGVPALLVVAADNQLRLAQEAERQGMAFNLGW
FT                   YHELDPASLYFALDRLINNQRLREKMAVRGQELIDGRGARRVAGVLLQLA"
FT   gene            complement(260776..261027)
FT                   /locus_tag="Swol_0213"
FT   CDS_pept        complement(260776..261027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67565"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D9"
FT                   /protein_id="ABI67565.1"
FT                   /translation="MSSTIRDLGTIRRMGIEALTEKLGPVGMVEFLRQFDSGYGDYTEE
FT                   RHEWLDSMDIKTIIKQAEMQDNWPAHGDHPRAPGKAGK"
FT   gene            complement(261147..261458)
FT                   /locus_tag="Swol_0214"
FT   CDS_pept        complement(261147..261458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67566"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D8"
FT                   /protein_id="ABI67566.1"
FT                   /translation="MKIYLDVCCLNRPFDDQTQNKIRIESDAILAILSKCISGEWKLIS
FT                   SEVLDIEIKNTPDKWRRNKVYQLYKPAKEKIMLNDKIINRAIEIQSFGIKSFDSLHIA"
FT   gene            complement(261617..262000)
FT                   /locus_tag="Swol_0215"
FT   CDS_pept        complement(261617..262000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67567"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D7"
FT                   /protein_id="ABI67567.1"
FT                   /translation="MGNKECSLFITYPIAQKAISTHYREIAGEDLHKILLANVELFRYL
FT                   NSRYIKDEKLNEEVFNMAKTLYDPLVEKKGEKNGVKKGEKRSKLEVARNALVEGIEPHI
FT                   IVKITGLPMETIQELQAKQENKS"
FT   gene            complement(262062..262487)
FT                   /locus_tag="Swol_0216"
FT   CDS_pept        complement(262062..262487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA1852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67568"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D6"
FT                   /protein_id="ABI67568.1"
FT                   /translation="MSDHDRICAKLEKLQTYYTELKSLSSISLDEYISNSIYRRAVERT
FT                   MQLIVECATDINNMLLKMQSGKGATDYFNSFIDIAEQDIIPIEFALKIAPSTGLRNILV
FT                   HEYEKINDEVVYSSINTCLQYYLEYMDLINQYLKCTK"
FT   gene            complement(262474..262899)
FT                   /locus_tag="Swol_0217"
FT   CDS_pept        complement(262474..262899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0712 predicted nucleotidyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67569"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D5"
FT                   /protein_id="ABI67569.1"
FT                   /translation="MLTKIDTDKLQQVVEKYHLKLLVYYGSYARQEDYDHSRSDIDIAF
FT                   ISEQQLGSQQLFDLMSDLIMLHRKSNIDLVNLQTASGLLKEAVANDGRVLYEKEEGYFQ
FT                   QLCPYLYKCYYETRKFRQIKHALFEKKLAEELKNVRP"
FT   gene            complement(262975..263193)
FT                   /locus_tag="Swol_0218"
FT   CDS_pept        complement(262975..263193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eli:ELI_09120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67570"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D4"
FT                   /protein_id="ABI67570.1"
FT                   /translation="MKDYHINIFYSEKDGGYIADIPDLKGCSAFGVSPEEAAKEIQLAK
FT                   KAWIAAAREADIPIPRPRYKPIIYQNQ"
FT   gene            complement(263190..263447)
FT                   /locus_tag="Swol_0219"
FT   CDS_pept        complement(263190..263447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67571"
FT                   /db_xref="GOA:Q0B0D3"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D3"
FT                   /protein_id="ABI67571.1"
FT                   /translation="MNPKKLIKKILNNNRNIRFSDMLKLVAAYGFELKRINGSHHIFVH
FT                   PDINEIINLQEVDGKVKPYQINQFLTLIEKYNLQMGVEED"
FT   gene            263588..264010
FT                   /locus_tag="Swol_0220"
FT   CDS_pept        263588..264010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0220"
FT                   /product="nucleotidyltransferase substrate-binding protein,
FT                   putative"
FT                   /note="KEGG: cbu:CBU_1021 nucleotidyltransferase
FT                   substrate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67572"
FT                   /db_xref="GOA:Q0B0D2"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D2"
FT                   /protein_id="ABI67572.1"
FT                   /translation="MKLELSSLRNAIRSLEKALLITADKIVQEDVSTDEIDLMKAGVIQ
FT                   NFEFSYELCWKSMKRWIEYNVGAEIVDGVTRKELFRRGLENKLISDIDIWMEFHRARNI
FT                   SSHIYDDKTAEEVYEIATKFLDYAKKLLDSLESRND"
FT   gene            264003..264341
FT                   /locus_tag="Swol_0221"
FT   CDS_pept        264003..264341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hit:NTHI0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67573"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D1"
FT                   /protein_id="ABI67573.1"
FT                   /translation="MINVSESQMQIILRILDRYVPDSQVWAFGSRVKGNFKSYSDLDLV
FT                   VISEDKMSISEFGELIEAFQESDLPFRVDVLDWHAISPEFRQLIKQKYEVLKAKKSPTD
FT                   SLLVAVLS"
FT   gene            264468..265724
FT                   /locus_tag="Swol_0222"
FT   CDS_pept        264468..265724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67574"
FT                   /db_xref="InterPro:IPR022605"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0D0"
FT                   /protein_id="ABI67574.1"
FT                   /translation="MRETVNLTLEAHPDIELGRERRPLEAFLTFPEAGINEDTGIFLLI
FT                   DGLGGRANSQYQSDELRPFVADTFNCVAVGVNYFGIARNEVLNITPEFLYNFNRIYGLN
FT                   LSLESFKLVQGEDDIYRVIAEAVIGRGITSVDVRCQPTLETGRGEYQSWGFLPAIDCLQ
FT                   VVGEVLKTYPLNPGRIMAYGSGYGGYIALLLGKFAPHTFSVIMERGAYCRSELKHIACG
FT                   EVMEEDYIYSFAIRFSDLRFTIAAGSKNPWTIEDELSLAYFSDSHRRIRSLLAEGPRMV
FT                   SPTRYYILHAEDDDIVPVADKDLLVERLRDYAPVYYQRVPGSGGEREVLDDSVVKEENG
FT                   KENGAKELFPLLDLNKASDRDLLQCLSQVEQDESIPEKRDTDFTLNSRYVFDCGEKHYE
FT                   FSFADSYGLQVTLRDKPGI"
FT   gene            265859..266713
FT                   /locus_tag="Swol_0223"
FT   CDS_pept        265859..266713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0223"
FT                   /product="conserved hypothetical regulatory protein"
FT                   /note="KEGG: pto:PTO1106 hypothetical regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67575"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C9"
FT                   /protein_id="ABI67575.1"
FT                   /translation="MATVISMINLKGGVGKTTLTVAMAEFMAAEYGLKVLVVDLDPQTN
FT                   ATVALINELEWRKRNIRGQTLLNIFLDHLSKYQVFSLEEAIVHNVSNVNGGIEGLDLLP
FT                   SSIDLIEVHDEFLQAIPSLPINPLHLLDDVLRAALSAYDIVLIDCPPDLGLICQNGLMI
FT                   SDYYIIPTIPDILSTYGIPQIINRIGRLQRENSISIQPLGLVISKYRQQSEIHKNQANL
FT                   LKIHAPKAGYRQVFNTFIPEGNLAAMVMDYTLHFNSLREKYNYSKYYQIYKALTEEVLS
FT                   CVQ"
FT   gene            266703..267101
FT                   /locus_tag="Swol_0224"
FT   CDS_pept        266703..267101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67576"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C8"
FT                   /protein_id="ABI67576.1"
FT                   /translation="MSNNELGQQMAEFFRALAVEIENSPSLARKLAVPFQNVAAAGGQA
FT                   APKKRTSRSKVFVPEGFDPFQIYYDRGGLGLQQAMEAMDAATLKAILNHFALDPTRSYT
FT                   RWRKEERLMAYIIERVKALSNKGQVFRG"
FT   gene            267238..267474
FT                   /locus_tag="Swol_0225"
FT   CDS_pept        267238..267474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0225"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: mta:Moth_0686 transcriptional regulator, AbrB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67577"
FT                   /db_xref="GOA:Q0B0C7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C7"
FT                   /protein_id="ABI67577.1"
FT                   /translation="MSVARVGKRGTLIIPAEIRKNNGIKEGDELIINVSEAGVIYMIPK
FT                   PKDFVMALKESGQGLWGDIDPVEYIRQERDSWD"
FT   gene            267465..267902
FT                   /locus_tag="Swol_0226"
FT   CDS_pept        267465..267902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0226"
FT                   /product="PilT protein-like protein"
FT                   /note="KEGG: noc:Noc_2205 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67578"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C6"
FT                   /protein_id="ABI67578.1"
FT                   /translation="MGLDYTGQTLMIDSNCFIYLIEGECYPLFLPRVERSFRAVSKGQC
FT                   VALTSPITLTEVMTRPRKMGQEDLAYTYKALITNFPNLNIIPIDNNIADRAAALRGLYG
FT                   LKTPDALQLATGLVNRATRFVTFDREFRKLPPLMNVLIPDE"
FT   gene            268167..269180
FT                   /locus_tag="Swol_0227"
FT   CDS_pept        268167..269180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0227"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="KEGG: mbu:Mbur_1591 polysaccharide biosynthesis
FT                   protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67579"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C5"
FT                   /protein_id="ABI67579.1"
FT                   /translation="MGIKEMIRGKKVLVTGGTGTVGKKLAQRLLELEAAVVRIYSRDEH
FT                   KQFAIQEHFTYQRLDMKRMRFFLGDVRDKERLKRAMEDIDLVFHLAALKHVPACEYNPS
FT                   EAVKTNVIGTQNIIDCAIETAVSAVVYTSTDKAASPTNTMGATKLLSERLISSADHWKG
FT                   PRQIKFLSVRFGNIINSRGSVVPLFEKQIARGGPVTLTDPLMTRFFMSADRAVDLILKS
FT                   LAMSRGGETFVFKMPVLQVGDLARAVIDNSGKDVEMSIIGLRPGEKMYEELMSEEESAR
FT                   ALETDELFVIIPYDHDRREYQECYSGARLAECSTYSSTAAEAMSLEEIKAMLNGKR"
FT   gene            269203..270135
FT                   /locus_tag="Swol_0228"
FT   CDS_pept        269203..270135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0228"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="KEGG: cac:CAC2166 nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67580"
FT                   /db_xref="GOA:Q0B0C4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C4"
FT                   /protein_id="ABI67580.1"
FT                   /translation="MNILVTGGAGFIGRWVVKKLLAEGQRITALDDLSNGRLMNIDEFR
FT                   DNPDFLFIEGDIKDRDTLKQVFAGGFDLVYHLAASINVQDSIDDPRTTYENDVTGTFNV
FT                   LEECRRQNIKMLFMSTCMVYERSLDETGITEEHPVKPASPYAASKLAGEALTLSYYYAY
FT                   GLPTVVVRPFNTYGPFQKSSGEGGVVAIFIQRELAGEELNIYGDGTQTRDLLYVEDCAD
FT                   FVVRAGRDSRANGQLLNAGLGRDVSINGLARMIGGDAGRIRHVAHIHPQSEIPKLLCNY
FT                   DKARELLDWQPRVSLEEGLQRTREWMIVG"
FT   gene            270303..271472
FT                   /locus_tag="Swol_0229"
FT   CDS_pept        270303..271472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0229"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="KEGG: mhu:Mhun_3093 DegT/DnrJ/EryC1/StrS
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67581"
FT                   /db_xref="GOA:Q0B0C3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C3"
FT                   /protein_id="ABI67581.1"
FT                   /translation="MEIDSFIPYGRQNIEQDDIDAVIEVLRSAWITQGPWGEEFEKQVA
FT                   TYCGVSYAVAFNSGTSALHAAIYAAGIGPGDEVITSPVTFLATANAAVYTGARPVFVDM
FT                   DINSYCIDPQLLEAAITPRSRAIVPVDYAGYPVDISVIKEIARRHNLLIIEDAAHALGA
FT                   RRQGRAVGQDADMSILSFHPVKHITTGEGGIVLTDNPELQERLRQFRSHGIVRDASRMM
FT                   ENHGPWYYEMQSLGYNFRLSDIQSALGISQLKKLETFVEERQRIACYYDQAFAGIKQLH
FT                   TPPRPAAGDRHAYHLYPLLLSPGIDRQEVFSYLRERKIGVQVHYIPVHLQPYYRKNYGY
FT                   GPGDFPVAEDFYRREISLPIFPGLKREEQDYVIHHVCSSVVGHRKTEGG"
FT   gene            271776..271982
FT                   /locus_tag="Swol_0230"
FT   CDS_pept        271776..271982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67582"
FT                   /db_xref="InterPro:IPR025906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C2"
FT                   /protein_id="ABI67582.1"
FT                   /translation="METAAIAGMAMGVQAARLQQEVATGVMKMQMDASKEAAQGIIDMM
FT                   KMSSQALEKSVNPHLGTMLDILA"
FT   gene            272100..272468
FT                   /locus_tag="Swol_0231"
FT   CDS_pept        272100..272468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67583"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C1"
FT                   /protein_id="ABI67583.1"
FT                   /translation="MEYMYEVAGQIIELSQTIKEGLIHINEKMDEGQLKETLYLFEDVL
FT                   EAFSSIEIPIQPVLQADNMDELQGATAELKKSLEMLAQAFEANDLEKARAEISQSLIPA
FT                   YSRWQSELEQSLKAYRES"
FT   gene            272635..273141
FT                   /locus_tag="Swol_0232"
FT   CDS_pept        272635..273141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0232"
FT                   /product="Flagellin-specific chaperone FliS-like protein"
FT                   /note="KEGG: tte:TTE0506 Flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67584"
FT                   /db_xref="GOA:Q0B0C0"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0C0"
FT                   /protein_id="ABI67584.1"
FT                   /translation="MSVNAQAYNQYKKSVVETVAPEKLLLMLYDAAIKNINNAKKAIKE
FT                   KDINRAHEQIMRTEEIIVELMSTLNMEYEISGRLFALYEYFYHRLTQANAQKDIVILDE
FT                   VEGFLLELRGTWQEAINALKTAPSQDNKVEVEPVASVTPRIPSEAMGVKPINPATTAKG
FT                   INITG"
FT   gene            273486..273872
FT                   /locus_tag="Swol_0233"
FT   CDS_pept        273486..273872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK3115 flagellar protein FlaG"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67585"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B9"
FT                   /protein_id="ABI67585.1"
FT                   /translation="MRVDGQGMAPNVFPSDTPVNRPVNSAATVVKEPGGEPRERIGRES
FT                   LSAQMEAKKIEEIARNLNEAVKFASCHLEFQPYEDSGRFQVKVVNSLSGEVIKEIPPDY
FT                   LLDFSIKMKEMINQVVGLFVDELA"
FT   gene            273913..274389
FT                   /locus_tag="Swol_0234"
FT   CDS_pept        273913..274389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67586"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B8"
FT                   /protein_id="ABI67586.1"
FT                   /translation="METISPIEKARGLYGDLLLLSKEQLLLARSINADKDISQEMLTLF
FT                   QKRQEIMEGIDLLLLEINQGENRNNTVNSKNSRVEFPLSLGKQQAETHDKVIQEIIAII
FT                   REIQAHDEVGRKIMQKSQREAGKKLASLKRSQAASNAYLHVDSYADGWFFDQKK"
FT   gene            274426..274896
FT                   /locus_tag="Swol_0235"
FT   CDS_pept        274426..274896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B7"
FT                   /protein_id="ABI67587.1"
FT                   /translation="MTREIIREIIENFKQQKQCYSRMSDLASEQLAILEKSQGQVYASE
FT                   IDGLLRQRKEILDEINENNRKNKNLQQKIVKELGIEEFVLGQLEGSLESDHYQALKEQI
FT                   SNLSQLLEMISEKDQQSQELMQQAIKSKRQKKPRGSSQQASQAYKQSKLTRE"
FT   gene            275262..275552
FT                   /locus_tag="Swol_0236"
FT   CDS_pept        275262..275552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: det:DET0416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67588"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B6"
FT                   /protein_id="ABI67588.1"
FT                   /translation="MFQDKTLVCQDCGQEFVFTAGEQEFYSEKGFENEPKRCRECRVNR
FT                   RNSRSNSRGPREMFAAVCAGCGAETEVPFRPVEGRPVYCMECFQKQKEAAY"
FT   gene            275749..276294
FT                   /locus_tag="Swol_0237"
FT   CDS_pept        275749..276294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0237"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /note="KEGG: mta:Moth_0227 sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67589"
FT                   /db_xref="GOA:Q0B0B5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B5"
FT                   /protein_id="ABI67589.1"
FT                   /translation="MKFIIRGRNIEITDALKDYTTKRLSKLEKYIDDVKEAQVALSIEG
FT                   EDHKVEVTIPLNGIILRGEEMSDDMYSSIDMVEEKLEKQIEKYKTRLYRSNRGAGLKKA
FT                   LAEEIKKELDKGEKIEKFKVVRSKRFALKPMDVEEAIMQMNLLGHSFFVFFNPQSEEVN
FT                   VVYKRKDGNYGLIEPDFD"
FT   gene            276385..278877
FT                   /locus_tag="Swol_0238"
FT   CDS_pept        276385..278877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0238"
FT                   /product="protein translocase subunit secA"
FT                   /note="KEGG: dsy:DSY4870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67590"
FT                   /db_xref="GOA:Q0B0B4"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0B4"
FT                   /protein_id="ABI67590.1"
FT                   /translation="MIKSLLKSLLDDDEREVKKLRRTVEVINSLEAEFQELAEEEFPQK
FT                   TGEFKERLKNGEELDDILPEAFALVREASQRVLGMRHFDVQLIGGMVLHQGRIAEMKTG
FT                   EGKTLVATLPAYLNALEGKGVHIVTVNDYLAARDADWMGPVLEYCGLSVGLIVHGLSYE
FT                   ERKAAYACDVTYGTNNEMGFDYLRDNMVVSADNMVQRELHYAIIDEVDSILVDEARTPL
FT                   IISGEGDKPTTLYYQIAKFIPRLRNEEDYKVDEKAHVVTLTEEGVKKVEKYFTIENLSE
FT                   NMELAHHVNQGLKAHSLMKRDRDYVIKDEQVIIVDEFTGRLMFGRRYSDGLHQAIEAKE
FT                   GVKIEKESQTLATITFQNYFRMYHKLGGMTGTAKTEEEEFRKIYGMDVVSIPTHNPMIR
FT                   EDQADMVYRTEEGKFRAVVEDIISRHQAKQPVLVGTISVEKSEYLSAMLAKRGVKHQVL
FT                   NAKYHEKEAQIIAQAGQEETVTIATNMAGRGTDIVLGEGIQELGGLYVLGTERHESRRI
FT                   DNQLRGRSGRQGDPGESRFYVSLEDDLMRLFGSANVEGLMDRLGMDDDMPIEHKMISRA
FT                   IESAQKKVEARNFSIRKNVLEYDDVINQQREVMYGERRKVLFGEDLKETVASMVDDVIE
FT                   QAVERFAGEFKYSDEWDLPGFLSYIEQSIIPQPDFNQEDMRGMRKNEVVAFLAEKTQTL
FT                   YEQREKEMGSEIMRELEKAILLRIIDEKWMDHIDAMDQLRNGISLRAYGQKDPLIEYKF
FT                   EAFEAFQMMIESMKEDVVRYIFRVKVVQQPEERKTFENQGEEAEKKPVRVGKKIGRNDL
FT                   CPCGSGKKYKKCCGRGVS"
FT   gene            278877..279668
FT                   /locus_tag="Swol_0239"
FT   CDS_pept        278877..279668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67591"
FT                   /db_xref="GOA:Q0B0B3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B3"
FT                   /protein_id="ABI67591.1"
FT                   /translation="MDIATFIGLVVGLGGLAGGFLLEGAHLSSLWGHTAFIIVFGGTIG
FT                   ATIVSYTMEELKKVPFFLKVVFSEKKIDYFTVMETLVETADKARREGLLSLESQLGEID
FT                   NEFLSRGLQLVIDGTDPELTRSMLEMEIEAHEKSQKVGVDIFMTAGGFAPTMGIIGTVM
FT                   GLIHVLSNIAEPDKLAGAIAVAFLATLYGVASANVMWIPFGTKIKVKSGREILLMELVL
FT                   EGILSIQAGENPRVIREKLMTFLPADAREKGAEQERARMEM"
FT   gene            279674..280519
FT                   /locus_tag="Swol_0240"
FT   CDS_pept        279674..280519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67592"
FT                   /db_xref="GOA:Q0B0B2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B2"
FT                   /protein_id="ABI67592.1"
FT                   /translation="MAGRRRKKVQEEEQGGMERWLITYADLITLLMVFFVLMYSMSQIN
FT                   AQKFAAVANSLSLVLSGQAMSTLSTQGPSMVEGLSGQMLPEGPGTIPDNQGQLDEVKRM
FT                   IAEFIKAEDLTADEAQKGGSTSTTRLSDNLIVYEQERGLVISFKDTMLFASGSDELTPR
FT                   AREIIQQIGGALLKLPNFIRVEGHTDNRPINTAKFPSNWELSVLRASNVVHVLNENARI
FT                   PAERLSIIGYGENRPLVANDSDEGRAMNRRVDIVILKKKYDYFEPPQSTHQEDMQPGNQ
FT                   "
FT   gene            280650..281654
FT                   /locus_tag="Swol_0241"
FT   CDS_pept        280650..281654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0241"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="KEGG: mta:Moth_0230 peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67593"
FT                   /db_xref="GOA:Q0B0B1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B1"
FT                   /protein_id="ABI67593.1"
FT                   /translation="MQKKTLQENFWSERKEAQEILKQISKLQENLNLYKELMGTAQYLN
FT                   DILEMAEEENDETLWQESVRELLALQKRFREFELLVLFSGPHDYSNAIVSLHAGAGGTE
FT                   AQDWVEILFRMYSRWAENSSYSIEVLDFLDGDEAGIKSVTFLVRGPYAFGKLKCEEGVH
FT                   RLIRISPFDSSGRRHTSFASLSVLPEINEDIEVLINVEDLRVDTYRSSGAGGQHINKTD
FT                   SAVRITHLPSGIVVQCQNERSQHANRLAAMKILQAKLYALKQKEAQDKLQSIKGDYKEI
FT                   AWGSQIRTYTLNPFNLIKDHRTNMEIGNVQAVLDGELDDLIFACLHWKSKIKE"
FT   gene            complement(281665..281874)
FT                   /pseudo
FT                   /locus_tag="Swol_0242"
FT   gene            281965..282792
FT                   /locus_tag="Swol_0243"
FT   CDS_pept        281965..282792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0243"
FT                   /product="transketolase subunit A"
FT                   /EC_number="2.2.1.1"
FT                   /note="KEGG: mta:Moth_0236 transketolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67594"
FT                   /db_xref="GOA:Q0B0B0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0B0"
FT                   /protein_id="ABI67594.1"
FT                   /translation="MRRIGEEELVLTSEKAGIIRREIIKMLGEAGSGHTGGSLSAADLV
FT                   ACLYFWEMKLDPKKPDWEDRDRFVLSKGHAAPVLYAALAEKGFFPREYLKTLRKLGSPL
FT                   QGHPDMRKLAGVEACTGSLGQGISWAVGMALAARIDQRDYRVYALLGDGELEEGMVWEA
FT                   AMAAAHYRLDNLLALVDNNGLQIDGKIAEVMSPEPIADKFVAFGWNTLEIDGHDHRQIM
FT                   EALNSARSFKGSPTAIIAHTTKGKGCSFMENRVEWHGTAPNREEMEKALAELA"
FT   gene            282837..283772
FT                   /locus_tag="Swol_0244"
FT   CDS_pept        282837..283772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0244"
FT                   /product="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /note="KEGG: cpe:CPE0297 transketolase C-terminal section"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67595"
FT                   /db_xref="GOA:Q0B0A9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A9"
FT                   /protein_id="ABI67595.1"
FT                   /translation="MKKQATRDAYGQALLELGALYDNIVVLDADLSKSTKTVEFARAYP
FT                   ERFINAGIAEQNMMGMAAGLASCGKVVFASSFAIFATGRAFEQVRNSIAYAKLNVKICA
FT                   THAGITVGEDGGSHQSVEDIALMRSVPNMTVIVPSDGISTRQALFQLYQHDGPAYLRLG
FT                   RPAVPQVHDPELDFAIGRAVELRKGKDLSLMACGIMVSKALQAAEILAGEGIEVSVVDI
FT                   LSIKPLDKEMIIRKARESGALLTLEEHSIIGGLGSSICEVVCEHCPVPVTCLGINDLFG
FT                   QSGSPEELLQYYGLGIEQIVEKARKLLKKK"
FT   gene            283848..284531
FT                   /locus_tag="Swol_0245"
FT   CDS_pept        283848..284531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0245"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: dsy:DSY4865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67596"
FT                   /db_xref="GOA:Q0B0A8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A8"
FT                   /protein_id="ABI67596.1"
FT                   /translation="MLVQFYNVSKIYSNGVKALDDVSLKIERGEFLFLMGPSGAGKSTL
FT                   IKLFFREEVPTRGQIFIASRSIVRMKRSEVPPLRRNIGIIFQDFKLLENKTASENIAFA
FT                   MEVVGANPKEIRQRVAEVIEMVGLKGRENSFPGELSGGEQQRVGIARALANRPLLLIAD
FT                   EPTGNLDIDISREIMELLFDINRKGTTVIMATHARELVKAARKRVILLDKGRVIADNPN
FT                   GESIV"
FT   gene            284528..285412
FT                   /locus_tag="Swol_0246"
FT   CDS_pept        284528..285412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0246"
FT                   /product="cell division protein FtsX"
FT                   /note="KEGG: mta:Moth_0245 protein of unknown function
FT                   DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67597"
FT                   /db_xref="GOA:Q0B0A7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A7"
FT                   /protein_id="ABI67597.1"
FT                   /translation="MKLRNVLYFWREAWKSLRRNKVLTIASVSTVSICILILGMAVLMT
FT                   VNAGNVIKKLESDVEMVAFLDRALTRSQISQIEEQISKLDGVKSVKFVSRDTALARLEK
FT                   SYGNKEYDLKSTLGKNPLPHSFEVKAKNPHDVPRIASKVEKIEGIYKVNYGQGVVERLF
FT                   AVTKWVRAISLAFIVLLSLGAIFLIATTIRLAIYARRKEIYLMKLVGATDWFIRWPFFI
FT                   EGILLGTLGALLSILLLAGAYSSLVNNMGSVYFIPLVTGGPILNQLYIALLAVGAILGV
FT                   LGTYISLNRFLDV"
FT   sig_peptide     284528..284674
FT                   /locus_tag="Swol_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.951 at
FT                   residue 49"
FT   gene            285508..286647
FT                   /locus_tag="Swol_0247"
FT   CDS_pept        285508..286647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0247"
FT                   /product="peptidase M23B"
FT                   /note="KEGG: mta:Moth_0246 peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67598"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A6"
FT                   /protein_id="ABI67598.1"
FT                   /translation="MSKATKTLAWFLTLFLGLALIFPVSAGELEEQQKKLQDVDQQINR
FT                   QKSNLDQARKKEKTIMGQLQNIEQNIIRTESEIKTLGERISFLEDNIAKTEKDIAEMEA
FT                   KLAEQSDILSERMVFIYEEGDLTYLQVLLAATDINDFLTRYDMLNLIVEQDVELIDSIN
FT                   KQRKALNEKKELLEASRKELLNAQQSQEEKKGILGEEREQKSVVLSSVQKEKKAYQQAL
FT                   EELEKASREIEAMIKKLQSSGSGAQLGSGTYTWPAPSCKKITSPYGMRYHPILKTRKLH
FT                   TGMDIGASQGSTIVAADSGEVIYVGWMSGYGQVTVIDHGNGMSTLYAHQSAFLVKNGAQ
FT                   VSKGQAIGKVGSTGWSTGPHLHFEVRVNGSPVDPAGYVK"
FT   sig_peptide     285508..285588
FT                   /locus_tag="Swol_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            286870..288039
FT                   /locus_tag="Swol_0248"
FT   CDS_pept        286870..288039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0248"
FT                   /product="C-terminal processing peptidase-2. Serine
FT                   peptidase. MEROPS family S41A"
FT                   /note="KEGG: chy:CHY_0170 carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67599"
FT                   /db_xref="GOA:Q0B0A5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A5"
FT                   /protein_id="ABI67599.1"
FT                   /translation="MRKSRLVNSFKTFFALVGMLVVAGLLYVYITNAAGISTLISVLGL
FT                   VKSQALYEVNNSQLIQGATAGIVDSMQDPYSKYLDKQTWKDLRERLEAEFGGIGVYVLQ
FT                   DNEGRLKIVSPIKDTPAYREGVKHGDIILRINNKSALNMSTDDAVHLMRGDPGTQLLLG
FT                   VYRESDKKEYDFRIIREIINVPSVEDKIISEKPRIGYIGLNQFHSRSAEEMKESIDELL
FT                   EEKKVEGLILDLRNNGGGDFDASIAIASIFLDGQEVVSVVDRKGNKTVHKAGHGKLDIP
FT                   LVVMVNGDSASASEILAGALQDNKRALLVGDKTYGKGLVQTVYPLGNGGALKLTTQKYF
FT                   TPDGTDINEIGITPDFPVKNEANSEEDRQLQKALEIVKKQIAGPVSKAS"
FT   sig_peptide     286870..286971
FT                   /locus_tag="Swol_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.593 at
FT                   residue 34"
FT   gene            288084..289301
FT                   /locus_tag="Swol_0249"
FT   CDS_pept        288084..289301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67600"
FT                   /db_xref="GOA:Q0B0A4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A4"
FT                   /protein_id="ABI67600.1"
FT                   /translation="MMGRVFVTTFTSPLFLLIYLFLFMMVAWQYRRMDKLSGRILDNGR
FT                   KSYWKAALLSSFLGLLGGGLGSILLVLLGINLNNIGIAQLWLLAILLMLINPRFLCFAY
FT                   AGGILSLFSLLTGYPEINVPHLMGLIAVLHMVESSLILLDGKFQPSPIYIKKDGTVQGG
FT                   FNLQKFWPIPLVALIGVGMIEPGSGIDMPAWWPLLKDYPTVSPDQTYALLPVLAILGYG
FT                   EITTTTTPAQRIRHSAGKLFAFSLILLLLALGASRWEALGLAAALFGPLGHELVIWLGQ
FT                   REERRKQPLYLQSGSGVMVLDVIPGTVADRAGIKSRDIILLANGQELQSLYALEAEWER
FT                   SQGRVRLEVLREGKRMLCQLEQKSGRELGIIPAPDPYNRRYLLLQEDNIFGLLQKIWEK
FT                   LKRLKG"
FT   gene            289328..290437
FT                   /locus_tag="Swol_0250"
FT   CDS_pept        289328..290437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1766 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67601"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A3"
FT                   /protein_id="ABI67601.1"
FT                   /translation="MLGKQGKVRYVFTSSNTAGGYCSFMPELLAGLQKIFILKGPAGTG
FT                   KSSFLRLLGQSMAEQGYEVEVWLSALNPLNPEGIYLPQMEAAVVNGSLPITIDPGYPAG
FT                   RAEIINLEDYRDRKAAAEKGRDILELVQRVEKHHSKAYNILKSVIQTREELRQLSARHL
FT                   DNSKFNQIFQELEARLAEEEVRERHYFANAVTADGIISYIEELSTPCRKRYIFKGPEGC
FT                   GKSTMIAELARKAAEKGQFLEYYHSGLEPERLLMVIISSSQTALIDIGEMEINLKPCDL
FT                   LVDLGKCLSDYDCSLLGMKNSQVYRNHEAMLLQVQDELENACLAVKKIKKINASFMDYD
FT                   SIDKKRMEIEQELGSELSKCFCNGIESGL"
FT   gene            290439..292436
FT                   /locus_tag="Swol_0251"
FT   CDS_pept        290439..292436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0251"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="KEGG: mta:Moth_0251 excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67602"
FT                   /db_xref="GOA:Q0B0A2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A2"
FT                   /protein_id="ABI67602.1"
FT                   /translation="MPEFKLHSSYKATGDQPQAIKQLLDGVAAGFRDQTLLGVTGSGKT
FT                   FTMARIIEELQRPALVMAPNKTLAGQLYSEFKQFFPDNAVEYFISYYDYYQPEAYVPQT
FT                   DTYIEKDSSINDEIDKLRHSATAGVLERRDVIIVASVSCIYGLGAPEDYYSLAVSLRPG
FT                   MEIARDDLLRRLVDNHYERNDFSFFRGNFRARGDVVEIFPASSNENALRVEFFGDEIDR
FT                   IIEFNPLSGEIIGRRLHSMIFPASHFVTTRERMLEAAGQIEEELAQQLARFKMEGKLLE
FT                   AQRLEQRTRYDLEMIREIGYCKGIENYSRYITGRAPGEPPYTLLDFFPDDFLLFIDESH
FT                   IGVPQIRGMYEGDRSRKQNLVDFGFRLPSALDNRPLKFAEFQEKINQVIYVSATPADYE
FT                   LQHSVQVSEQIIRPTGLLDPEVEVRSSQNQIDDLMAEARAVVEKGYRVLITTLTKRMAE
FT                   DLTDYLADTGLKVRYMHSDIDALQRLEILRELRSGVFDVLVGINLLREGLDLPEVALVA
FT                   ILDADKEGFLRSTRSLVQTIGRAARNVEGKVIMYADEITLSMKSAIDETNRRRLKQLEY
FT                   NREHHITPESIRKAIYAPVEATIAEEAVEYDIRDFQKMAREEREKLLREMEADMYRAAE
FT                   TLEFEKAARLRDSIRELQQPVKKSRRRGKR"
FT   gene            292433..295261
FT                   /locus_tag="Swol_0252"
FT   CDS_pept        292433..295261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0252"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="KEGG: bha:BH3594 excinuclease ABC (subunit A)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67603"
FT                   /db_xref="GOA:Q0B0A1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B0A1"
FT                   /protein_id="ABI67603.1"
FT                   /translation="MKNRIIIKGAREHNLKNIDLEIPRDKLVVFTGVSGSGKSSLAFDT
FT                   IYSEGQRRYVESLSTYARQFLGQMDKPDIDHIEGLSPSISIDQKSTSNNPRSTVGTVTE
FT                   IYDYLRLLFARVGKPHCPHCRQPIKKQTVDQVVDSLLALPAGSRLKLLAPIIKGQKGEH
FT                   KKVLENLFRDGFVRVLVDGFEYTADEEIVLAKNQKHDIAAVVDRLVLKEGIRSRLAESL
FT                   ELAFELGEGIVKARLLQEDGSEEEILFSREFACPECGFSLPELSPRMFSFNSPFGACPE
FT                   CDGLGEKREIDADLLLDMNKSLDQGAVIPWSRNFHTYYNQILAAMAARNNIPVDSPLKE
FT                   LSSKQIKTILYGNDKERFEIVYTNSYGETGSFRSSYEGVFNNLKRRYHETKSEAAREDI
FT                   ERYMSSTLCPACGGKRLRSEILWVLLGEKNINQVTALSVRDALEFFHRLELNERDLFIA
FT                   RQVIKEIRERLTFLVDVGLDYLTLDRAAGSLSGGEAQRIRLATQVGSSLVGVLYVLDEP
FT                   SIGLHPRDNDRLLATLKRLRDLGNTVIVVEHDEDTIRTADYIVDIGPRAGIHGGQVVAA
FT                   GRLEDIMAAEESLTGQYLAGKLEIDIPSQRRVGNGHKLLLKGAAEHNLKEIEVAIPLGQ
FT                   LVLITGVSGSGKSTLVEDIIYPALMKELHGGRHRPGSYQQMKGMENVDKVINIDQSPIG
FT                   RTPRSNPATYTGAFDGIRELFSNTGEARLRGYRPGRFSFNVRGGRCEACSGDGIIKIEM
FT                   HFLPDVYIPCEVCKGKRYNRETLEVKYRGKTIADVLEMTVDEAVELFENIPRVYRKLKV
FT                   LQDVGLGYIQLGQPAPSLSGGEAQRVKLATELSKRSTGKTLYILDEPTTGLHKEDVKHL
FT                   LTVLNRLVDNGNTVLVIEHNLDMIKSADHIIDLGPEGGEKGGYIVAEGTPEELAKHPLS
FT                   YTGKYLQDILDG"
FT   gene            complement(295296..295418)
FT                   /pseudo
FT                   /locus_tag="Swol_0253"
FT   gene            295471..297276
FT                   /locus_tag="Swol_0254"
FT   CDS_pept        295471..297276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0254"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="KEGG: mta:Moth_0256 excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67604"
FT                   /db_xref="GOA:Q0B0A0"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B0A0"
FT                   /protein_id="ABI67604.1"
FT                   /translation="MGDEMLKERLKKVPLQPGVYLFKNQEGQVLYVGKARVLRQRMRSY
FT                   FQAPERMHPKVKAMMAWVSDFDFIVTHSEMEALILENNLIKSYKPRYNIDLRDDKSYPY
FT                   IKVTVADKFPRVYLAREKKDGVSRYFGPYTDVTSLRDTLKLLNGVFGLRSCRTMKSRRR
FT                   PCLNRDMGKCLSPCSGEISEEEYSQKVQALITFLEGDFQEIVREKEKEMAMAARSLEFE
FT                   KAARLRDQIQSLRQLGEKQKIELASPYELDLVGMLSGEKENLVLVFKVRSGKIVGKDTF
FT                   WLKRPIQEDENEAMEFFIKHYYDENPDIPPEILLSHLPSESKLVEAWLKSRVSHRVELR
FT                   VPQRGEKKQVLNMLLENARLLLEEKQREENKQLAALSHLARVLDLEVVPNRLECFDVSH
FT                   LAGEETVASMVVFVGGQPEKKAYRHFKIRTQQNNDTASLAETVRRRLENARQANPAFLP
FT                   EPDLILVDGGLGQVNAVAAVLQEMNLDIPLFALAEKNEEIYRPGKSQPLVLAARDNGLQ
FT                   LLQRLRDEAHRFAIEYNRKRRAKKIRSSALDEIPGIGKQRKKNLLVHFTSVAKIKEASL
FT                   DEIAAVPGMNRKAALAVIEFFHNQD"
FT   gene            297708..298067
FT                   /locus_tag="Swol_0255"
FT   CDS_pept        297708..298067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I3164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67605"
FT                   /db_xref="GOA:Q0B099"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B099"
FT                   /protein_id="ABI67605.1"
FT                   /translation="MQGWVLRWFLNILAIVITAALLENFELTLWGAIVGSIFLGIVNAV
FT                   IRPLLIILTLPLNIVTLGLFTFVINGVMLWITSATVKGFDIHGFGWAIVSALLISIISF
FT                   IISFFIDDRTFRFRN"
FT   gene            298098..298371
FT                   /pseudo
FT                   /locus_tag="Swol_0256"
FT   gene            complement(298777..299697)
FT                   /locus_tag="Swol_0257"
FT   CDS_pept        complement(298777..299697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67606"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B098"
FT                   /protein_id="ABI67606.1"
FT                   /translation="MLVVVPEILDPKVDLVFKKVFGSQENKSILLSFLNAVLNWTGEQK
FT                   IVDVKILNPYLEPESIDDSVGILDIKLQLENDDLVDVEMQIGNLGNMERRSTYYTCRMF
FT                   GDQNISGGRYQDLNRVIAINVLDFTRIKNIERYHTKFRLRETQENIDLTDAIEIHFIEL
FT                   PKLRQEMASYTDPLDRWVVFLKGGWNMELLDRLAKEDPAIGQAKQVLEQMASNPREREL
FT                   YELRRKAILDRNSALYEAKMEGKAEGKAEGQAIILLRLLKKKFGFMPVEMENRVMSMSA
FT                   EKLQELAEAIFDLGTIDELNNFISR"
FT   gene            300546..301352
FT                   /locus_tag="Swol_0258"
FT   CDS_pept        300546..301352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr0833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67607"
FT                   /db_xref="GOA:Q0B097"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B097"
FT                   /protein_id="ABI67607.1"
FT                   /translation="MSIELVAIDLDDTLLDSTWKIPESCLEAISQVQRKGVRVTLATGR
FT                   MFRSALPYAQQLKVDIPLITYQGALVKNSFSQEVLYYEPLPRKLAAEIMIFFKERGIFY
FT                   QSYFNDCFCIERWSPEAQYYAELSGMEPLFYDDLIAVSREQDTPKILASIFDERLMLAI
FT                   EEELNRRYGEELYITRSKPVFLEVMKRSVDKGLALKMLARYFGIPREKVLAFGDSYNDL
FT                   AMIKWAGIGVAMGNAPEVVKEAADYLAPSNEEEGVAHVLHELILDK"
FT   gene            301619..302629
FT                   /locus_tag="Swol_0259"
FT   CDS_pept        301619..302629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0259"
FT                   /product="glucokinase / transcriptional regulator"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: tte:TTE0090 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67608"
FT                   /db_xref="GOA:Q0B096"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B096"
FT                   /protein_id="ABI67608.1"
FT                   /translation="MVVCVDLGGSKVLMAVAMAEGQFLRRLKFPTQSEKGPEDILDRIA
FT                   AGVQEMLKAGAETADRIVGIGVATPGPLSFPDTVVWDSPNLGWNRVNIKEEMKARLGWE
FT                   PLVEKDTNMAVLGEYYFGQMQRCQNLLYITVSTGIGGGIMLGGQLYRGQNGGAGEIGHM
FT                   VVASGGRICGCGRQGCLEAQASGTAIAQMAKELGQEGKGQGMFSGLGTVGAKEVGEAAR
FT                   RGDREARTIVAQVVDYLGIALGNLVNIFNPEKIVLGGAVSLGWEDLLLEPLRERVKAEV
FT                   FPLNARDLQIEVTRLGEDVVLYGCIAEVGRRKTEGGKRKAEDGRSCIRVDSTNFF"
FT   gene            302802..303824
FT                   /locus_tag="Swol_0260"
FT   CDS_pept        302802..303824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0260"
FT                   /product="mannose-6-phosphate isomerase /
FT                   glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /EC_number="5.3.1.9"
FT                   /note="KEGG: mta:Moth_0610 bifunctional
FT                   phosphoglucose/phosphomannose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67609"
FT                   /db_xref="GOA:Q0B095"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="InterPro:IPR035484"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B095"
FT                   /protein_id="ABI67609.1"
FT                   /translation="MTVEKMRDYLYHLPEQFAESLKMEFDFVEDYRSAYENIVVSGLGG
FT                   SAIGGDILRTFALQKASIPVVVNRDYNLPAFVGEKTLFYAVSYSGNTEETLSAYRQARE
FT                   RGAAIVCFSSGGELEKMARLDGKPVVKVPTGLVPRAATGYLFAPLVLLLEKLGIVAGAR
FT                   DELGECVLVLRDIRDSLHPEIEIEKNPAKKIARELKDSIPIIWGSSGISEVAALRWKAQ
FT                   INENAKSPAYYHVFPELNHNEIVGFEVPAELVSRLFVVILKDRFDHERVKRRMAISRDI
FT                   IKQRVKGFVEVESRGESFLARLYSLCYTGDYASFYLALENGINPTPVALIDYLKAELAK
FT                   "
FT   gene            303908..304636
FT                   /pseudo
FT                   /locus_tag="Swol_0261"
FT   gene            304663..305547
FT                   /locus_tag="Swol_0262"
FT   CDS_pept        304663..305547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0262"
FT                   /product="uncharacterised P-loop ATPase protein UPF0042"
FT                   /note="KEGG: mta:Moth_0258 uncharacterised P-loop ATPase
FT                   protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67610"
FT                   /db_xref="GOA:Q0B094"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B094"
FT                   /protein_id="ABI67610.1"
FT                   /translation="MGEKNEELQILIITGLSGAGKTQAINCLEDIGYYCVDNLPPALMF
FT                   KFIELSMQSEGIKKVALVIDVRGGDFFPDLSLVLEELEDSQINYQIIFLEASDEVLVRR
FT                   FKESRRRHPLGSSSRLLEAIQEERRMLQELRGKAHFLIDTSNLSPRELKEKLDLRYSED
FT                   ETLRFSASIVSFGYKLGLPMDSDLVIDVRFLPNPFYDPLMRTMTGKDPMVIDYVLESSV
FT                   TKSFTRRFLNLLKYLIPYYIKEGKTNLAIAIGCTGGQHRSVVLADYTGKQLEKMGYNVI
FT                   VRHRDIAKHKTEE"
FT   gene            305548..306498
FT                   /locus_tag="Swol_0263"
FT   CDS_pept        305548..306498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67611"
FT                   /db_xref="GOA:Q0B093"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B093"
FT                   /protein_id="ABI67611.1"
FT                   /translation="MTVVDKEAKVVVIGGGTGLSVLLKGLKNYTSHLTAVVTVSDDGGS
FT                   SGRLRAEMGVLPPGDIRNCLVALAETETLMDKVFQHRFDHEGSLKGHNLGNLLLVAMTE
FT                   IAGDFVSAIQEVSKVLKVRGRVLPATLEHVALGARMKDGMLIYGETSIRNYGGEIESLF
FT                   LVPEKCLPVPDALEAIMEADIIVLGPGSLYSSIIPNLLVEGIGSALASSKARKVYVSNI
FT                   MTEHGETDSFTAVDHLRVIMRHLPQSVVEYIIVNNGVIDEGILKRYRGEQAVPVLSNRP
FT                   EIEAMGIKLIEADLVSDSDLAWHDSEKLARVIMNL"
FT   gene            306584..307531
FT                   /locus_tag="Swol_0264"
FT   CDS_pept        306584..307531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67612"
FT                   /db_xref="GOA:Q0B092"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B092"
FT                   /protein_id="ABI67612.1"
FT                   /translation="MSFSSDVRNELARIIPEKECCRKAELAALLAISGDLVVGEDGRRI
FT                   LKVQADNAATARKIITLLKENYQIPSTFKALEQKRFKRKRIYEVNVLLDGEDEALNKEL
FT                   EEILLLREKETTPVLNRSLLGRTCCKRAYLRGIFLSRGSINRPEGEYHLELVLNDSRMA
FT                   LAVQKMLDKFALEPGLVERKNYLVVYLKESEKIVDFLRVVEASRALLNFENVRIIKSVR
FT                   NNVNRQVNCETANLSKTIDASLRQIELIKRLLEEQGLEILPGNLRDLAEMRMSYTDASL
FT                   KELGDLLDPPLSKSGVAYRMRKLEESVKEILQED"
FT   gene            307690..309075
FT                   /locus_tag="Swol_0265"
FT   CDS_pept        307690..309075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0265"
FT                   /product="sigma-54 (RpoN)"
FT                   /note="KEGG: mta:Moth_0261 sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67613"
FT                   /db_xref="GOA:Q0B091"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B091"
FT                   /protein_id="ABI67613.1"
FT                   /translation="MKLVQDISIQQQQKLLMTPELRQAIAILQMSTLELNEYIQRELEE
FT                   NPFLEEKEAEENGDYEKEAADNSESKLEDWLEYYNDRDIGFLSREAETEKSFENFFARR
FT                   PSLYEHLEFQLRLSCKNRDELAIGNYLIGSIDRNGYLGIDLKELASHLEVSLEQVEEVL
FT                   EMVHSFHPHGVGARDLPECLLLQLKHYGKESFLARIIIEQHMDDLARGRLNKIAQALTV
FT                   PVHQVQEISDLIRTLDPRPGLQYSNTDEIKYIIPDVFVEKVEGEYIIIVNDFHFPRLMV
FT                   NHLYENILRQPDSFPQDTKKYMEDKMGSAIWLIRSIEQRRMTLYKVARCIVDIQSEFLD
FT                   KGIEYLKPLNLRQVATIVDVHESTVSRATTNKYIQTPQGLFELKYFFGAGLESCYGGEK
FT                   VSSKSIKRKVEEIIAEEDSLKPLSDEAIAKLLKKRGYRISRRTVTKYRQEMGIPATTAR
FT                   KRF"
FT   gene            complement(309234..310193)
FT                   /locus_tag="Swol_0266"
FT   CDS_pept        complement(309234..310193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67614"
FT                   /db_xref="GOA:Q0B090"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B090"
FT                   /protein_id="ABI67614.1"
FT                   /translation="MAGIWIFAEDYEHNLELIQGGKELAQKLAGKIVVILPHNSGNDEK
FT                   AHDCIARGADEVLYLPPLAKDEDFMACIPLIVAEVLQEKPDIFLIGSSLRGKELAARIA
FT                   ARLNTGLCSDCISLELSNDDQSLVMERLIFGGAAVQRVVIPTRPQMATIPPRLFSPAAV
FT                   QEGRTGNIRELPPAPPSRVKILGKKTRTHEAAALTEARILLCVGRGVEKEEDLSLVREL
FT                   ADLLGAEIGCTRPISDEMHWLPEECCIGLSGIQVKPELYIGIGVSGQIQHITGIRDARI
FT                   ICSINNDENAPIFAVSDYAIQGDLYKVLPLMIEGLKKS"
FT   gene            complement(310194..310970)
FT                   /locus_tag="Swol_0267"
FT   CDS_pept        complement(310194..310970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0267"
FT                   /product="Electron transfer flavoprotein beta subunit-like
FT                   protein"
FT                   /note="KEGG: sdy:SDY_0063 FixA"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67615"
FT                   /db_xref="GOA:Q0B089"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B089"
FT                   /protein_id="ABI67615.1"
FT                   /translation="MPRIIACYKWVVDEAYIRTDSSPELDLEYADKKMSDYDRNAIEEA
FT                   MQLYEKYGGSVAAITVGHPDDTKGVKDALSRGPEKAYFINDPSFENLEPAQTAVILADV
FT                   ITAKTEYDLIICGEGSSDLYAQQVGPRLAELLDIPCVTMVSKIDLAGEQLIAERKVDDG
FT                   IETVSLSLPALLTVLPDINSPRIPGLRDTLAASKKPVIEIVKDELSGNFAPCLQVLASF
FT                   KANMERNGQKLSDEAADIMLLLDTLQSKGLIARGVK"
FT   gene            complement(311014..312153)
FT                   /locus_tag="Swol_0268"
FT   CDS_pept        complement(311014..312153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0268"
FT                   /product="butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="KEGG: tte:TTE0545 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67616"
FT                   /db_xref="GOA:Q0B088"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B088"
FT                   /protein_id="ABI67616.1"
FT                   /translation="MDFKLSEEQELIRENIRELVKKYLDPIAVEIDESSRYPAEVIEQL
FT                   AAGGWMGMPYPVEYGGAGLDYVSYAMVIEEISRSCAATGFTVSCHTSLASGPIFNFGNE
FT                   EQKQKYLVPLAKGQHIGAFAVTEPGAGTDVGAATTTATLDGDSYVLNGIKTFTSNGPVA
FT                   DTFVVFAFTDKSLGGKGMSAFIISKDNPGLKVGQHFYKMGIRASQTSEIILKDCRVPRE
FT                   DLLGKEGQGLQIAMSSFDHGRIGIAAQAVGITQAALDESISYSKQRVQFGKPISKNQAI
FT                   QWMIADMATDIAAARFLYSYAAFLKDQKQPFSKEAAMAKVFAAEMSTRHTSKAVQIHGG
FT                   YGYIKGQKVERLMRDAKITEIYEGTSEAQRMVIAGNLLR"
FT   gene            complement(312313..312729)
FT                   /locus_tag="Swol_0269"
FT   CDS_pept        complement(312313..312729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0269"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: gsu:GSU1483 transcriptional regulator, MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67617"
FT                   /db_xref="GOA:Q0B087"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B087"
FT                   /protein_id="ABI67617.1"
FT                   /translation="MELDQCLNFVLTKAQQSVHQLFKAELIPHGVTPGQYSVLKCLWKD
FT                   NGQTVKQLAEHLYLDSSTVTGILDRMEQKGLIKKTADPKDRRALQVLLTEKGQALEEPL
FT                   SQAILNANKKALQEMNDKEYESLKELLHKLSPGN"
FT   gene            complement(312824..313156)
FT                   /locus_tag="Swol_0270"
FT   CDS_pept        complement(312824..313156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67618"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B086"
FT                   /protein_id="ABI67618.1"
FT                   /translation="MKDSDFQNLVIEQLSQINCRLDKLDEGQAKLEAGQSKLEAGQAKL
FT                   EAGQSKLEARQAKLEIQVTKLETQVKKIQKDVNVIKRDLKGVWSDIGRLDKRLTSQEDE
FT                   IDSLKR"
FT   gene            313401..314441
FT                   /locus_tag="Swol_0271"
FT   CDS_pept        313401..314441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0271"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: tte:TTE1763 Transcriptional regulator,
FT                   contains sigma factor-related N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67619"
FT                   /db_xref="GOA:Q0B085"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B085"
FT                   /protein_id="ABI67619.1"
FT                   /translation="MDRLFTIIQRFAPESLEIMETRYRLLRQILHHQPVGRRQLGKELG
FT                   LSERMVRSEMELLRSRGAVYFTAAGIYLTAYGEELLSDIDELIPYIFGIQTLAERIKQM
FT                   FNLTEVIIVPGDSQDDYLAKRDLGRAAARFLKRNLYLGCTVAVTGGSTLAEMVTAFGDG
FT                   INARDVLVVPARGGLGEEMEQQAGVIAARIAGAIGAQYRLLHIPDNLEESTVEILKNDV
FT                   HIKTVVQAIKNSDILLHGIGSAMEMANRRGLASEEIDYLQEKRAIGEALRYYFDKKGKI
FT                   VYEVPGIGLEFPDLQNIGIIAAVAGGKNKADAIKAVLSHQHESVLITDEGAARKIIEEN
FT                   NGKDDG"
FT   gene            314441..315445
FT                   /locus_tag="Swol_0272"
FT   CDS_pept        314441..315445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0272"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: mta:Moth_0262 glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67620"
FT                   /db_xref="GOA:Q0B084"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B084"
FT                   /protein_id="ABI67620.1"
FT                   /translation="MAVKVAINGFGRIGRLVGRIALQREDVEIVAVNGLGDIKTSSHLF
FT                   RYDSVHGEFKGQVAIDGEYLMLNGQKVRYLSEKDPRQLPWKELGAEVVVEASGAFRTRE
FT                   KAAQHLQAGAKKVVITAPGKGVELTMVMGVNHEQYRPEFDVVSNASCTTNCLATVAKVL
FT                   LDEFGINKGLINTVHSYTNDQRVIDLEHDDLRRARAAGLSMIPTTTGAASALGLVLPEL
FT                   EGKLDGLAVRVPTPDVSLLDFTLELEKPATAEAINQAFKAASEGYLKGYLRYEEEPLVS
FT                   IDYRGDEHSAIVDGPLTMVMGDRLAKVIAWYDNEWGYSARVVDMVAYLAAKGL"
FT   gene            315484..316815
FT                   /locus_tag="Swol_0273"
FT   CDS_pept        315484..316815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0273"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="KEGG: tte:TTE1761 3-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67621"
FT                   /db_xref="GOA:Q0B083"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B083"
FT                   /protein_id="ABI67621.1"
FT                   /translation="MLCQRSLCIFMQPLCNKRGFAMESKFDLEVCCLRSLKELELKGQR
FT                   VLMRVDFNVPTDKEGNIIDDTKMRAALPSIEHVLAQGGRLILMSHLGRPNGKIDEKYSL
FT                   KNLASRLGQLLAAPVYMAHDCIGPEVAQAARGLQDGEVLLLENLRFHAEEEKNDPAFSR
FT                   ELASLGDIFVNDAFGTAHRAHSSTAGIADYLPCYAGFLMEKEVEMLEKVLENPQSPRMA
FT                   IMGGAKVADKLGLIGNLLQKMDVILIGGGMANTFLKALGKTIGKSICEDNLLEQARGLV
FT                   EEAEKKNVSLILPLDAVVAPELSAEAPGQIVDIDHVPAELMILDIGPQSIELFKKYIEK
FT                   ASTIVWNGPLGVYEYPNFARGTEEITRAIARSSAVSVIGGGDTAVIVHDMGLEEGITHI
FT                   STGGGATLEFLEGIRLPGVAACQEKAARGIGAELGQGAPLWEKS"
FT   gene            316800..317597
FT                   /locus_tag="Swol_0274"
FT   CDS_pept        316800..317597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0274"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="KEGG: dsy:DSY4840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67622"
FT                   /db_xref="GOA:Q0B082"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B082"
FT                   /protein_id="ABI67622.1"
FT                   /translation="MGKKLKGGDFLRRRLIAANWKMNKSIREAEDFAREFLQLIPDANS
FT                   NERPEIVICPPFTTLSTLKSITEDYGVKLGAQNAFWEEKGAYTGEISPSMLLDAACSYV
FT                   ILGHSERRQIMGESNNIINRKVKAAVEAGIIPLLCVGETLQEREKDRAREVVKEQLVKC
FT                   LKDIKLSGEKLVVAYEPVWAIGTGVNASSDDAQEMIAFIRSCLEKIYSREEADLTRIIY
FT                   GGSVKEENIAEFLGEADVDGALIGGASLQAESLARIVRLSSNA"
FT   gene            317590..319137
FT                   /locus_tag="Swol_0275"
FT   CDS_pept        317590..319137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0275"
FT                   /product="phosphoglycerate mutase"
FT                   /note="KEGG: dsy:DSY4839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67623"
FT                   /db_xref="GOA:Q0B081"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B081"
FT                   /protein_id="ABI67623.1"
FT                   /translation="MPKKPLVLMILDGWGNRAACSDNAISLANPVHFCSLQTKYPSTLL
FT                   ACSGKDVGLPAGQMGNSEVGHLNIGSGRIVFQEISRISNAIEDGSFFSNPVFLASLNSA
FT                   RAKNGTVHLMGLLSDGGVHSHSEHIYALLRLCQIQQVEKVFVHAFLDGRDVGPQTAGKY
FT                   IAELEEKMQRLGVGKMATLGGRFYGMDRDKHWDRIEKAYDAMVLGEGRKAPNAFAALQN
FT                   SYEARLSDEFMEPVVIIDEKGEPLGLIEDGDSIIFFNFRADRARQISRAFTDRELHSCK
FT                   RKVRPEVFFVCLTQYDATIEAPVAFPPQNLENTLGEVLAAAGLKQLRIAETEKYAHVTF
FT                   FFNGGVEAANPGEDRILIPSPAVATYNLQPEMSAPEVSKRVIQEIERDFYDVVIMNYAN
FT                   PDMVGHTGILEAAVKAVKAVDESMIEVVRLVREKGGITLITADHGNCEMMVCPQTGNPF
FT                   TAHTCEKVPFILVSDGHIDCQLRDDAILSDIAPTILELLDLPVPAEMTGKSLLRGEA"
FT   gene            319199..320476
FT                   /locus_tag="Swol_0276"
FT   CDS_pept        319199..320476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0276"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: tte:TTE1759 enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67624"
FT                   /db_xref="GOA:Q0B080"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B080"
FT                   /protein_id="ABI67624.1"
FT                   /translation="MSTIVDVFAREVLDSRGNPTVEVEVFLEDGTMGRAIVPSGASTGA
FT                   HEAVELRDGDSKRYLGKGVLQAVDNVNMIIAPEVIGMDATAQIDIDQLMIDLDNTPNKA
FT                   KLGANAIMGVSLATARAAATHLAIPLYQYIGGVNAREIPVPMMNILNGGKHADNNVDIQ
FT                   EFMIVPSGAPNFAEGLRMGVEVYHSLKKVLNNKGLGSGVGDEGGFAPNLPSNEAALDLI
FT                   LEAIAAAGYQAGSDINLALDVAATELFKDGKYHLASSGQVLSSSEMVDFYAQMLEKYPL
FT                   ISLEDGLAEDDWDGWKQLTERLGSKIQLVGDDLFVTNSQRLARGIEEGVCNSILIKVNQ
FT                   IGTLSETLNTIEMARRAGYTCVISHRSGETEDSTIADIAVATNAGQIKTGAPARSDRVA
FT                   KYNQLLRIEEELDVFAVYRGIKAFKR"
FT   gene            320582..320815
FT                   /locus_tag="Swol_0277"
FT   CDS_pept        320582..320815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0277"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: chy:CHY_0285 preprotein translocase, SecG
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67625"
FT                   /db_xref="GOA:Q0B079"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B079"
FT                   /protein_id="ABI67625.1"
FT                   /translation="MLKTIILILQVICALGLISTILLQSGKSAGLSGSIAGAGETIFGG
FT                   KKKGLDDLLAKITAYVAVLFMILTLTLAIMNQ"
FT   sig_peptide     320582..320674
FT                   /locus_tag="Swol_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.692) with cleavage site probability 0.314 at
FT                   residue 31"
FT   gene            320923..321681
FT                   /locus_tag="Swol_0278"
FT   CDS_pept        320923..321681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0278"
FT                   /product="putative esterase/lipase"
FT                   /note="KEGG: fra:Francci3_3089 putative esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67626"
FT                   /db_xref="GOA:Q0B078"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B078"
FT                   /protein_id="ABI67626.1"
FT                   /translation="MSGTHIHRQAQPFFLKGDSRVALLFIHGFTASPSELYPVAELLHQ
FT                   LCACSISGLLLPGHGSRPEDLNLCRWQDWFAAVKTALLNLQEEYAEVFVVGLSMGGLLA
FT                   LYSGLHVPGVCGVSSINAPVFQRSTLTTALAPLIKIFRPYWPKQEQGRQRQLEAEGRFA
FT                   YDCFPLHAFQSMMELRNQVVRELGDLKVPVLIMQSQNDEVVKSESGRYLAAQLRHREAR
FT                   LVELENSEHVATMGPEKKKIAHELAEFITR"
FT   gene            322106..322657
FT                   /locus_tag="Swol_0279"
FT   CDS_pept        322106..322657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0279"
FT                   /product="HDIG domain protein"
FT                   /note="KEGG: chy:CHY_0288 HDIG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67627"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B077"
FT                   /protein_id="ABI67627.1"
FT                   /translation="MQREEALELLQKHLHNENLFHHSLAVEAIMQGLAESLGEDVEEFA
FT                   LAGLLHDIDYDITVDDLEKHSLLGAQILEENGLPADVVYAVKVHNERHGLERLSLLDRA
FT                   LYAADPVSGFITAAALVRPDKKLAEVQLKSLKKRFKEKAFARGASREQMASCSELGLEL
FT                   DEFLSIALESCKKIAPQLGL"
FT   gene            322884..325001
FT                   /locus_tag="Swol_0280"
FT   CDS_pept        322884..325001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0280"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /note="KEGG: mta:Moth_0273 ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67628"
FT                   /db_xref="GOA:Q0B076"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B076"
FT                   /protein_id="ABI67628.1"
FT                   /translation="MINRDSILDCMHKESYKPLSYHELKAVFGIKDVDEDIKFSKIVGK
FT                   LEKEGEIVKTRAGKFGLPEMMNLVKGIIHISKKGFGVLVPDKAGLGEVFVYGKKLNGAM
FT                   HNDRVMVRIQEKGYNGQRPEGTVIRILARNTRELVGTFTKGRHLLQVVPDDSRQIYPIY
FT                   VKASRKWKAKEGDKVLVRISSWPERDKVAEGKIVEVLGRKGEAGVDLKVLAKKHGLRLE
FT                   FPDNVMEEARNVAVEVNAEEISRRRDLREWRMVTIDGEDAKDLDDAVSIEKTSKGYKLG
FT                   VHIADVSHYVKEDCKLDREAFKRGTSVYLIDKVLPMLPVELSNNICSLNPQVERLAISC
FT                   IMDIDSWGQVVDYEIVKSVIQINERMTYSDVNRILADNPPALKERYGELVEDFFLMKEL
FT                   SDILRRSRLNRGMLDFDFPESKVIVDEEGFPLEVKRAERGPGEMLIEDFMIKANEVVAE
FT                   HLHNLGLPVLYRVHEKPDEEAISELNKVLAVFGHKIKGHKVSPMLFQGILADIKGQPEE
FT                   QMISLMILRSMKHASYLPEPRGHFGLASPYYCHFTSPIRRYPDLIVHRVLSSLLDGGMT
FT                   TRKKSSLEKKMTIYGEQSSLQEMKAEEAERELLDVKKAQYMSQFVGDEFSARISSVQAF
FT                   GFFVALENTVEGLVHISSIADDYYLFSDRTYTLRGRHSGRKFAIGDQVRVQLVRVDVDE
FT                   GKIDFELLQDE"
FT   gene            325269..325742
FT                   /locus_tag="Swol_0281"
FT   CDS_pept        325269..325742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0281"
FT                   /product="SsrA-binding protein"
FT                   /note="KEGG: mta:Moth_0275 SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67629"
FT                   /db_xref="GOA:Q0B075"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B075"
FT                   /protein_id="ABI67629.1"
FT                   /translation="MGKKGKGIKPVVDNRRARYEYHIKENLEAGLVLVGTEVKSLRMGK
FT                   ANLRDAYAVVKDGEIWVNNFHISPYDKGNQFNHDPLRPKKLLLHRREINRLYALQREKG
FT                   LTLIPLKIYFKEGRAKMDLAVAVGKKLYDKREDIASRDAWRDMERSLKERNRA"
FT   gene            325818..326166
FT                   /gene="ssrA"
FT                   /locus_tag="Swol_R0067"
FT   tmRNA           325818..326166
FT                   /gene="ssrA"
FT                   /locus_tag="Swol_R0067"
FT                   /note="prediction based on tmRNA website at Indiana
FT                   University"
FT   gene            326374..326675
FT                   /pseudo
FT                   /locus_tag="Swol_0282"
FT   gene            326999..327454
FT                   /locus_tag="Swol_0283"
FT   CDS_pept        326999..327454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mth:MTH931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67630"
FT                   /db_xref="GOA:Q0B074"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B074"
FT                   /protein_id="ABI67630.1"
FT                   /translation="MNQLEQKAYIFGTIFALSNKLQVIGDKFDKNITIKQWLLLVSISK
FT                   FEEPPTISEVANYVGYSRQNAKRMAAVLQERGFVTIAKDENDARALRIARTPKCIEYFA
FT                   GRDQRELEFLEEIFNGFDAELTAGFYQGLSRIEKNIATMIDNDANDS"
FT   gene            327669..328466
FT                   /locus_tag="Swol_0284"
FT   CDS_pept        327669..328466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A3063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67631"
FT                   /db_xref="GOA:Q0B073"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B073"
FT                   /protein_id="ABI67631.1"
FT                   /translation="MVDSVLTEQPEGDSLGMGVWLVLPMLTALVIILISRFSWKELGLK
FT                   PNFKGNVKWYLASILIFPVVTAIVMLIGATTNWIDLSAFALRPFIVAFGSTMFVNFIID
FT                   IFEETAWRGYLTSQLLKLNLNDWKLYLIVGCVWAAWHIPYYLVFLPEADIQAVMPVSRA
FT                   IYVVVAFTTFLCWTVMFTELFRVTKSVWPCVILHTVEDSLINLLVISGYISIAVGKEIL
FT                   VSPINGIIASILYLAVGLGIRAYRIKAYGMRSDQILISKECSG"
FT   gene            328556..329416
FT                   /locus_tag="Swol_0285"
FT   CDS_pept        328556..329416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mth:MTH932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67632"
FT                   /db_xref="GOA:Q0B072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B072"
FT                   /protein_id="ABI67632.1"
FT                   /translation="MKRGKKNMVWILAVAALIAGILIWFIVPYSPTKAEFAKLTSYQMT
FT                   KTMTQGGIITSEDIAELPLPVQKHFQYCGYIGKSKMSNMNVHFNDVDFVLTPDKPKLKI
FT                   KYTQYNFVAEPERFACINTSLYGIPFEGIDAYQNGAGSMKGVIAKTFTLFDQKGEAMDQ
FT                   ASLVTCLAESLLLPTLALQEYISWEEIDETHAQAVINYYGISASGIFTFDDNGAMTRFT
FT                   TNDREYTDTKGNSQKVKWSAVCGDYEEVDGIKYPSNLKAVWHLETGDLVYFDGRDITVK
FT                   YDVSK"
FT   sig_peptide     328556..328660
FT                   /locus_tag="Swol_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.903) with cleavage site probability 0.564 at
FT                   residue 35"
FT   gene            complement(329577..329867)
FT                   /locus_tag="Swol_0286"
FT   CDS_pept        complement(329577..329867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67633"
FT                   /db_xref="InterPro:IPR031552"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B071"
FT                   /protein_id="ABI67633.1"
FT                   /translation="MTKLVVLPPAARYLKKLKEKPLKEKFQAIVDQILRNPYYGEPKTG
FT                   DLSGVYCCDIFHNKTNYELAYTIVEQDGETVVVILAGTRENFYEELKRYMK"
FT   gene            complement(329867..330241)
FT                   /locus_tag="Swol_0287"
FT   CDS_pept        complement(329867..330241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67634"
FT                   /db_xref="GOA:Q0B070"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B070"
FT                   /protein_id="ABI67634.1"
FT                   /translation="MSQVKTKGENPMIKKRISVSQKRQITIPIEFYNSVGIDKEVECYV
FT                   QNNAIVIRPVRESGGEFDEQILADLISQGLSGQELLDKFKETRRQVRPAVERLLEEARL
FT                   AAEGHASSDNYEDVFGSEAD"
FT   gene            complement(330393..330929)
FT                   /locus_tag="Swol_0288"
FT   CDS_pept        complement(330393..330929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67635"
FT                   /db_xref="GOA:Q0B069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B069"
FT                   /protein_id="ABI67635.1"
FT                   /translation="MLLPDLNFTTINSLKPVEIVITEASRALKEQDRVISSSEIANVLR
FT                   ITLQTITEADISFRAIYAYGTSKSNNPEEYIPSEDAADTFISSHLPYLTANLNDGLLAL
FT                   VGSIFFLVFRRKKIKQKEQILYDEAMTIEKSLRNQLLLEANASQERIDYLKSIHALLTY
FT                   ALKELKRDLTVLKAN"
FT   gene            complement(331151..331585)
FT                   /locus_tag="Swol_0289"
FT   CDS_pept        complement(331151..331585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0289"
FT                   /product="beta-lactamase"
FT                   /note="KEGG: bcz:pE33L466_0098 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67636"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B068"
FT                   /protein_id="ABI67636.1"
FT                   /translation="MPGYAGQYKIVDSDTAWQDVQIPLMSGRDLGTLDISNIDGKEYLS
FT                   NAGSIFISEKDMVNMYAGDNAICTIQENGYARWYTISQNDAGKTMTVNLPENASFAVYD
FT                   EESCVYYSTVNGNQTVKLPENGKVVYIGEAPGDCFTITTK"
FT   gene            complement(331820..333466)
FT                   /locus_tag="Swol_0290"
FT   CDS_pept        complement(331820..333466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67637"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AW49"
FT                   /protein_id="ABI67637.1"
FT                   /translation="MFKPNNDHLQGKVFSDFQRFNSVVAKRLKNSWSMVFYEQVFCLIR
FT                   EELFAPLYSLEWGRPNFPINILVGLEIIKHLFDYTDQELLDQYYFNYQVQYALGIENIG
FT                   EIYLGERTLYNFRERVVRYSKEYPEKEALAFQQFEILTRNFLGLVGLKTDELRIDSTLI
FT                   SPNIKKAGRLSLAHDVLAQAVRAIPVAYRSENLNKVLEDSFKNKLLYQTKNSQLDSRLQ
FT                   AVLDLMSEIYVLSQNHKTIADLEKVKILLRFLNEQANCDENSGRFKAKASKEVSSDSLQ
FT                   SAYDTDATYRDKAGKKESGYTATFTETCNSENDVQIIVDYTVEPNNKSDVEIFQDRMDI
FT                   IKDNTNASDIYADGGYYGENVINKANSKGIEIQLHYTDMTGKTAPEGQLPAHHFVFNKD
FT                   MEMVQCPGGQIPSSSKYNSKTKITTSHFPKEVCNNCPHRCNCPLKEQKRDMVVRISKKS
FT                   ILASQVRETVNDPHIKHENISKRAAIEGTNSAIKGCQGAKRLRVRGKIKCTLQIGFKVI
FT                   GHNFKQIFRALTKQIKKPKIKTKGLLCPNPN"
FT   gene            complement(333590..335149)
FT                   /locus_tag="Swol_0291"
FT   CDS_pept        complement(333590..335149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0291"
FT                   /product="beta-lactamase class C domain (PBPX family)
FT                   containing protein"
FT                   /note="KEGG: cac:CAC2808 beta-lactamase class C domain
FT                   (PBPX family) containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67638"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B066"
FT                   /protein_id="ABI67638.1"
FT                   /translation="MKKLKTPWFYVVVAIFMIFPSIAFGENDIYTDVKKSANELAEVLV
FT                   NDYNVSGVQYALISDGKIVVSGTSGIFHKANVKTLDNKSIFGIGSISKMFPTTAIMLLS
FT                   DQGKLNLDEPVATYLPEFKMADERYKEITVRMLLNHSSGIMGSLYVNSGMYDYPTTLNH
FT                   DNFLKELAQQKLKGDPGEFSVYCNDGFTLAELVVEKVSGMSFSEFIKKNITEPLGMTNT
FT                   KTPQDDFDRNRLARTFKNEEETPIETLNMIGAGGVYSTAEDLCRLGQAYMNDPGYAAAA
FT                   KLLSQEAKTRTMQKEYLRGIGPEQNEGLFGYGLGWDSVDAYPYSQYNIQALIKGGDTGL
FT                   YHGSMIVLPEYNMAFAAVLSGGSSFCGQVMGQTLLLKTLLAENDITKIIPPGDLQAPVL
FT                   SSMPLEQTSYAGIYANNAMVMNVSVGTEGKITISALSHKDIPDEIYLYTSEGVFVNEDG
FT                   SKKLTFVNEANGKTYIQINQIFNLPNLGQTIMTSYEYEKIEPNIIDDVSQKAWDERNGT
FT                   KY"
FT   sig_peptide     complement(335072..335149)
FT                   /locus_tag="Swol_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.953 at
FT                   residue 26"
FT   gene            complement(335469..338333)
FT                   /locus_tag="Swol_0292"
FT   CDS_pept        complement(335469..338333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67639"
FT                   /db_xref="GOA:Q0B065"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B065"
FT                   /protein_id="ABI67639.1"
FT                   /translation="MFNIPSARLTIPRAAVGEIVRKNLIDTVLNSPTKLVYIHAGAGHG
FT                   KTTLLSQFANSTEKVVWLSLDGENDIFTFINTLCEAVKQTFPEFDFSASEYLPFSEKNN
FT                   FISMLAGALICSIENISGDFVAIMDDLHTIEEDEVKKLITYLIKYLPNNAKLCFGSREA
FT                   PWQDFLSFKVKGKITELTQKELAFTREEIVGILGFDDPAIYGSTEGWPLAIRSFQVLLE
FT                   NGISIGDITSYGNETLYAYLFRECIANLNSDMVDFLKKSACFDVLDAQMLDDVLNKKNT
FT                   RLMLESLVSRNIFTIKTGDGFYRYHALFRSGLLETGDKDQMPLLRQKAARYYFDHKQYS
FT                   RAARYAIDSKDDELLENIILACYRDYIKAGNYNELRIWFRALNDAAVELNPRILVAKGA
FT                   FLSVLGNFVQAKACLEAAIPLMNRDDKELYFEAMIHKARVLRNFVSFEESNRLLDELIA
FT                   KLDDPTGELAYSVVIEKLYNLCWNSQIGEAYALARHMIESCAHVGNIKIMRWFERYLCT
FT                   IQFFAGRMKESVYYYEKSLELPEDELNYLGMHSTGIYVAKAYQMLGERSRSLSALSEEL
FT                   QRLRNTGNYEEMWAGYLLAAEIHFQNTFIDKMNGENASYETAVKYFTLADEYAPLYRKT
FT                   NFQMHWAKMQRLTYSLIFTDDPKEDIVREIFENLDRAGAYLKSLVLARLMGYFSAISDY
FT                   PSAVKCANLCIETGESSGMLLHASLAYGVLVRAAIETKDHEKATSLTGRYLKLCSDHGF
FT                   YEYFRLRKAYDPVLEFAYNYGIEPEFTKQMIEFAGYRPKKVYIETLGAFTVYQDRSRQK
FT                   LLKFRSKKERELLAFLLDAGDQGATKEQIYNAIWWESESKNIKNLIAVNLRHIKNDLEC
FT                   TGIMESVIYRENRYFICRDEIACDIDLFEKIYEEFKLHNTKVQAKNLLSLYKGEYLSDF
FT                   EALWATAKRIRYHEIYEEAEKYWL"
FT   gene            338874..342656
FT                   /locus_tag="Swol_0293"
FT   CDS_pept        338874..342656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67640"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR040751"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B064"
FT                   /protein_id="ABI67640.1"
FT                   /translation="MFKTIQKWMTVVLIVSMLFQVFVGVSPVLAEDSSDHIAGPEFVPL
FT                   LAVTLSPGETTGATSATVTGYVYGNLLVNITEQEIARPRVGDTAPTTGDNMIADYESGA
FT                   DITAGVAAGNYLQIYDIDMEEGARIVAFYQAKLSEEDIKEDIGEGAEEEPVESLMMGTE
FT                   LMAEGGYTYIDDNGETKNTGDKAVTKITSDTATLNEGWYIVEGNINRTGAITVSGNVHL
FT                   ILADSSSLTVRGRRDDAGINVPKDNSLIIYAQSKGDEKGSLNATGVAGGAGIGGGAEGS
FT                   SGEITINGGTVTAIARYGGGAGIGGGALGSYIGEITINGGTVTATGGDYAAGIGGGERC
FT                   DGGNVTINNGTVIATGGNGSAGIGGGGHPRLSGGSGGTIIINNYPTVIATGKAGGTDIG
FT                   NGRYSVGKTIIKRGDVKGTDLTYVRLEVQNLSLENENKITFNEQEHIIDSEGITGFFVD
FT                   KSAQSKYISLESAGPLISINPGDVQNSRIILNAHDYAKPVAGFGSALDFPENSQRRINV
FT                   PFEDTKIEGNSDFTISMWIFPRENEPYQTLYRQEGDDTRGSLGLDFRFIKYNDDEGYLY
FT                   FGFNGLNYSWQNAFPWNDEISLTNITKIPMNQWTHVVLTKSGKSVIVYANGTKYYEMTL
FT                   DSMHFYAPAPLAGNISIGGTTTVNQFFSGRMDEIQFWNTALNPDEIVAWMYRGVDSSHN
FT                   KYGNLVYYYKLNQSSGTTVIDSKGSYNGTLVNMTDGSWVVSDVRGWTVYAGSTLEGRLI
FT                   GSYDAGSSNDGTDWNLAFEIVEHAKKGTVTITGDNKFEYCTHDMKQVGHDSFTYSVKGP
FT                   NGRYSNTQTVNIDIIPIPSAGNGNSLGSPSNSQSTNNANGKSETADTVTTTQEGDKTVT
FT                   TVVINDKKVEEKLAREGNNAVVTIPVMSGADVVIGTLNGHTVKNMESKNAVLEIKTGQL
FT                   TYTLPASQINIDAVSGQFGKQVEFKDIAVSVKISKPAADTVKIVEDTADKSNYQIIVKP
FT                   IEFEITCSSGSKTVEVSKFSTYVERMIAIPEGVDPSKITTGVILNSDGTFSHVPTVITM
FT                   IDGKYYAKINSLTNSAYLLIYSPKTFKDVGKHWAEKDVNDMASRLIISGVGNDLFEPER
FT                   NITRAEFSAVMVRALGLRPEEYKNNFFDVKAGEWYSEYISASSYYGLVRGYDDGIFKPD
FT                   GNITRQEAMAILARAMDTTKLGEELEIDASHILAAFNDNADVSGWAKDSASKCVKTGVV
FT                   TGRDNGRIAPLDNITRAETTIMVRRLLLNSGLINK"
FT   sig_peptide     338874..338966
FT                   /locus_tag="Swol_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.994 at
FT                   residue 31"
FT   gene            342725..345229
FT                   /locus_tag="Swol_0294"
FT   CDS_pept        342725..345229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0294"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding proteins-like protein"
FT                   /note="KEGG: bce:BC3187 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67641"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B063"
FT                   /protein_id="ABI67641.1"
FT                   /translation="MKKLPIFLVKLIVLVFFLTCIQLPGVTNPSAYAVTTDMAQGYEAS
FT                   IKAAREAVAKELSTGIPSSATVAIMVDGKIVYAEGFGLRDRAKNLQVETDTQFNIGSIS
FT                   KIFTAASVLILEQEGKLSLDKPVTDYIPNFTMNDTRYKDITIRMLLNHTSGFPGSNFKD
FT                   GFTAVKNRNYVEETLERLKISNLVNDPGKISIYCNDGFTIAEAVIEHVSGMSFPDFLEK
FT                   RIFNKMGLDNTSAYFKDGNQNIARVYEKDSIAPLPVEYVNILGSGGISSTAIDICQYGE
FT                   ILQSETILNPAMIEEYTKVQYGPETVPAGKPIFNAGLGWDYVQVHKFKNQAVDVLAKNG
FT                   GTLQYFSQLYVLPKEHINVAVIFAGNANPTAVANAILQALLEEKGIVKKPSSDTLLPLD
FT                   AKIPDNFKGYEGFYTSDNGIMKVEISSDKNGMTLSTYDGKGFKPAGVLTYKENGRFYRP
FT                   DGINYSFAEHAEGKVMMIHLDSSNAGSVSYEKLNNLSDIDASAFSGKVWVPRNMGQYDF
FT                   FTMMFQTETIPEIPGYLFVNGGATYIPLALKSPTGTRMSFNYLRDQFEVLLQNIEGETL
FT                   LYNYGHYYSDASKLPIIAEGDILQIDSNGQNKAGKMGSGDLVRFSIPEGGRIVVFSPEL
FT                   NLAYDSLMSDSPETYVEKGAYILAVGKSGNTFKITNSERFKDITGHWAKDSINQLASAN
FT                   ILKGTGNNLYQPDKNMTGLDFLILIQRATGITPDNLSASGEETLSFKAEQPITRTQAIS
FT                   VLADVMALTGFEANLTTEEEVSLIKGFSDLEGIDQELKSKAALLIKLGIFQGRSNKLLA
FT                   PGDTMSRGEAAATVLRMLKSIQ"
FT   sig_peptide     342725..342826
FT                   /locus_tag="Swol_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.975 at
FT                   residue 34"
FT   gene            345497..345727
FT                   /pseudo
FT                   /locus_tag="Swol_0295"
FT   gene            346076..346483
FT                   /locus_tag="Swol_0296"
FT   CDS_pept        346076..346483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0296"
FT                   /product="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain-like
FT                   protein"
FT                   /note="KEGG: gka:GK3208 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67642"
FT                   /db_xref="GOA:Q0B062"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B062"
FT                   /protein_id="ABI67642.1"
FT                   /translation="MTALPIRDSNNKLLFIVFIFITSRYYQDREEIIKGKEYIDNHWQE
FT                   EFDIDKLAGIVHMSRYHYTRLFKQHAGMTPYNYYQEVKIGKLKEKLCDTDLSITQVFEE
FT                   CGVDYNGNLAKKFKEKLGMTPSQYRTMMTQK"
FT   gene            complement(346673..346882)
FT                   /pseudo
FT                   /locus_tag="Swol_0297"
FT   gene            347314..351687
FT                   /locus_tag="Swol_0298"
FT   CDS_pept        347314..351687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67643"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B061"
FT                   /protein_id="ABI67643.1"
FT                   /translation="MRKVKRLLALLLIMALTITQLPLTALAEDVAQEEIGIETTENNEA
FT                   STELPLLQSVPEEPGTSLGMKALEKLAGGIISGIAGKTVNESFAAIFGSDTGRIIQALQ
FT                   EIKGKLDNIENQIKALSGKLEEGELKRNLDSFAEFFSDYASPYNQLCGYQTDLADDGEL
FT                   TDLFMQDLYWGKNRNIDTGSKSVIAASNALGNRITMVLTSGYNIFGAFDKLERHQNHWE
FT                   HQGYEKRKEYRNYIITVYAMYNAMGQTACEKVIEAHQGDSLSDSNIRLQAQRDLDELKA
FT                   NAEKVKNMYQRCAVVEHPNLRIYRDTTTGTDLYAFYENFYVAQMTPLDLYYRDRLETTE
FT                   YMQSMIWTKYPVRRPGNGGTELISWQPWRGLFEDIYKAYGGKKTLYDIFFDPQEGNFIN
FT                   NGKHLPKGTRFATDYYVYKRVNSTDFQWRTNVVTDKGKLNETVVLARLDFSYTKSRYDS
FT                   LKISSEQFFSVNRYWGIVNQGALQSNDWPPTSETAGMISGMASSYELPYTGSITLSMEE
FT                   KAGATYQWFVAKGDGKDFEEIAGETGATYTLSVLEPSMNGWMYRCAIIENAGTDEEIST
FT                   LADPETLKLTGEGVPEPMTVHEIGSTNELADALEKVSDGSWNGHELKLTANIDYSLPIT
FT                   LSGCSLMIDLNGHTLTVQPDSTAQPNVDPMSSTPAMAAIYANNFSRLKLTGEGALNVMT
FT                   GEGVAYGVYAGEGSNVQVNSVTSAGGSNAVYAKGGGTVTVDSITVAGDNAYGVGCFDSS
FT                   SIIVNGDVKVTGVFSYGVYIDSESGGLQPVFIGGDIAVTGEKSRGAYLGAEEAILSVAG
FT                   SVIVTGGASGVSAGKGEVAIKGDITAPDYAVNAWHGASVTVQGNVAAKGEEATAVSSSG
FT                   ANVHIQGNVISSGQDGTGIYVSAWELVDPVESAKVTIDGKISADTPLRIEGLLVEESEH
FT                   TETTTKEDYYTFTDGTNTVWAKPGSFQRAVTYTVTFAKNGGDTQASPGAIEVISGGQVG
FT                   TLPTVPARSGYTFTGWNTQADGSGTAFTAATTVTGAITVYAQWSKNSTGGGSSGGDRAT
FT                   SAPVETPKTETNIAGNTATATTTVTAAVDSSGNARAIVSRTQVSDAINKAKEEVRKQGE
FT                   GTAARLEIKVQAPAATTTAETSIPKEAVSQAAEAGIGVLTISTPVASISFDASTLSTLS
FT                   GEATGDVKITASKVEASSLSPEAQRTVGDRPVFDFSITSGGKTISQFGGNVSVSVPYTP
FT                   KVGEDTDAIVIYYIKESGELEVVSNCIYDPATGMISFNTRHFSQYALGYNKVSFKDVAE
FT                   SAWYSKAVGFIAAREITTGTGGGNFSPEVKLTRGQFIAMLMKSYGIAPDLNTKVNFADA
FT                   GNSYYTGYLAAAKRLGISAGVGNNLFMPEKEITRQEMFTLMYKVLKIIGKLPQGNSGKT
FT                   LSDFSDAGDIASWAKVAMSLLVETGTVSGSGGKLSPISTTTRAELTQVLYSLLSK"
FT   sig_peptide     347314..347397
FT                   /locus_tag="Swol_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            complement(352773..353031)
FT                   /pseudo
FT                   /locus_tag="Swol_0299"
FT   gene            353197..354915
FT                   /locus_tag="Swol_0300"
FT   CDS_pept        353197..354915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyb:CYB_0887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B060"
FT                   /protein_id="ABI67644.1"
FT                   /translation="MADYHEWNLAIIAYFLQGLPTGSTVYLNMDEGALSEISTRLSIDG
FT                   NVQKPWEDFYAAIRSQCVRNGNVQLGSIAGFDESGIPHGVAFLAAMVLAAYLMMDEETE
FT                   IGIVSETNYFNRLRTVLGLATDERGRPSGLNPPGTEEILWNNWNEYLLRNRFFPSAEAG
FT                   EGIARKYINYPLSQALLRNADQERLEHLFNKEEKAGRLGRSQDKDRLIIWLKNNLHLIT
FT                   SSHLKKLLCQDDRRRYNALCESVYDVYTQIEWDKEFVNNNFHHGLERQRRLTAGIYRVE
FT                   DPFFGEIDYILYPQQPRRCQVAEIKIIDIEEQKHTLKIERPGWYYPLWSINPVGGLKYT
FT                   VTGDPRFYELIVPDKEFWILIRDPENEDSGVFASWGYPDLGETFLLVCRKEYKEQLELL
FT                   AQEKLMTWDHTVELPGDLEGWVEYRECMVTSDNWDCIIPINADLFETLRPNIRASISLK
FT                   SGLRVSPHLRWLEGYGPELTVIGFTDSVRLQLTVLGNDMHSITDELVETNQTIDLRNLS
FT                   PGNYIARILEGSRVVSMKSFQIIAWQELKSQVIESGMGMNLGACTLEGALIRINE"
FT   gene            354930..356270
FT                   /locus_tag="Swol_0301"
FT   CDS_pept        354930..356270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyb:CYB_0886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67645"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B059"
FT                   /protein_id="ABI67645.1"
FT                   /translation="MHGGVRLYVGIRTVGRPDQVLQKIKHSIQRSGLAKVVPIIKIEKR
FT                   AAREFYLFLAVETSDSGTMPGPITQALKMAGIKGEKIWPLSIDEIKRMTASMDIDIHAF
FT                   NSLRYRSRWQNEALSFEEIEESQIIDSNNSIDDDPELGNRYNQLLYWLSASGTGSWYSF
FT                   AKTCVTLGLVDDARKTRNVFRRLRLLGHMECSQDGLRWQICPSTMVFSPGGDFGFLCGQ
FT                   RTPEFEEQLGRKYPVTYINQPSFEGPSAIRINIKDQACNNDVGIIWAGITSLSLANLLP
FT                   DINGWKQILPIVDRLNIHNYHFEKWEDNMYFPYNDFVQREKRYEGKSGLYRLTQNNAKH
FT                   LYRLNLYFDYEQQRWLKGDWYGLRFLSVHDEGKNIKAYYDSERSHLVIQNDQRWPLVYE
FT                   KALVLASGRLPELEPHKHLQLYREVPAKLSSLLANKLDVSLEVKDYA"
FT   gene            356311..361947
FT                   /locus_tag="Swol_0302"
FT   CDS_pept        356311..361947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0302"
FT                   /product="putative helicase"
FT                   /note="KEGG: cyb:CYB_0885 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67646"
FT                   /db_xref="GOA:Q0B058"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B058"
FT                   /protein_id="ABI67646.1"
FT                   /translation="MYIESAFPLRYEILNQERSSILSQTGFLSQPPLLETLPIYPSSGK
FT                   SLELACRHLPREYRDLPNLAKNLFPEGMELYQHQLAALGEVIMNRRDIVVTTGTGSGKT
FT                   ECFLLPILAELVKDSISWPQCHQPPPNRKWWRKDGTSSGNRVGQFEHSARNKVNTHAVR
FT                   AMILYPLNALVEDQLRRLRVTLDSPGVHQWMDEHRGGNRILFGRYTGLTPVSGWPSNKN
FT                   ALNRLVSRLRELDAELLKVANLDEDIQYYFPNMDGGEMWSRWDMQETPPDILITNYSML
FT                   NIMLMRRIEEQIFDKTRNWLAQDRANKFFLVIDELHSYRGTPGTEVGYILRLLLDRLGL
FT                   NINSEQLVIIATSASITDSLESRKFLREFFGRDRFRIISGSEILPPKGSRYSIKKWADH
FT                   LSVFRRRVEPDIMDPMIPPNPGDPESQKAMEELAIIMGADTSYNTTPDAMLAKALFDNG
FT                   IPEAVRDACHAIHGSVRPTKITELDKILFPNIKHNGVASDAMIGLLLAMALGKNPETGQ
FT                   SIQPVRGHLFFHNLQNLWVCSNPKCSDPSCAETKRFEAMGTQEEVPVGSLHFRHRLTCT
FT                   CGGRVLDLIVCEVCGEVFLGGYRVSRKINSTRFEILTSDQPDLEKMPDQTSVLKTYEKY
FT                   AVFWPIQKGTEVKPEDEQYQVNNIVRRWKAGRLNVFSGVLRQDNKAPDDNEVGGWIYVI
FT                   GGDNPNEPSLPTKCPRCGADYRSKMVSSPLRNHRTGFQKACQVLASALFREMNPFTDNQ
FT                   SFRKLVVFSDSRQDSAKLAAGMEQDHFRDMIRLALLQAISKYWMEFAAFWRTTVKVMPQ
FT                   VAHKIQEINPELYSTVIEPQKTEDEVHRYRFQKSHIQMMSEIMNWSLGMNPTNLDVYNT
FT                   MLKMIKFYPGKVPLFELRGVIREIMLGLGMNPGGNEYRVNTYYVQEGGRGKPHAWHECY
FT                   NWNSSEAQEKAQLVPEARRLLGLMDNCLAEEVMHVLFPHVARTFEGLGQGWVTYEETTN
FT                   ATDLIIQATNSAIRLLGGRKTHRYQRGYKAGSETKLPRYVSNYLSVIGVSAAEVETEMV
FT                   HSKAGMGGLSSLGLDPDYLYLNLSHFDHEETRPQGWRCVTCNAFYLQPAGGFCPECASQ
FT                   RQSHRLVPSNPQSHLDYYLYLASQSGPAFRMHCEELTGQTDYIDRIRRQRWFQDVFVED
FT                   EIPLVHGVDLLSVTTTMEAGVDIGPLLAVMMANMPPRRFNYQQRVGRAGRRGSGLSIAL
FT                   TFCRGRSHDDYYYERPEQVTGDPPPLPYVDMNNEKIIRRVLIKEVLRMAFRSLPDDIFP
FT                   PDPRDSVHGEFGSVEDWPGVSGEIQNWIHNPENEGKIVDIFRALTQGTLWDSSTKNHEM
FT                   FLTQNIVSLRKELVNAVSEVTQSPYYTQEFLSERLANAGYLPMFGFPSRIRNMYTRWPS
FT                   NANPWPPSSGLIDRDLEVAISQFAPGSQLVKDKAVHTACGVVDLYPKGNQVASKPGFIP
FT                   DLIEGNPSPVGICGHCQAVMYLPGTAITALGGRTPEVIQCPVCSAVEMRRLDAREPKGF
FT                   FSDLTPGDFEGVFEWVPNSTRPFLAIKADNPHPIHVNNVCISSFADEIISINDDGGKGG
FT                   FDFQQAKVHNRSIPGAYAVSPASDLFIKVNGPAWRIALLAKRYTDVLLVDLNHWPEGIF
FT                   ADPTTVEGRAAWYSFAFTLRMAAAVELDIDTTELDAGFQVKNREGFPVGLAFLCDKLEN
FT                   GAGYSRWLGSETSFHKLLRQGFLTEPSSMATHWMEHKHKSACDTSCNLCLRDFYNSMYH
FT                   GLLDWKLGLDMLHLASDQNTSIDLTSSWGNYDNPWTSLVNGDTSKIAVTMQNLGYQPPT
FT                   NIEGLNVYIHRSRPQVWVERHPLWTDSHSVYQTVYYEISSKYRQHTIKPMNPFMAIRRP
FT                   ADFV"
FT   gene            complement(362039..362232)
FT                   /pseudo
FT                   /locus_tag="Swol_0303"
FT   gene            362840..364171
FT                   /locus_tag="Swol_0304"
FT   CDS_pept        362840..364171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0304"
FT                   /product="RNA-directed DNA polymerase (reverse
FT                   transcriptase)"
FT                   /note="KEGG: mta:Moth_2231 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67647"
FT                   /db_xref="GOA:Q0AW97"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AW97"
FT                   /protein_id="ABI67647.1"
FT                   /translation="METGLVRIAEIARQNPKERFTALIHHINHETLKECHLEISGSKAS
FT                   GVDQVTKQAYEENLEANIADLIGRMKRQAYKPQPVRRVYIPKEGSNKRRPLGIPSYEDK
FT                   LVQKGLARILNTIYEQDFLDCSFGFRPGRGCHDALKVLNHIIERKKVNYIVDADIRGFF
FT                   DHVDHEWMMKFLELRIADPNLLRLIKRFLKAGVMEAGIVYDTPKGTPQGGIVSPILANI
FT                   YLHYVLDLWFEKVVKKRCQGEAYLVRYADDFVCCFQNKSDAEWFYANLRERLNKFNLEV
FT                   AEEKTRIIAFGRFADKESKKQGRKKPDTFDLLGFTHYCSKSKKGWFRVKRKTSQKKYRS
FT                   SLLKCKTWLRKHLISPTDYVIEMLQIKLQGYYRYYGITDNSTALRNFCDKVRRMLFKWF
FT                   NRRSQRKSMNWDKYVRFLNKHPLPKGRIYVDIYDVRPELLSYLK"
FT   gene            complement(364833..366410)
FT                   /locus_tag="Swol_0305"
FT   CDS_pept        complement(364833..366410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0305"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="KEGG: mta:Moth_1187 RNA-metabolising
FT                   metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67648"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B056"
FT                   /protein_id="ABI67648.1"
FT                   /translation="MKLKFLGAAKTVTGSFFLVETGDFRFAVDCGLFQGSKSLQQRNYQ
FT                   DFPVDPASINFVILTHAHIDHSGLIPKLCKKGFTGPIYCSQITEQLCQVLLPDSGYIQE
FT                   SEVERKNRKLKRSGLKLLEPIYTAKDALNCLPQFRPLNTDEIIKINCHISIRLRTAGHI
FT                   LGATIVEVWVEEDGKKSKLVFSGDLGNINQPLVKDPSIIESADFLVIESTYGNRLHDYS
FT                   MDRAEQLLQVINETMAKGGNLIIPAFAVERTQDLIYDLIMLGYEKKLDPNMQIYIDSPL
FT                   AIAATEIFVKNRDSYEDTTRAFMTKGDPWQYINLNLTRTREESMQLNDSVSKSIIISAS
FT                   GMCEAGRIKHHLKHNLWRPESTILFVGYQAAGSLGRRILEGEQIVTIHGEKVAVKADIR
FT                   RIVAYSAHADKDGLIDWLMSFVVKPRDIFIVHGEEEAQLALAEVIQQKLNVPIFIPDWL
FT                   QEFELIAREEEVRPSYVHSSMELSEAVKAEQMYLQVSLKLNDMFRENWTRGNYTKIIEA
FT                   MQNISTIV"
FT   gene            366580..368328
FT                   /locus_tag="Swol_0306"
FT   CDS_pept        366580..368328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67649"
FT                   /db_xref="GOA:Q0B055"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B055"
FT                   /protein_id="ABI67649.1"
FT                   /translation="MSKSVDSFNLYKVSEAMLDNPFMACVVVDEHGIIRFINQAYLEWL
FT                   HKDRNEVMEKHILEVTPHSKLPEVLRSGKSDPLDLWTVNDRETIITRYPLIKDEQTIGA
FT                   VGQTIFLDKAGAKILMKKLQTMEKEYETVSEVLVQSPYLIYVIVDKAGSITFMNQTYLH
FT                   LLGMKKEDVVGKHILDITPHSKLPEVLRTGDIHEIDTWTVNGRDTIITRTPIIKDGEIT
FT                   GAVGRSLFLDMSQAKMLINKLQETAKELNYYREEFRQLYQARWQFDDLIGVNPEFTMVK
FT                   SMAQQLAHTRSTILITGESGTGKELFAQSIHNQGGQEGPFVRVNCAALPENLLESELFG
FT                   YEEGAFTGAKKGGKPGKFELAKGGTIFLDEIGDMPIGMQTKLLSVLQERVIERVGGTNP
FT                   ISIKVRVIAASNRDLEKMVAKQEFREDLYYRLNVVRLHIPPLRERMEDIPLLVNYLMAG
FT                   INTHLNANVMHISNEALHMLQNYNWPGNVRELQNLLERAINLASLKQAACLEVQHFPSL
FT                   TGEALPPAVSENGRTTLNDSVQRLEKELIEQTLKSTNYNKSQTAKELGINKSVLYSKMR
FT                   KYGLFD"
FT   gene            369029..369877
FT                   /locus_tag="Swol_0307"
FT   CDS_pept        369029..369877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0307"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="KEGG: ctc:CTC02423 3-hydroxybutyryl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67650"
FT                   /db_xref="GOA:Q0B054"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B054"
FT                   /protein_id="ABI67650.1"
FT                   /translation="MAINKIGMLGAGTMGQGIAWALASAGKKVVLYDIKKEFADRAISS
FT                   IGKSLAKAEEKGKAAPGTKDTVVGNIFGTDKFEDLKDVDFIVEGVFENMDVKKDVYTKL
FT                   DALLAPEVIIATNTSSLSITEIAAITKRPDKVVGMHFFNPANVMKLVEVIPALQTSEET
FT                   VQTVVDLSIEIGKKPVKVKEGPGFVVNRILVPAINEGCAILYEGLATAEDIDTAMKFGA
FT                   GWPMGPLTLCDLVGADISLAVMNTLYNETGDPKYRPSGLLKQYVRAGWLGMKTKKGFYN
FT                   Y"
FT   sig_peptide     369029..369094
FT                   /locus_tag="Swol_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.932) with cleavage site probability 0.880 at
FT                   residue 22"
FT   gene            369952..371160
FT                   /locus_tag="Swol_0308"
FT   CDS_pept        369952..371160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0308"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: gme:Gmet_2213 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67651"
FT                   /db_xref="GOA:Q0B053"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B053"
FT                   /protein_id="ABI67651.1"
FT                   /translation="MGLNEVVMVSACRTPIGKFLGQFKDVPAKDLAVTAGKEAIKRAGI
FT                   PADIIDEIVMGQVYQGLQKSLPARIVGLACGLPERSNACVVNQNCTSSMRALEIASRNI
FT                   MLGVTDIALVVGVENMTQAPYMVPSARTGARMGDAKQIDSLTHDALVDSLVPGHMGMTA
FT                   ENVAVMYNITREQCDELAVRSHTNAINATDNGIFKREIVPVEVKTKKGITIIETDEHPI
FT                   RGSSMESVGRLKPAFKKDGGVVTAANASGINDGASAAVIMSKQKAAELGITPLMKLVAS
FT                   VGVGVDPQIMGIGPAEAIPVALEKAGWKFDDVDYWELHEAFAPQFIGCKIRLKEKYGMD
FT                   LSMDKVNHNGSGIALGHPIGSSGLRIVVSLYYELERLGLTKGGASTCVGTGPAMASLWT
FT                   RDI"
FT   gene            371259..372602
FT                   /locus_tag="Swol_0309"
FT   CDS_pept        371259..372602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0309"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="KEGG: rfr:Rfer_2267 acetyl-CoA
FT                   hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67652"
FT                   /db_xref="GOA:Q0B052"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B052"
FT                   /protein_id="ABI67652.1"
FT                   /translation="MDYSMEYKRKLLPVEEAMKVIKSGDLVQYGEFVMNSSYLDAALAQ
FT                   RVDELENVNIRTTTCPFPPKTVLADPERKHFIYNDYHMSAASRKLHDKDLCNYVPLTYH
FT                   EGPSFYERDYVAADVALIKVAPMDKHGFFNLGTSLSLTPLFCDTARTVIVEVNENVPIC
FT                   LGGCRESIHISEVDYIVEGDNQPMIQLPELPISDTDKKIAAIVLEEIEDGACLQLGIGA
FT                   MPNAVGAMIAQSDLKDLGVHTEMLVDSFVDMYEAGRITGRRKQLDKCKMVYTFAMGTNK
FT                   LYNFLDGNPACAIYPVDYTNDPFIIGRNDKVFGINNAIEIDLYGQVASESSGTRHISGT
FT                   GGQLDFIIGSYYSKGGKGLICLTSTFTDKEGNLQSRIRPTLTPGAVVTVPRSINFYVVT
FT                   EYGIAMLKAKSTWQRAEALINLAHPDLRDELIKEAEKMRIWVRSNKIV"
FT   gene            complement(372774..374420)
FT                   /locus_tag="Swol_0310"
FT   CDS_pept        complement(372774..374420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67653"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AW49"
FT                   /protein_id="ABI67653.1"
FT                   /translation="MFKPNNDHLQGKVFSDFQRFNSVVAKRLKNSWSMVFYEQVFCLIR
FT                   EELFAPLYSLEWGRPNFPINILVGLEIIKHLFDYTDQELLDQYYFNYQVQYALGIENIG
FT                   EIYLGERTLYNFRERVVRYSKEYPEKEALAFQQFEILTRNFLGLVGLKTDELRIDSTLI
FT                   SPNIKKAGRLSLAHDVLAQAVRAIPVAYRSENLNKVLEDSFKNKLLYQTKNSQLDSRLQ
FT                   AVLDLMSEIYVLSQNHKTIADLEKVKILLRFLNEQANCDENSGRFKAKASKEVSSDSLQ
FT                   SAYDTDATYRDKAGKKESGYTATFTETCNSENDVQIIVDYTVEPNNKSDVEIFQDRMDI
FT                   IKDNTNASDIYADGGYYGENVINKANSKGIEIQLHYTDMTGKTAPEGQLPAHHFVFNKD
FT                   MEMVQCPGGQIPSSSKYNSKTKITTSHFPKEVCNNCPHRCNCPLKEQKRDMVVRISKKS
FT                   ILASQVRETVNDPHIKHENISKRAAIEGTNSAIKGCQGAKRLRVRGKIKCTLQIGFKVI
FT                   GHNFKQIFRALTKQIKKPKIKTKGLLCPNPN"
FT   gene            375120..376739
FT                   /locus_tag="Swol_0311"
FT   CDS_pept        375120..376739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0311"
FT                   /product="Na+/H+-dicarboxylate symporters-like protein"
FT                   /note="KEGG: fnu:FN0604 proton/sodium-aspartate symport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67654"
FT                   /db_xref="GOA:Q0B050"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B050"
FT                   /protein_id="ABI67654.1"
FT                   /translation="MKGKKDFRLEIASIESASDYVRDLLKQYKCTERDMVRAQLFTEET
FT                   IVYWTEIADEGDIFQINVRKRFKTISLSLSYRGAQSNPLAISDEEEDEAEFSFIGQNIL
FT                   IGLSTVTYNYENGYNVITFTIKEKGINPVIFIIFALAAAIICGLIVNRFAPSLGPGLSA
FT                   SILTPLSKAFFGLLNAIVIPFLFLSVIASIFNMENIAQMKRIFRILFSWFLGLTAISAV
FT                   IAVLAGIIYFPLQSGASAGVNEVNIWAQIAKMLFDIIPANIFQSFLDGNTLQTIFLAVI
FT                   TGITMLVYKGRFPVISKVVSESNLIFSTLLDAICSLMPWVIFICIFDMLLSGDGRVLLS
FT                   SIAVVVLICICFLLIILLCLLSVAFIEKQNPIQYIKTIGPVLLIALSTASSSATFAPHS
FT                   MIASNKQGIRDYLANFSIPVGALFAKPFVVPVLLLMTLFVGNFYSVTFTMADVVSMVLL
FT                   CIILSVAVPPIQGMGIFLFTIIFKRFTIPLEGLAMAASLFMLFDYLMTTGNVFSVNISM
FT                   LHTEHRLREKEKRVIVHNNQKC"
FT   gene            377205..377795
FT                   /locus_tag="Swol_0312"
FT   CDS_pept        377205..377795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsa:LSA0709 signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67655"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B049"
FT                   /protein_id="ABI67655.1"
FT                   /translation="MAYWLLCQSCKEWSKFTTPLSNDKVCPLCSNSFITVKSHLSSIPY
FT                   EKTIEKAQDLLENLPTVENEPASSVKEKESLEALRETDKTEMPKTADIPKTAGMPEIAE
FT                   MPKIEEIPDTSATPDEPETEDKADLQENSEITGQPEITEISETPEDSAIQETSLEEDQT
FT                   NEISEPQETEKVLTGNEKQNILRQKKKRSKFYR"
FT   gene            complement(377841..379208)
FT                   /locus_tag="Swol_0313"
FT   CDS_pept        complement(377841..379208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67656"
FT                   /db_xref="GOA:Q0B048"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B048"
FT                   /protein_id="ABI67656.1"
FT                   /translation="MDRSARMRKQRIGKLLWDFSLPTIVGMLVSSLYNVIARIFVGRGI
FT                   GSLAIAATTVAFPIMILLMAVSLLIGVGATSLISLKLGEQKKDEAEKVAGNAMTMLIIL
FT                   PAALAVLFLLFTEPILIAFGASAAVLPYARDFTRIIMLGSVFGSISMGMNNFIRAEGNP
FT                   AMAMSTQILGAVVSVALNYVFIFIFHWGIKGAALATILAQLISAIWVLSYFFTGRSLVK
FT                   IHWKNLKPAWPVLSGIMAIGFAPFAMQTAACIQQLILNQTLMFYGGDLALAAIGIVMSI
FT                   SMLLVMPVLGLGQGAQPIIGYNYGACQYQRVKETWKTAVLAGTGIAVAGYMALHIWPLQ
FT                   LVGLFSKGDTALTTMTVHAMLTFFALLPVVGFQVVSSMYFQAVGKARQAAILSLSRQFL
FT                   IFIPLLLILPRFWGIDGVWRTAPIADGLSVALTAGFIYFEMKKMRQEETRQPSEDK"
FT   gene            complement(379338..380105)
FT                   /locus_tag="Swol_0314"
FT   CDS_pept        complement(379338..380105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67657"
FT                   /db_xref="GOA:Q0B047"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B047"
FT                   /protein_id="ABI67657.1"
FT                   /translation="MYILQAINIHKNFGSLGVLHGVSLQVQKGEVIAIIGPSGSGKSTL
FT                   LRCLNHLERIDSGQIEIEGETIAQNNSEGKAVYSSEAKIAQARRKMGMVFQNFNLFPHK
FT                   SVMQNLIMAPTLVKNMGKAEAEESARLLLAKVGLSQKADNYPFELSGGQQQRVAIARAL
FT                   AMNPDIMCFDEPTSALDPELTGEVLMVMKDLALEDMTMVVVTHEIGFAREVADRVIFMD
FT                   EGVIMEEGQAEEVLLNPRQERTSAFLSKVLMAR"
FT   gene            complement(380144..380785)
FT                   /locus_tag="Swol_0315"
FT   CDS_pept        complement(380144..380785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0315"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="KEGG: bbr:BB2796 putative ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67658"
FT                   /db_xref="GOA:Q0B046"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B046"
FT                   /protein_id="ABI67658.1"
FT                   /translation="MDYIIMLLPSMLKGLTVTLKLFSITLVMALPLGVIMGMARISSFS
FT                   PLRWFMEFYVWLFRGTPLLLQLLFMYFGLMTLGLRLEREMAAYLAFVLNYSAYLAEIFR
FT                   AGIQSIDRGQYEAADVLGLSRYQTMTNIILPQVFKRVLPPIGNEVINLVKDTALVYVLA
FT                   ISELSRVARTHVMRDDTFIPFLIAAIFYLMMTGMVQRFFKWVELRYDYFH"
FT   gene            complement(380887..381654)
FT                   /locus_tag="Swol_0316"
FT   CDS_pept        complement(380887..381654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0316"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="KEGG: rfr:Rfer_2969 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67659"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B045"
FT                   /protein_id="ABI67659.1"
FT                   /translation="MSGCAAKTPAPETSSDESWTKIKDKGYFVMGLDDAFPPMGFRDEA
FT                   NEIVGFDVDLAKEVAQRLGVEVQFQSIVWDTKKEELNSGNIDVIWNGFTITEERKQDFL
FT                   FSKPYISDRQIIVVRADSDIASKADLAGKKIGIQAASSANEAVEADKETFEVIKDNLLQ
FT                   FESNDLALRDLKGGGVEAVVVDEVVGRYYLSKHPGDYKVLKDNFDLEDFGVGFRLDDKA
FT                   FHAEVEKALDEMKADGTAAKISEKWFGEDIINK"
FT   gene            382025..384487
FT                   /locus_tag="Swol_0317"
FT   CDS_pept        382025..384487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67660"
FT                   /db_xref="GOA:Q0B044"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR011432"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B044"
FT                   /protein_id="ABI67660.1"
FT                   /translation="MRLIGLKDLRIVVGVGWLFVLSLLFTVFPVSWGEAMDIQNSIFQV
FT                   QASEQLSLAASEELDTTGGWVAEITPEITKKGDISLTFDKVMADPSGTKEQFTVVVNGD
FT                   TAVITGVVKTNTPEKIKLELKDKANGAQNVIIDYVKSSDPAKQLKSTDGGTVESFSIQI
FT                   GEPSQAPSLIADSSDNLLGNVIDITFVDDSLWRERVSNVKVNDSSIRGQYRIEEGRLSI
FT                   DADVFLTSGNHSIVVKAPGYTDAAVVQTILESVTLLNPPVLSADLTNNTIGQAIDITFS
FT                   DDVAWRGAISDLSINGQSANAKYSINEGKITINAEVFKEARNYIIVVKATGYNDIQLEQ
FT                   SIIQPSSNGGSGSGDGSNNNNSGGGSGDGSGGGAGSGTPGGLTVLFSQAKLSPSDTLLQ
FT                   FDFGNGMDKTLSSNLNKIRVYEKASGTEVKYSNYNYIKQGSGNDAVKLRRLELMFNNLK
FT                   PGTAYVVELDAGIEANNGSTLGSKQSFEFSTSGTTAGEGAGVPAAEKRFGQEAATIDEQ
FT                   GARIDIPAAAFDQDFKVKVGKVADVSQLPLAEKSKLISDVVEIEKDKSGEFKKAVSITL
FT                   SFDKTKVDSSKYDIQICYLDEKANKWLPLSNIKVDLAAGQVSGETKHFTKFAVIAAEKA
FT                   ADLKPVEAPKVVKLSDIQGHWAQKAIEELLASSAIGGYPDGSFKPEQNITRAEFTSILV
FT                   KALKLSVKDGKVFDDTAQHWANEAIAAAAASGIVSGYSESIFAPDESITREQMAVMVVN
FT                   AGQLAGLGDNKIFADAEQVSAWARKAVAVASAHSIISGYPDNSFRPRANASRAEAAMVI
FT                   AKSLQLAS"
FT   gene            384562..385770
FT                   /locus_tag="Swol_0318"
FT   CDS_pept        384562..385770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0318"
FT                   /product="small GTP-binding protein domain"
FT                   /note="KEGG: mta:Moth_1277 small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67661"
FT                   /db_xref="GOA:Q0B043"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B043"
FT                   /protein_id="ABI67661.1"
FT                   /translation="MQDTPKANRLHIAIFGRRNAGKSSLINALTRQEIALVSEVPGTTT
FT                   DPVFKAMEILPIGPCMIIDTAGIDDEGQLGELRIKKTREVLNQTDLALLVIDPALGISE
FT                   FEKELKQAIRSRKIALIGVLNKTDQGQVDKKSLEKQLGLSLVAVSSRSGEGIEFLKERI
FT                   IERAPAHFEEAHIVGDLIEPGDICLLVVPIDMAAPKGRLILPQVQTIRDILDSDATAIV
FT                   VKEDKLRAALEGLAKKPRLLITDSQVFGKVAPQTPDDVMLTSFSILFARFKGDLLELVR
FT                   GAKAIEKLRPGDEVLIAEACTHHAQDDDIGRVQIPRWLNRYVGGELNFHWYSGSGYPEN
FT                   LEQFKLVVHCGACMINRRQMLHRIDLARDSGVPIINYGVLLAFVNGILERALQPFPQVR
FT                   AIL"
FT   gene            385820..387227
FT                   /pseudo
FT                   /locus_tag="Swol_0319"
FT   gene            complement(387312..387692)
FT                   /locus_tag="Swol_0320"
FT   CDS_pept        complement(387312..387692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67662"
FT                   /db_xref="InterPro:IPR025373"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B042"
FT                   /protein_id="ABI67662.1"
FT                   /translation="MRLLASLLAILLVVLAAGFWTNHSLLQSTKDLSRQIERVSQEIKQ
FT                   EQWEAAQKQNRQLEKTWQEKARWWPIILDHQEIDNIEFSLAKIKEYVASHNLPLALGQL
FT                   SELKLMIEHIPRKEAVNLENIL"
FT   sig_peptide     complement(387642..387692)
FT                   /locus_tag="Swol_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.439 at
FT                   residue 17"
FT   gene            complement(387777..388454)
FT                   /locus_tag="Swol_0321"
FT   CDS_pept        complement(387777..388454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67663"
FT                   /db_xref="GOA:Q0B041"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B041"
FT                   /protein_id="ABI67663.1"
FT                   /translation="MVLVIIRTLILFTVTVIFLRLMGKRQIGQLQPFELVIIIMISELA
FT                   AIPMENTGIPLLSGLIPIFVLFTAQVTLSYLSLRSEKARGIICGKPSILIENSQIVEDE
FT                   LRRIRYNINDLLEQLRSKNVADIADVEYAILETSGQLSVILKSEKRPVKPEDMDLPVKY
FT                   DGLPITLVIDGQVINENIKKMNYNEEWLQQKLNESGINNIKDLLFASLDPDGTIYFQLK
FT                   KGV"
FT   gene            388704..389063
FT                   /locus_tag="Swol_0322"
FT   CDS_pept        388704..389063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_0362 transcriptional regulator,
FT                   Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67664"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B040"
FT                   /protein_id="ABI67664.1"
FT                   /translation="MVEQLLIRPDDTHRLRLMIPVFYVIIDGHIELSAHSAGTGVNATI
FT                   AVRGTGDTVGDSSVFDQSASSLTAQIILSEATLLILDGKDIHRLCSLYPNIAMGFIKAI
FT                   SGRNRKLEKMLITMA"
FT   gene            complement(389821..390615)
FT                   /locus_tag="Swol_0323"
FT   CDS_pept        complement(389821..390615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67665"
FT                   /db_xref="GOA:Q0B039"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B039"
FT                   /protein_id="ABI67665.1"
FT                   /translation="MLIIENLSKTFNPGSINEKLALDNITLSLQPGEFLSIIGGNGAGK
FT                   STLLNCISGVYPMDQGRIILDSMDISYHPEYQRSCYIGRVFQDPMLGTAFDMTIEENLA
FT                   IAYARGKPRGLKPGIRKSEAKLFREHLARLELGLEDRMKQKVGLLSGGQRQALTLLMAT
FT                   IVKPKLLLLDEHTAALDPAIAQRVLQLTREIVSRYHLTTIMVTHNMKAALEYGNRTIMM
FT                   HEGRIILDLQEAEREEITVEKLVQLFGLKSGAELDNDRLLLI"
FT   gene            complement(390615..391529)
FT                   /locus_tag="Swol_0324"
FT   CDS_pept        complement(390615..391529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67666"
FT                   /db_xref="GOA:Q0B038"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B038"
FT                   /protein_id="ABI67666.1"
FT                   /translation="MSFLAFQGSVELGIIYAIMALGVFISFRTLNMPDLTVDGSFVLGA
FT                   AVSATLCSGGHPLVGLALAFAAGCLAGSVTALLHTRLNIQPLLSGILVMLGLYSINLRV
FT                   MDGRANIPLLNKTTVFSLLQGTPLEESATLLIPTIILLSMLVLLFLLLKTQFGFVLRAT
FT                   GDNDQMVRALGVNTDLVILIGLALSNGLVALSGSLIAQYQSFADISMGIGMVIIGLASV
FT                   IIGEVIFGTTPLLRRLVAVILGAMLYRLVIALALELGMAPTDLKLISALIVTLALSMPS
FT                   IKAYLITWKKKHSSPYSRKGGEA"
FT   gene            complement(391659..392672)
FT                   /locus_tag="Swol_0325"
FT   CDS_pept        complement(391659..392672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67667"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B037"
FT                   /protein_id="ABI67667.1"
FT                   /translation="MRKSLPRFLLLPVLLLLVFSLAGCAQEKEKTPPKTAEEVEMKTIG
FT                   IVQIVEHPSLNTIRESLVKQLAEKGFKEGENIKIDYQNAQGDQTNLKTICQKFAHQKYD
FT                   LIVAIATPSAQAAVGETREIPIVFSACTDPVGSGLVSDMEKPGGNVTGTSDAVSAEKIM
FT                   ELAKRITPNIKKVGALYNSSETNSIAVVNNLKDYAAKNGMTVVDATVTNSSEVQQAVSS
FT                   LIGKVDAVFSPIDNTVASAMPLVAQVANKAKMPVYVGADSMVKDGGLATYGINYPVLGQ
FT                   ETANMAVEILNGKKAGDIPVKSMTDMDIYLNQATAKAIGIDIPADVMKEAVQVFDK"
FT   sig_peptide     complement(392595..392672)
FT                   /locus_tag="Swol_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.864 at
FT                   residue 26"
FT   gene            392885..393154
FT                   /locus_tag="Swol_0326"
FT   CDS_pept        392885..393154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B036"
FT                   /protein_id="ABI67668.1"
FT                   /translation="MEATKASTLSPHPQRTICPFLACRASTLPGSLSGWFMVLLPRHRF
FT                   IKIIKQKPENCQGSSWDDFLEMIVLFFARTFMLSGDDFRLLPGC"
FT   gene            393413..393874
FT                   /locus_tag="Swol_0327"
FT   CDS_pept        393413..393874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eli:ELI_12965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67669"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B035"
FT                   /protein_id="ABI67669.1"
FT                   /translation="MNDQQHFMRLERMYLSAPYNQQLYHNNTIKVTREQAIITTEVMEK
FT                   HFHGAGAMHGSVYFKLLDDAAFFAVNSIIKDYMVYTVSFNVNLLRPVGTGIIKSVGMVK
FT                   HQARNRLVAEANLYDQEGKLAACGTGNFMRSPLKLGEMPEYTRELSDEG"
FT   gene            complement(394016..394201)
FT                   /pseudo
FT                   /locus_tag="Swol_0328"
FT   gene            complement(394274..395587)
FT                   /locus_tag="Swol_0329"
FT   CDS_pept        complement(394274..395587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0329"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /note="KEGG: dde:Dde_2214 TRAP dicarboxylate
FT                   transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67670"
FT                   /db_xref="GOA:Q0B034"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B034"
FT                   /protein_id="ABI67670.1"
FT                   /translation="MNPFSLGVLGIIVFLVLLMLRMPIAYAMALVGFTGFALLSSASAS
FT                   FSMVAKEIFNTFSSYSLSVIAMFVWMGFLAFYSGIGTRLYVFAYKLMGHLPGGLAVATQ
FT                   LACGIFGAICGSNTATAATMGAIALPEMEKYQYDTSLATASIAAGGVLGVLIPPSVIFI
FT                   VYGMATEQSIGELFMAGIIPGILLMLAYIATILFLTLRNPALGPAGPKASWKERASSLR
FT                   GGLFEVLVVFALSIGGLFAGWFTPTEAGAVGAAGVLAVSLLGKHLDWTGFKKSLYDTTR
FT                   TTAMIMLMIAGAMIFGRFMAISRIPFELASWAGSLPLPPFAIVGVILLIYLVLGCFIDA
FT                   LALILLTIPIFYPVVVKTLGYDPIWFGVIVVMVVAMGVITPPVGMNVYIIKGVAPDVPL
FT                   EVIFRGIWPFLLAIIFSLIILIAFPSIATFLPHLLHGV"
FT   sig_peptide     complement(395504..395587)
FT                   /locus_tag="Swol_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.812 at
FT                   residue 28"
FT   gene            complement(395584..396075)
FT                   /locus_tag="Swol_0330"
FT   CDS_pept        complement(395584..396075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0330"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporters, DctQ component, putative"
FT                   /note="KEGG: gsu:GSU2056 tripartite ATP-independent
FT                   periplasmic transporters, DctQ component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67671"
FT                   /db_xref="GOA:Q0B033"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B033"
FT                   /protein_id="ABI67671.1"
FT                   /translation="MAKKYNGFVAGLSQFLDQIAGLSLVAVMLVVVGNVLMRALFKHPI
FT                   LGTYDYVGFLTATAIGLALAHCALQNAHIAVDFVVERLPRKTRALIDTATNSVAITFWG
FT                   FALWNLAIYAGTMKANGIVAATSQLPVSPFIYLVAFGLFSLCLVLLSHLGESLRRVAAR
FT                   "
FT   gene            complement(396196..397311)
FT                   /locus_tag="Swol_0331"
FT   CDS_pept        complement(396196..397311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0331"
FT                   /product="extracellular solute-binding protein, family 7"
FT                   /note="KEGG: gsu:GSU2055 extracellular solute-binding
FT                   protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67672"
FT                   /db_xref="GOA:Q0B032"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B032"
FT                   /protein_id="ABI67672.1"
FT                   /translation="MKKTRFVGGKRSWHQGRILLSLLLLLALLAVGGCGKTSPTSTTPK
FT                   EAPKKSQTQTIELRLAHFWPSTHPAEVELVQPWSKAIEEATGGKVKIVSYPNQTLLQAD
FT                   SIYDGVLNGIADIGISCFSYTRNGFPVLEVFELPGITYESSRVASTVAWEGIKELNPKE
FT                   VQDSKLMMVLTTGPGDIYSKVPVRNLQDLKGLEIRATGLSAKTLQALGATPVAMPQSDA
FT                   YESLSKGVVKANLGPVEVLKGWKQAEVTQYLTQTPFLYNTLFFVTMNLDKWNSLDPETQ
FT                   KAIEKVNEKFFKEVAAGLWDKQNDEALKWAVDEKGMELIQLPADEAQRWIELVKPIQDD
FT                   FVKRMDKQGFEGAKILNTAKTLADKYNKEFK"
FT   sig_peptide     complement(397204..397311)
FT                   /locus_tag="Swol_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.720 at
FT                   residue 36"
FT   gene            397669..397947
FT                   /locus_tag="Swol_0332"
FT   CDS_pept        397669..397947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B031"
FT                   /protein_id="ABI67673.1"
FT                   /translation="MHNYSAPASLIATEGSISCARQGATHGQHQRLVSRLKGYRANLPS
FT                   MGGGALATSCRSPPFACSSSPGVASMLHQRSLCIFMQPYATKRGFCS"
FT   gene            398058..398588
FT                   /locus_tag="Swol_0333"
FT   CDS_pept        398058..398588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0333"
FT                   /product="phosphatase"
FT                   /note="KEGG: ilo:IL0105 predicted phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67674"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B030"
FT                   /protein_id="ABI67674.1"
FT                   /translation="MKVSGVEIQVVQGDITRQEDMAVIVNAANSSLRGGGGVDGAIHRA
FT                   AGPELKKESSALAPIGPGQAVITGAYRLPNRYVIHCVGPVYGVHKPEDELLASCYRNAL
FT                   RLAEKQQLDSIAFPAISTGVYGYPMREAAQVMFKTIIEVIPELKHIKKIRIVLFDHPAY
FT                   ELHRQALEACHTE"
FT   gene            398951..399325
FT                   /locus_tag="Swol_0334"
FT   CDS_pept        398951..399325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0334"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: tdn:Tmden_1034 response regulator receiver
FT                   domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67675"
FT                   /db_xref="GOA:Q0B029"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B029"
FT                   /protein_id="ABI67675.1"
FT                   /translation="MKILIVDDSQFFQGFLKKIFIKYLPEAELITANNGRDAYALYEQE
FT                   RPDFIITDLLMPEMNGQEFLQVVKQSNPQVKVIIISADIQKATREEVEKMGVLAYFNKP
FT                   LNNEKAGELLALLKEGSYAS"
FT   gene            399315..399959
FT                   /locus_tag="Swol_0335"
FT   CDS_pept        399315..399959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0335"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="KEGG: rpc:RPC_4604 CheC, inhibitor of MCP
FT                   methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67676"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B028"
FT                   /protein_id="ABI67676.1"
FT                   /translation="MLLNPLQKDALTELVNVYVGYAASLLSEMVGLRILLSVPRVELIP
FT                   EAEMEQGDLPLPEIFSPGHIVSSYISFGQDFRGKAFLVFPVQQAKLLVNACIGEELLLE
FT                   EEDAVPPRFLDTDFDVLKEISNLILNAVIGEFGNLLETRVVFTVPEVELIDVTESDQRL
FT                   FLKDGVYILILHTTFTVDEIQVQGVIMIALNLNSVSCLLQKIDALLEEQDV"
FT   gene            399952..400911
FT                   /locus_tag="Swol_0336"
FT   CDS_pept        399952..400911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0336"
FT                   /product="diguanylate cyclase/phosphodiesterase (GGDEF &
FT                   EAL domains) with PAS/PAC sensor(s)"
FT                   /note="KEGG: gme:Gmet_2629 diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67677"
FT                   /db_xref="GOA:Q0B027"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B027"
FT                   /protein_id="ABI67677.1"
FT                   /translation="MFKLAYLALDKVNQGIIILDKDLKIVFWNAWLEQYTGKSQEETIG
FT                   QKLPQLFPNLSRKPCLDAFQGALFHRQSRFLSGALHHCFIAPVEDIRKDVRQNLLVEPL
FT                   DYDDEKYMLLQISDLTGHYSRVKQLKHMIKEIDSEYEQVRAAEKINRFKAFHDALTGLP
FT                   NRYLFYDRLDNAISMAQRNKEMLAVVFLDLDGFKEVNDNYGHEAGDHLLQVVAERLREL
FT                   LRESDTLARLGGDEFLFIFPQIKSEADAATIAKKILTALANPFMFWGREVYLTASIGIS
FT                   LYPKDAKNSRNLINKADLAMYQVKNSGKNDYHFYNSGI"
FT   gene            complement(401295..402842)
FT                   /locus_tag="Swol_0337"
FT   CDS_pept        complement(401295..402842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0337"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: tdn:Tmden_0930 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67678"
FT                   /db_xref="GOA:Q0B026"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B026"
FT                   /protein_id="ABI67678.1"
FT                   /translation="MKHYTPEILEQVEDIINIGIALSAEKDKNRLLEMIVSEARRITNA
FT                   DAGTLYLCENESLSFKIMQNESMNTFLGGRGERINIPPVPLKMENVSAYAAITHKSVNI
FT                   PNVYQAKEFDFSGPKKFDESTGYRTLSMLVIPLENHEEEVIGVLQLINARDENGKLIPF
FT                   ARYLENVITSLASQAAIAISHMQLVADIEELFNSFVQVMATAIDSRTPYNANHTRRVAL
FT                   LAGEMARAINRQSQGYWAGVSFSDEQVAQLEMAGWLHDIGKIATPLEVMNKSTRIEHQL
FT                   ELVLQRFDYILSNSEAEYLKEKQALLAINSNDSREQLEQLERSWEDKQHYIKESREFII
FT                   KVDHPSTFVNQEIVERLKEIAVQSYRDATGKLQPWLRDNELKCLCVAKGTLTEQERKIM
FT                   EDHVVVTGKMLEKIPFTKKLKDVPFFASIHHEHLNGRGYPQGLSGEQIPLEGRILALVD
FT                   VFDALTASDRPYKKALPLEQALKILGFMVKDGELDGELLQLLVEQQVWENFLDLSEC"
FT   gene            complement(402839..403666)
FT                   /locus_tag="Swol_0338"
FT   CDS_pept        complement(402839..403666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0338"
FT                   /product="beta-lactamase-like protein"
FT                   /note="KEGG: ava:Ava_2117 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67679"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B025"
FT                   /protein_id="ABI67679.1"
FT                   /translation="MTKRNFEVTFWGVRGSLPVPGPHTIKYGGNTSCVQVQIGQRLFIM
FT                   DAGTGIHHLGQQLLKSQSQISGEIFISHTHWDHIQGFPFFAPAFIKGNRFVLYGQSKVN
FT                   STFADLMRGQMTYQHFPVSLGEMGASIEFHELDSGSKLDLGEQIRLRTVHTNHPNGSLA
FT                   YRLDYDGRSCCYITDTEHYSCVDPRLKAFCEETDLMIYDSNYTDEEYPRFLGYGHSTWQ
FT                   EGIKLAQAAGAKKLVLFHHDKARSDGEMDKIEKEAQRCFPNCIAAREGLVINL"
FT   gene            complement(403822..404517)
FT                   /locus_tag="Swol_0339"
FT   CDS_pept        complement(403822..404517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0339"
FT                   /product="putative sulfonate transport system ATP-binding
FT                   protein"
FT                   /note="KEGG: tma:TM0204 putative sulfonate transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67680"
FT                   /db_xref="GOA:Q0B024"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B024"
FT                   /protein_id="ABI67680.1"
FT                   /translation="MGARLEVRSLCKSFGSLSVLNNWNLNIRESERIVLLGPSGSGKTT
FT                   FLRLIAGLEKPSSGEIKLSSQRLGFVFQEPRLIPWRTVEDNLLFVNEKGDISGILEKLR
FT                   LSGFAGFFPAQLSGGMQQRVNLARALLVEPELLILDEAFSSLDLPVKTSIMKDINLHWQ
FT                   EKHFTIIAVTHDLKEALFLADRIIILSPAPSVIARELPVTLGKVRSFSSPEFLHLEGQL
FT                   LDIVCSADR"
FT   gene            complement(404502..405248)
FT                   /locus_tag="Swol_0340"
FT   CDS_pept        complement(404502..405248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0340"
FT                   /product="putative sulfonate transport system permease
FT                   protein"
FT                   /note="KEGG: tma:TM0203 putative sulfonate transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67681"
FT                   /db_xref="GOA:Q0B023"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B023"
FT                   /protein_id="ABI67681.1"
FT                   /translation="MKTGLRSLVGIIVFILLWQLLAVILDKSIIVPTPGETFGLFFHLL
FT                   LSPATLLAGLQTAWKVLMALGLVLLLGLPLGLIIGLFEPLYDMSRPIIMVIQAVPVISW
FT                   LSLVLFTWGRNWQGPVLIAFLSILPIAILTTVSGVRNLDKKLLEMARLYQVPARKIIHD
FT                   IYFGSLLPFIIAIIDVSLGQAWKVILVAEYLCGDSGLGLKIFDARSFVDTPSVYAYTLL
FT                   AVLLGIITERLIKMGTGRLSKLWVPV"
FT   gene            complement(405245..406216)
FT                   /locus_tag="Swol_0341"
FT   CDS_pept        complement(405245..406216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0341"
FT                   /product="putative sulfonate transport system
FT                   substrate-binding protein"
FT                   /note="KEGG: tma:TM0202 putative sulfonate transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67682"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B022"
FT                   /protein_id="ABI67682.1"
FT                   /translation="MKKGVWLLIIVLLLAGSFIFWKHGGLGPEPPAQITLINPLGPTVI
FT                   PVAGISSQQVISEMPITIQYWKDTDEAVALLASKKADFAVLPISAAANIYARGINIKML
FT                   GVHEWKVFYLLAAKDTPFEGWKSLVGKRVYTAHGRGQTADVIMRAALSKEGIEPDQDVK
FT                   ILYAPPQEIVALFKAGKVDFAALPEPFVTLAMSGDNGKIVLDFQKYWGESTGKPERIPV
FT                   AGLFVAGDFQEKYPRETKELARIFADSTRWSNENVDQALAVAAETLPTIPQPVMKKALS
FT                   RIEFEFIDSSKSRPEVEFYLQKMKELYPQGTPKLPDKGFYSS"
FT   gene            406452..408107
FT                   /locus_tag="Swol_0342"
FT   CDS_pept        406452..408107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0342"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="KEGG: bca:BCE4898 ABC1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67683"
FT                   /db_xref="GOA:Q0B021"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B021"
FT                   /protein_id="ABI67683.1"
FT                   /translation="MGLLQRIRHIRRRQQIVGVLVKNGFGYMIQRLGLDSLTPLAERPT
FT                   LVAERPGDRLLAQKLRQSLVELGPTFVKLGQVLSTRPDLLPPVYIEELERLQDKVEAMP
FT                   NAELMKQLLSELGHPDEVFAEFNPEPLAAASIGQVHLARLKSGEEVIVKVQRPGIEKIV
FT                   QNDLEIVLGLAHLSELRSSEARRLGIKDMVEEFSRMFMRELDYAREARNTERVYQNFAD
FT                   DQRVVIPLVYWEYTTGKVLTEEYLSGVKLGDLEEIDRRGWNRRKISQLGTETFLSQIIL
FT                   HGFYQADPHPGNILLLDENRIAFIDFGQIGSLSETRLIHLGELLLAISKQNMDKAMSSL
FT                   QDMGIVGDLDDIEDFQEDFADLIKSVSGSIGKLDINRLRNELMDLSYRHQLKMPAYLTG
FT                   LMKALITVEGVGKKLDPGYDFMETARPLANKVLEERLKAESVYKYIRRKYYQDIKPLAA
FT                   LPSNFNKLVRRTSEGQLKVRMELDLSDKAYHGISRLISRLSASLIITGALIGSSFILQA
FT                   NHAAWVEEYSFLGVLGFGVAIISLVVFLISSLRP"
FT   gene            complement(408144..410060)
FT                   /locus_tag="Swol_0343"
FT   CDS_pept        complement(408144..410060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0343"
FT                   /product="transmembrane sensor domain-like protein"
FT                   /note="KEGG: sat:SYN_01481 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67684"
FT                   /db_xref="GOA:Q0B020"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B020"
FT                   /protein_id="ABI67684.1"
FT                   /translation="MNLSYESHPLEEKKPRRIFSGISHNRFFIPILLFLLLQGLVMLGF
FT                   FTRSDLGLYDAFFRLKGASNPGEKVVIVAIDDSSISRLGPPAWPRSVHARLLEKLKEAR
FT                   AVSFDLTFNSAQEAREDQAFASAIQKHGQVILAAKFTFEKDESGELVQGFEPPLQELMS
FT                   GAAGLGFVNTPTDIDQRVRRSTLVDVNYFEVPFPSLAIATAMVAQDISYEELKLEADRL
FT                   LLGKTEIPLSPLNQAMVKFWGPKATFKTISYADVIEEKIPPAYFQDKIVLIGSITPEDH
FT                   DFVTTPYTTSNMVKGGALDTPGVEIHASIVQTFLEDSWYREAEKPFNMAFLLLAGLLTS
FT                   LVVRGRGPWKGLIGTVLVTLASIALVYGLWEYQRIWLSLAAPLALILLTYVVVTATEFI
FT                   RAELGRRKTKAMFSRYVSADVVDELLKNPDEISLGGKKQVVTIMFADIRGFTAFSENKD
FT                   PVDVINRLNEYLTAMTDSIQSHGGTLDKYLGDGLMAFFGAPVYFEDHVERAIKVAREIQ
FT                   VKVAELNHKWAEQGAVPLLVAVGINTGPVVVGNVGSPERMDYTLIGEDANLASRVEALT
FT                   KLFETLVLVSERSYDLLPEGETKASLHYVGEELVKGFTHPIKVYSFTDLDLHFEKSQDK
FT                   GFK"
FT   gene            complement(410077..410670)
FT                   /locus_tag="Swol_0344"
FT   CDS_pept        complement(410077..410670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0344"
FT                   /product="septum site-determining protein MinC"
FT                   /note="KEGG: aae:aq_878 septum site-determining protein
FT                   MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67685"
FT                   /db_xref="GOA:Q0B019"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B019"
FT                   /protein_id="ABI67685.1"
FT                   /translation="MVKIKGLNGNLVFIFGPGSFDEYLSFLEEKLTANKQLFSGSRVIF
FT                   KGEELKKLSHSQIASLQELCLRHGVIMNNNAVTVNKGSSKDLVIYRNLRSGQKLRSEGS
FT                   VIIWGDVHESAEILAAGDIIVLGKLDGIAHAGCYGDMNRLIFALSLSPGQIRIGDRLSR
FT                   SPEDPDKSPHPEIAFWDGENICIKAYSSRSGLRG"
FT   gene            complement(410680..410925)
FT                   /locus_tag="Swol_0345"
FT   CDS_pept        complement(410680..410925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0345"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="KEGG: sth:STH377 septum site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67686"
FT                   /db_xref="GOA:Q0B018"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B018"
FT                   /protein_id="ABI67686.1"
FT                   /translation="MLDFLKRVFADSSSRKQANDRLRVVLTHDRTGTSSRLMETLKEEI
FT                   LEVISRHVEIEGRPEVKIIREGRHSALDINIPLKGR"
FT   gene            complement(410940..411761)
FT                   /locus_tag="Swol_0346"
FT   CDS_pept        complement(410940..411761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0346"
FT                   /product="septum site-determining protein MinD"
FT                   /note="KEGG: mta:Moth_0542 septum site-determining protein
FT                   MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67687"
FT                   /db_xref="GOA:Q0B017"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B017"
FT                   /protein_id="ABI67687.1"
FT                   /translation="MGKKTEGSSVIVVTSGKGGVGKTTTVANVASALARKGYKIAVMDL
FT                   DIGLKKLDLILGLENRVIYDIIQVIEGECTLKQALVKDKRFPELYMLPAAQTRNKDDIK
FT                   PEQVQEICRQLRPEFDFIFIDCPAGIEQGFRNAIAAADKAIVVTNPEVSAVRDADRIIG
FT                   MLESAQFQDIQLVINRLQASMVRSGDMLSIDDLMEHLCISLLGIVPEDKKVLISTNKGE
FT                   PIVLNEHSEAGLAFNNIANRLLGQQVDFPSFEEDSLWGKIRNLGRNLFSKQ"
FT   gene            412896..413726
FT                   /locus_tag="Swol_0347"
FT   CDS_pept        412896..413726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sao:SAOUHSC_01664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67688"
FT                   /db_xref="GOA:Q0B016"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B016"
FT                   /protein_id="ABI67688.1"
FT                   /translation="MADNKLHIFAVSDSVGETAEKIAVASVLQFNLDRNITRFSRVTKE
FT                   EQVEKIIDQAVENDAIIIYTIVKPELSRFLDETARIKQVIAVNVMAPLFDAIQFKTGQK
FT                   PEYITGLTHKMDDQYFNRMKAIEYTIEHDNGQNLDSVHEADLIVLGLPRTSKTPLSMHL
FT                   ANLGIKVANYPILMDTEIPQEIVDLKGRIPMVGLTIDIDTLMELRKERFRSFELPDDIE
FT                   TLDDLVAEELDNAYRIYAKLKCLVIDVTLDDIEEVGNTITHKFNLPLRITHHRF"
FT   gene            complement(413811..414449)
FT                   /locus_tag="Swol_0348"
FT   CDS_pept        complement(413811..414449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0348"
FT                   /product="sensory box protein"
FT                   /note="KEGG: chy:CHY_1875 sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67689"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B015"
FT                   /protein_id="ABI67689.1"
FT                   /translation="MKKRFFKYVKKPLLKLPGLFKKTTSLSYNEELLIVARTLLRVVDL
FT                   IDHYTCSHSLRVASLADCIAVKMGLNAELRKTLHDGALLHDVGKIGVGKHILCKEGPLN
FT                   DDEWLLLKRHPLIGYEMLENMGYSTGVLSIVRHHHEHYDGKGYPDGFKGREIPFLARII
FT                   SVADSFDAMTTKRPYHPAYSTYKALEEITQCSGSQFDPDVATAINKIII"
FT   gene            414754..415026
FT                   /locus_tag="Swol_0349"
FT   CDS_pept        414754..415026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67690"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B014"
FT                   /protein_id="ABI67690.1"
FT                   /translation="MHNKKGKIMSKDDFLQNSLYAKEEYEGLLVSSDTNKGVYNIGIEL
FT                   GNNQILLIDQVKDSEVHERVHMWVPQIQEIQRRYGFEGDLGNYSS"
FT   gene            415088..415357
FT                   /locus_tag="Swol_0350"
FT   CDS_pept        415088..415357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B013"
FT                   /protein_id="ABI67691.1"
FT                   /translation="MMSKVEAYETPIMSLEEFNVGLLEKDRIPGLLIRSDEQGFYNIGV
FT                   QINDREVVKVASAMEDDAMYKIQFWADKVDQIKDQYKERQPQLK"
FT   gene            415438..416016
FT                   /locus_tag="Swol_0351"
FT   CDS_pept        415438..416016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67692"
FT                   /db_xref="GOA:Q0B012"
FT                   /db_xref="InterPro:IPR025098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B012"
FT                   /protein_id="ABI67692.1"
FT                   /translation="MNFYHYIRFPFRDEDWIKKILLGCVISIVPVLNLLSLCYFVECMK
FT                   FGMAGRQSLPEWERWEDFVREGIIAFLISLGYFLVPLILAFLLLHIPMVGVFLVSIIIL
FT                   AIGMIIPLAIANYLKDHYPMDAINFKEIFYMMNQVASNYIPAYFMAVFLMALGLTIVFL
FT                   LPYLSFLGVLLIFYCGMIFFHFTGSLLNS"
FT   gene            complement(416148..417266)
FT                   /locus_tag="Swol_0352"
FT   CDS_pept        complement(416148..417266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0352"
FT                   /product="sulfate permease (SulP)"
FT                   /note="KEGG: dde:Dde_2855 sulfate permease (SulP)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67693"
FT                   /db_xref="GOA:Q0B011"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B011"
FT                   /protein_id="ABI67693.1"
FT                   /translation="MKIGDFSEIHGEISGAIADLGTFLPYVLGAIIIGGLDASSIFITF
FT                   GLMYIFTGYFYRIPIPVQPMKIIGAAILVHHLTAGEVAAAGIMMGLTLFILSITGLASR
FT                   LAGLTPDSVTLGIQAGLGVSLAMLGINYIKTDLLLGLIIMLFMLFLFQNRRFPASIAGV
FT                   VGGTLLAFVLHPELHWPGLQLGFYWPHLILPAWTDFARGFTLAYLPQLPLTLTNSVLVT
FT                   AILAHELFPEQSEKVNERNLCLTLGIGNLLAAPLGGFAMCHGSGGLAAHYRFGGRTGFT
FT                   PALMGIILLFTGIFLGPAGVDLLQVIPQAVLGGLLFFSGVDLVRGVQDFGDKKTLFCFA
FT                   VVLIISIAVNPAIAFMVGLILHFLFNKGWVNI"
FT   gene            417882..419570
FT                   /locus_tag="Swol_R0015"
FT   rRNA            417882..419570
FT                   /locus_tag="Swol_R0015"
FT                   /product="16S ribosomal RNA"
FT   gene            419845..422932
FT                   /locus_tag="Swol_R0016"
FT   rRNA            419845..422932
FT                   /locus_tag="Swol_R0016"
FT                   /product="23S ribosomal RNA"
FT   gene            422988..423101
FT                   /locus_tag="Swol_R0017"
FT   rRNA            422988..423101
FT                   /locus_tag="Swol_R0017"
FT                   /product="5S ribosomal RNA"
FT   gene            423216..423324
FT                   /locus_tag="Swol_R0018"
FT   rRNA            423216..423324
FT                   /locus_tag="Swol_R0018"
FT                   /product="5S ribosomal RNA"
FT   gene            423439..423547
FT                   /locus_tag="Swol_R0019"
FT   rRNA            423439..423547
FT                   /locus_tag="Swol_R0019"
FT                   /product="5S ribosomal RNA"
FT   gene            423716..426787
FT                   /locus_tag="Swol_0353"
FT   CDS_pept        423716..426787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0353"
FT                   /product="putative CheA signal transduction histidine
FT                   kinases"
FT                   /note="KEGG: mag:amb1466 predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67694"
FT                   /db_xref="GOA:Q0B010"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B010"
FT                   /protein_id="ABI67694.1"
FT                   /translation="MRNSLKSRFIIVVFTVCFCCLLVVSLVSYYNSYILVREETNQVAH
FT                   EAVNRYASELNNWFMQQAGVLHAISQDIEINRDFSDEYLSLYLMEKFQRRDSCVIDYYI
FT                   GFADSNRKMVCATGWVPPEDYEASTREWYKEAVKNNKLVYITPYLDADTKEMVITLADP
FT                   IRDGDRLLGVLAADILLTDVMKLAQDVHIDKEHYSFLLDDCYNFIVHPHPDFQPLASES
FT                   RNASQVMQGLYRPLTEQIQEGRYPIIELKDYDNSKRCFALSEIKETGWTFGIAIPHSEY
FT                   FGPLKKLWYGFALALAISLFIGFIIILPVVRSLLRPIEDLHQAVGRFADKDFSARSPVT
FT                   SADEVGELSNNFNRMADIIQEYNVGLERKVEERTAAIRNLLDNAGQGFLSFGSDLQINQ
FT                   EYSSECKRIFGFDIAGQYFPRVIFPGDEAEKQFLENALQTIFGEEDEYRRGVYLSLLPE
FT                   ELMINGRHIQLEYKVIANRRLKDNYSIMLIITDITEKRCLEKQMEEERELLEMVVKVVA
FT                   NRDDFLEYRNDFQRFCIHGIGELLDSDLPRDEVIAEIYRQIHTFKGGFAQMKMGYLFNQ
FT                   LHDCESEISASRDELREMSAVEIKDFLDSFKLFEAMARDISLLEEVLGEEFLEHDNKLL
FT                   IDEQKLLEIKQKIITCLAPWECKMLLPYIKRLRFRPFKELLRSYPESVSSLAESLGKSL
FT                   LPLRITGGDMLVDSDYYHDFCKSLLHVFRNAIDHGLESPEDRLELGKNEYGIISCDIKE
FT                   EDGGIAVVISDDGRGIDINLLKEQALDRGIYDEEYIEGLSCEEALQLIFADSLSSKEEV
FT                   SSISGRGMGMPAVKAELDKLGGKVEISSEKDRGTRFCFWLPAHDKIDIEDFSIEEIINP
FT                   LLETAREFFSREIGINLLHSTEVERKKRQELLRITAFITIKGVVRSYFILSVDEELGRY
FT                   LVQAMTMDEIESGTEEDFVEDVLAECANMILGNSIKLFPGISELVMLEVPVTLYSDQTA
FT                   IKHLQADIWTCDFLFEEGRLRLGLISQEEIYSCL"
FT   sig_peptide     423716..423814
FT                   /locus_tag="Swol_0353"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.357 at
FT                   residue 33"
FT   gene            complement(426801..426926)
FT                   /pseudo
FT                   /locus_tag="Swol_0354"
FT   gene            427080..427784
FT                   /locus_tag="Swol_0355"
FT   CDS_pept        427080..427784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0355"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: pab:PAB1330 chemotaxis response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67695"
FT                   /db_xref="GOA:Q0B009"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B009"
FT                   /protein_id="ABI67695.1"
FT                   /translation="MAKILIVDDSKLIRRNLRIILTRAGHEIIAEAENGLQAFQEYEKN
FT                   QPDLITMDISMPLMDGVAAVKKIVSQYPDAIIIMISAMDQKNMVMAAIQSGARNYIIKP
FT                   FSPDKVVSVVNAALASVGKAVAASPQHSTLEDKQVLYPFYIEAHDANVRVTIKQSFASG
FT                   HVKPLLDALQSFFNQKPLQVTFDFASVQIYEYSLIDRLIELMQTIKDNEGKLRVLAEDK
FT                   KITRYVKSKGII"
FT   gene            427801..428364
FT                   /locus_tag="Swol_0356"
FT   CDS_pept        427801..428364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0356"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: dsy:DSY1853 cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67696"
FT                   /db_xref="GOA:Q0B008"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B008"
FT                   /protein_id="ABI67696.1"
FT                   /translation="MLQVYTGEGKGKSTAAFGLAMRAAGHGCRVRIIQFLKGNTFAGEL
FT                   RSAKKLGIEVFSFGRSCPHATLIKGGFMECDECAECWVSPEGLTENDRKKATMAWQLTQ
FT                   NTVREGSIHLLILDEVFAALELELLPYEDFLKWLENASRSMEIVLTGRNALPEVIAIAH
FT                   LVSRIEKVKHPFDINGHPRRGIEY"
FT   gene            428492..428782
FT                   /locus_tag="Swol_0357"
FT   CDS_pept        428492..428782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67697"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B007"
FT                   /protein_id="ABI67697.1"
FT                   /translation="MSRYKNLYASTLFGAGFYFPFLKTMKKGRSKIRECSYCCMSFRAA
FT                   FARSFTISPSIFTAGSLRLPQASSILPLALLPIIFWLAKDGQYWPSGHKLA"
FT   gene            428984..430006
FT                   /locus_tag="Swol_0358"
FT   CDS_pept        428984..430006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0358"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: chy:CHY_1585 anthranilate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67698"
FT                   /db_xref="GOA:Q0B006"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B006"
FT                   /protein_id="ABI67698.1"
FT                   /translation="MFDRYLKSVVEGDYLNSEEAYLTARMLLHEDIPEIKAAAFLSALR
FT                   TRKESQEELTGFVQALYEEAKMVDCGMEVLDTCGTGGDGLGTFNISTASALVVASCGVA
FT                   VAKHGNRAVTGKVGSADVLEALGVEVQLEPDEARQLLDKAGITFLFAPHYHPILKQVGG
FT                   LRRGLGIATIFNFMGPLLNPCRPSYQVLGISDSNLQEAVAGTLQRLGRKRALVVHAFNG
FT                   MDEISPEGKTRVFDVGEHGLEVFDIDPEELGIGGFSLDAIQGGDATASARLVIKVLQGE
FT                   PGPYRDTVILNTAAALLTAGRAKNIQEGMQMAAEAIDAGKSMETLQKMISFSRDRILAC
FT                   "
FT   gene            430000..430782
FT                   /locus_tag="Swol_0359"
FT   CDS_pept        430000..430782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0359"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="KEGG: sde:Sde_0754 indole-3-glycerol-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67699"
FT                   /db_xref="GOA:Q0B005"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B005"
FT                   /protein_id="ABI67699.1"
FT                   /translation="MLKTIAEGKLKEVKRLRESLDIAQVEARCETSRQISLSRDSGGKL
FT                   QLIAEIKKASPLKGLLCREFSPLEMARSYEANGAAVISVITEQEFFDGRKEYLPLVKTG
FT                   VKLPVLRKDFIIDEVQIYESRQMGADLLLLIAALHDYDSLLALVEKCSALGMEPLLETH
FT                   GREEIKMALDLPVKIIGINNRNLRDFSVDIRSSLDLLPLIPDSYLKVSESGIKEASDLR
FT                   LLESAGCDFVLVGEALVTAADPGAKLREILSYQQEEGL"
FT   gene            430779..431393
FT                   /locus_tag="Swol_0360"
FT   CDS_pept        430779..431393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0360"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="KEGG: gme:Gmet_2492 N-(5'phosphoribosyl)anthranilate
FT                   isomerase (PRAI)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67700"
FT                   /db_xref="GOA:Q0B004"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B004"
FT                   /protein_id="ABI67700.1"
FT                   /translation="MTRVKICGIRSLEEAIAAREAGAWAIGQVFAPSPRRLEVDIAAAI
FT                   NRELGQSILKIGVFVNEEAENLRRIVASCRLDMVQLHGDEEPAYLEEVSVPVIKSFRVR
FT                   GSLELEQLKRWRPWAYLFDSYHPGVYGGTGESFDWSFLQEIARQERIILAGGLNTENVG
FT                   RAIHQLRPLVVDVSSGVEYPSGGKDPAKIREFINIVQEQAT"
FT   gene            431640..432836
FT                   /locus_tag="Swol_0361"
FT   CDS_pept        431640..432836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0361"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: aae:aq_706 tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67701"
FT                   /db_xref="GOA:Q0B003"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B003"
FT                   /protein_id="ABI67701.1"
FT                   /translation="MMYPDERGYFGRYGGRFVPETLIPALMETEEAYRELAGDEKFQQE
FT                   LQLYLKDYVGRESPLYFASRLSENAGKARIFLKREDLNHTGSHKINNTLGQALLARKMG
FT                   KKRLIAETGAGQHGVATATAAAAFGLECTVYMGSKDMERQRLNVFRMQMLGAEVRGVKK
FT                   GSETLKDATNEAFRDYIRSFEYSHMVIGSVVGPHPYPMMVRDFQAVIGRELRRQFQEQE
FT                   GGLPDCIIACVGGGSNAMGIFYPFLEDPVKLLGVEAGGCGTAPGQHCATLSRGNDGVLH
FT                   GAFSRLLQDEYGQVMDTHSISAGLDYPGVGPEHASLRERGRVDYVQMSDREALDAFVQL
FT                   CRMEGIIPALESAHAVAYALKIAAALEEEKSLVVNLSGRGDKDVEEVARLLGGVGNGN"
FT   gene            432826..433605
FT                   /locus_tag="Swol_0362"
FT   CDS_pept        432826..433605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0362"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: chy:CHY_1581 tryptophan synthase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67702"
FT                   /db_xref="GOA:Q0B002"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B002"
FT                   /protein_id="ABI67702.1"
FT                   /translation="MEIRNRLAQLREKEEMALIAFIMAAVPDEDLCLDCIRALEQGGCD
FT                   LLELGVPFTDPLADGEVIERFHHWGVRLGLNLKRGLDFAARVRAACQLPLILFSYYNPI
FT                   LQMGLDRFAGDCRSAGVDAVIVPDLPLDELGRLAGQGLELIPMLAPSSTLSRIQMAADL
FT                   DPAFIYCVSVRGVTGVRSLPEMEIKDYLQKVRRVSTAPLALGFGISQPEQVRAFRGQAD
FT                   GVVIGSALAQIIEEYESRPALLPGMLEKRCQALKLLS"
FT   gene            433717..434529
FT                   /locus_tag="Swol_0363"
FT   CDS_pept        433717..434529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0363"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: mta:Moth_1335
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67703"
FT                   /db_xref="GOA:Q0B001"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B001"
FT                   /protein_id="ABI67703.1"
FT                   /translation="MLACKLASRSPDSKNNTIIKIKTAGKEISIGDGNCTIIAGPCSVE
FT                   SQEQYLEIALILKEMGVDILRGGAFKPRSSPYSFAGLGTEGLKILAEARELTGLPVVSE
FT                   VMDPRDLDQVAAHCDLIQIGSRNMQNFSLLKEAGRVDKPVLLKRGLAATIEEWLLACEY
FT                   IMDAGNEKVILCERGIRTFEPLTRNTVDIGAVALVKELSHLPVIVDPSHATGRRSLVAP
FT                   VARAAMAAGADGLMIEVHQHPEEALSDGEQSLTPEQFAALTERIRAMV"
FT   gene            434560..436764
FT                   /locus_tag="Swol_0364"
FT   CDS_pept        434560..436764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0364"
FT                   /product="anthranilate synthase, component I / anthranilate
FT                   synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: ana:all0414 anthranilate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67704"
FT                   /db_xref="GOA:Q0B000"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010112"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B000"
FT                   /protein_id="ABI67704.1"
FT                   /translation="MNNISQHLAGFRSLRYSSEGGVDIERRVRSIELKGATEPIIKQID
FT                   RQKGALFSSSYDYPGRYSQWDIGFLNPCLELRAQGRDFCLEALKSSGLKLLFGLYAELR
FT                   GREEFTALLLKQNKIEGSVKKSPEVCWEEERSRQASIFSLIRVIRRYLFYPDDCFLGLY
FT                   GAFGYDLVYQFEPMELKRPRPEGQCDLLLYLPDELTVVDHRMARAYQLNYSFRSSGELM
FT                   NIPQYSQENICPEVSNRQQEQPLPGHYTALVEKAKQSFQRGDLFEVVPSYSLLEPCPIA
FT                   PSEAFKNLKRINPSPYGFIINLGDEQLVGASPEMYVRVEGRRVETCPISGTIKRGKDAI
FT                   EDALQIRKLLNSGKDEAELTMCTDVDRNDKSRICEPGSVKVIGRRQIELYSHLIHTVDH
FT                   VEGILRPDFDALDAFLTHMWAVTVTGAPKRAAIKWLEENEESPRGWYGGAVGYLSFNGD
FT                   LNTGLTLRSIRIKNKLAEIRVGATLLMDSIPEEEEAETLVKAAAMLKAIQGASADRRPL
FT                   IVPGLQLEKPAPRVLLVDHEDSFVHTLSNYLKQLGAEVWVARAPLARKRLRQGQDFDLL
FT                   FLSPGPGRPDDFQLKETIDLAIKRSIPVFGVCLGLQGIVEYFGGRVEELPYPCHGQASL
FT                   LTVSQPSPLWKFLPRQFQVGRYHSLYAAVLPDCLQVSAISEDGVAMAVEHREMPMAAIQ
FT                   FHPESILTADNGNGLQVLRNVLDYLATAPYAVAGNSKITI"
FT   gene            complement(436754..438400)
FT                   /locus_tag="Swol_0365"
FT   CDS_pept        complement(436754..438400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0365"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /note="KEGG: chy:CHY_1296 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67705"
FT                   /db_xref="GOA:Q0AZZ9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZZ9"
FT                   /protein_id="ABI67705.1"
FT                   /translation="MLNRLNIAVQVIAVFIIISIFSIVVGIVGVKANDKALKHLIKIED
FT                   VNFPSAEELAKIALSQSMVLTAERGLINNDMLESKLHQSQYDRIELEKQIAQEAIKNYL
FT                   TLPQASEEKQMWEQFLPLWETWLSHSQQVVQIAREKDALLSELGNLDAPQIKEINTTLL
FT                   NASLQSRESFLKAQDSLNTLIDINTQAAHNEGVIAKQEVTLSFRLMLGGMFLSILLALI
FT                   LGYYLLRTLRQRLVNPVKDMGEIAHQAASGDLSVDIAIGSNDEIGQLAKALKNMILQIR
FT                   GIISEVSEKSNYLSSSAGQLNANYQQSTVQANQTATTMGEIASAVSQVATSVQEISQVS
FT                   VKTSDFANNGKEGVAIIGSQMQAITDSTTHASDVIHSLSQKAKEITQIVELISSISDQT
FT                   NLLALNAAIEAARAGEQGRGFAVVAEEVRKLAEQSAQAAKRIKDLIISIQLESQKAEEA
FT                   MAFGSQEVEAGNRVVNELKESFNAIIEAVHILSDQIQEAASATEETSAGVQEVAATVEE
FT                   QTASMGDVASAAESLAMLAKELSELVKRFKL"
FT   gene            438721..439053
FT                   /locus_tag="Swol_0366"
FT   CDS_pept        438721..439053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0366"
FT                   /product="membrane protein"
FT                   /note="KEGG: cac:CAC2744 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67706"
FT                   /db_xref="GOA:Q0AZZ8"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZZ8"
FT                   /protein_id="ABI67706.1"
FT                   /translation="MNASWRLGAHTYLWMFPIYGLAVFLEPFHDRIRSAPWPVRGFIWA
FT                   SLIIGIEYLCGWLLKIFLGFCPWDYSGASLFSLDGFVRLDYTPFWFIAGLAFEQIHDYL
FT                   DRIGIS"
FT   gene            complement(439197..439601)
FT                   /locus_tag="Swol_0367"
FT   CDS_pept        complement(439197..439601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67707"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZZ7"
FT                   /protein_id="ABI67707.1"
FT                   /translation="MKVQSLNLHGLSLEEAQQKTRQNLSWCMQNGVDVLDLNHGKGYHS
FT                   SRNFSVLKQELRRMLKSEPSLKEFGYKVVYGESNLPVALTYDEGHTLIVARGKENEYIG
FT                   SRKEQEKKQRIFSPEGQQERKLRKKRSKYK"
FT   gene            439783..441873
FT                   /locus_tag="Swol_0368"
FT   CDS_pept        439783..441873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0368"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: tte:TTE0604 Superfamily I DNA and RNA
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67708"
FT                   /db_xref="GOA:Q0AZZ6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZZ6"
FT                   /protein_id="ABI67708.1"
FT                   /translation="MQNIFADLNEQQKEAVAHVDGPCMVLAGAGSGKTRVLTRRIVHLV
FT                   KQGIPPHRIMAITFTNKAAQEMRSRVISMLPDFNSQWIQTFHSTCNRILRMDIQELGFD
FT                   KYFSIIDDTEAKSLIKTLLREENDYETKAEELLYIFKQAKNSLEKPEKYFYSFAVPDFI
FT                   KERNCRVFSLYNSRLKNLNVLDFEDLIVLCIRLFQQNPDVLEKYQGWFQYIMVDEYQDT
FT                   NYSQYFWARLLASRHHNIFVVGDPDQSIYSWRGAEPYNIKRFLGDYPDSRLIKLEMNYR
FT                   SSGNILSAANAVICNNEEREEKQLYTQKGQGEKLVHFCAGDSFQEARFIADEINQLLRS
FT                   ENRHFQDFAVFYRTHAQSRALEEALLYRNIPYHIVGARKFYERKEIKDILAYLRLVSNN
FT                   NDLLSFERVINVPRRGIGEKTLGRIKAYSEERGISLLDVLAEAESIPGIGRKMLTAMED
FT                   FYGMLKYLTDLVTSGASLMELLEQVIEVTGYIEELKKSKATDAEARIENLQELRSLVVE
FT                   FEREGGQGLEEFLSQTALVQESDELDNSDHVLLMTLHGAKGLEFPVVFITGLEEGVFPS
FT                   YRSQTAEEMEEERRLCYVGITRAQERLYLSHALSRLLYGYERSNPPSRFLYEIPEELLL
FT                   SPQQKKVAKPVFQAGDRVLHAKFGMGIISELNEEEQIAVVEFVQAGTRMLRLDIAPLEK
FT                   ID"
FT   gene            441936..443921
FT                   /locus_tag="Swol_0369"
FT   CDS_pept        441936..443921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0369"
FT                   /product="DNA ligase (NAD(+))"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: chy:CHY_1100 DNA ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67709"
FT                   /db_xref="GOA:Q0AZZ5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZZ5"
FT                   /protein_id="ABI67709.1"
FT                   /translation="MEVSSRIKELREEMQKHDYHYYILDAPLISDSGYDRLMQELKKLE
FT                   EEYPQYITADSPTQRVAGKASEKFSPVRHRFPLLSLDNAFSYQDLLEFDRRIGRVARTL
FT                   SYMAELKIDGVSIALVYENGVLLNAATRGDGLVGEDVTANIRTIKTIPLRLRHSLPRLE
FT                   VRGEVFMPKQEFIRLNEEKEEKGERVFANPRNAAAGSLRQLDPRVTAGRALSAFVYDII
FT                   YMEGQTLAEQQEAWHFMQELGLPVNPEVRFCADINAVLAFTEEYAEKRHELPYEIDGVV
FT                   VKLNTLAEREELGATARSPRWAMAYKFPAEEKETRLLGVEINVGRTGIIAPTALLEPVF
FT                   LAGTTVSRASMHNFDLIKEKDLRIGDMVLLHKAGDIIPEIIASLPEKRSGEERVITPPE
FT                   NCPACDSKVARFAGEVAYRCENINCPARLKESLIFFASRGAMDIDGLGSAVIEQLVNKD
FT                   MVKRIDDLYRLREEEITALERMGPKSAANLIKAINESKSRPLSRLLTALGIRHIGARSA
FT                   KILSRHIHDIDDFYKLGVENLTSIPEIGPKMAESMVNFFAEPRNRETIEDLKDLGVNTR
FT                   EEAIEAGEQLLQGKTFVLTGTLPSLTRQQASEMIESRGGKVSSSVSKKTSYVVAGDDPG
FT                   SKLDKALQLELTILDEAGFLNLLGLS"
FT   gene            complement(443966..444175)
FT                   /pseudo
FT                   /locus_tag="Swol_0370"
FT   gene            444265..444939
FT                   /locus_tag="Swol_0371"
FT   CDS_pept        444265..444939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_2225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67710"
FT                   /db_xref="GOA:Q0AZZ4"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZZ4"
FT                   /protein_id="ABI67710.1"
FT                   /translation="MTGTLINAGVIVAAGAVGLLLRRGIPENIARSLQDAMGLLILIIG
FT                   IQYGLKTESLVVVGLSLALGTVFGEWRNWEGKLENTGKRLKRLLGQEENLFVKGFVSAT
FT                   LVFCVGAMAILGALQDGLTHNYDILLVKSMLDGIMAMIFAASMGIGVLFSALPLLLYQG
FT                   AISLGAGFLKPFLTDPVINNLTGLGGIIIAGIGLNTLGLARIRLANLLPGLLLVPLLMF
FT                   LF"
FT   gene            445060..445344
FT                   /locus_tag="Swol_0372"
FT   CDS_pept        445060..445344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0372"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="KEGG: mta:Moth_2010 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67711"
FT                   /db_xref="GOA:Q0AZZ3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZZ3"
FT                   /protein_id="ABI67711.1"
FT                   /translation="MALSPEEVNHVAMLARLALSEDEKTAFAEQLTLILDYVERLNELD
FT                   TGEVEPLIHILPVFNVLRQDEALPGSSQEEILSNAPLVEDGQYKVPRII"
FT   gene            445359..446822
FT                   /locus_tag="Swol_0373"
FT   CDS_pept        445359..446822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0373"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="KEGG: mta:Moth_2009 glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67712"
FT                   /db_xref="GOA:Q0AZZ2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZZ2"
FT                   /protein_id="ABI67712.1"
FT                   /translation="MDLYKLTVHELQDKLLAGEISSEDIVKSLFSRIALVEEKAQAFIT
FT                   LCEETALEGARRIDQQDEYGGIKGIPYGLKDLFCTRGIKTTCASRMLENFVPSYESTAS
FT                   KLLNEKGGILLGKLNLDEFAMGSSTEQSAFFPSRNPWDWERVPGGSSGGCAAAVAAGEI
FT                   PFALASDTGGSIRQPASYCGIVGLKPTYGRVSRWGVAAFASSLDQVGILSRDVRDCALI
FT                   LKIIAGKDPLDATSADTEVPNYCAFLDGEVKGMRIAYPREYFQHWVTESIRTAVMKALR
FT                   KFEELGAIVEEVSLPHSEYALPAYYIVAPAEASTNLARFDGVRYGLRDDEADNVIDMFS
FT                   LSRAQGFGPEVKRRIMLGTYALSSGYYDAYYLKAMKVRRLIASDFAKVFRDFDLIVSPT
FT                   TPTTAFKLGEQIDDTLTLYMNDALTVPVNMAGLPGISIPCALDDGLPVGMQLIGRAFDE
FT                   ATLLKAAYAFEQNTDYHRLTPVPGGGINE"
FT   gene            446815..448257
FT                   /locus_tag="Swol_0374"
FT   CDS_pept        446815..448257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0374"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="KEGG: chy:CHY_1103 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67713"
FT                   /db_xref="GOA:Q0AZZ1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZZ1"
FT                   /protein_id="ABI67713.1"
FT                   /translation="MSKEFETVIGLEVHAELKTESKIFCSCSTAFGAEPNSQVCPFCAG
FT                   FPGALPVLNEKVLELAIRTGIALNCEIPEYCKFDRKNYFYPDLPAAYQISQYDQPVCIN
FT                   GYLEIDLDGEIKRIRINRAHMEEDAGKLVHQGDITTTPFSLVDLNRCGIGLLEIVSEPD
FT                   MRSAREARAYLEKLRSILLFAGVSDCKMQEGSLRCDANISVRPAGQEELGTRTEIKNLN
FT                   SFRSLERAIEYEARRHVEAIEDGEELLQETRTWDEEKQVTRSMRSKEEADDYRYFPDPD
FT                   LPPLRISRERIEEVRRQMPELPDVAQERLVETYGLPHYDATILTTTPDYLEFFDRVIKI
FT                   YPDAKVVANWMMSELNKYLNQSNLEISDCLIKPENLVEMLQLIDDGTISGKMAKTVFAE
FT                   MFNSGKRAPEVVREKGMVQISDEKALSAIIESIVNGNPKVVEDYRNGKEKAFGFFVGQV
FT                   MKATRGQANPAVVNKLLKEKLK"
FT   gene            448399..449571
FT                   /locus_tag="Swol_0375"
FT   CDS_pept        448399..449571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67714"
FT                   /db_xref="GOA:Q0AZZ0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZZ0"
FT                   /protein_id="ABI67714.1"
FT                   /translation="MTRSSMNKDWFLEEGARVNIVDTTLRDGEQTAGVVFTNNEKIQIA
FT                   RYLDMIGVDQIEAGIPVMGGFEKDCIKEIVALGLKSSIMAWNRAVIADIKESLDCGVDA
FT                   VAISISTSDIHIEHKLQTTRQDVLNRMADAVKFAKDKGLYISVNAEDASRSDIDFLTEF
FT                   ALLAKRSGADRLRFCDTVGTLTPLSAFRYIKTLIDAVGINIEMHTHNDFGMATANALAG
FT                   VYAGANYVGVTINGLGERAGNACLQETIMGLKYLMNVNLTYNTTLFREVAEYVAQASGR
FT                   ALSVSKPIVGSGIFAHESGIHGDGVLKNPLTYEVFSPEEVGLERQIVIGKHSGTAAVRS
FT                   KFTREYNIELNDTEAAQILARVREMSIELKRSLFDKELMYIYEELYGKAR"
FT   gene            449623..450873
FT                   /locus_tag="Swol_0376"
FT   CDS_pept        449623..450873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0376"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: chy:CHY_1105 3-isopropylmalate dehydratase,
FT                   large subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67715"
FT                   /db_xref="GOA:Q0AZY9"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY9"
FT                   /protein_id="ABI67715.1"
FT                   /translation="MGKTIAEKILSTKSGRDVKANDIVVAELDFIMGQDGTSPLAIQAF
FT                   QEMQARRVFDPARIAMVIDHSAPSPLEGVSELHRQMRSFAGEQGICFYDIGDGVCHQLL
FT                   PEQGHVVPGDLVIGADSHTCTYGAINVFSTGVGSTDLAAGLISGKLWFKVPETFKFVLN
FT                   GQLPAGVYSKDLILHLIGDVTADGATYMAAEYVGEAIAGLSVEARFTISNMAIEMGAKA
FT                   GLMDADQKTLDWVKEHSTKSFTPVKADADAVYARVKEYDVSRLEPQVARPHTVDNVAPI
FT                   GEVAGTPIQQGVIGTCTNGRMEDLRIAASILKGRKVKSRLIVAPSSRQVMLQAIREGLI
FT                   EIFLESGAAVVTPGCGPCVGTHNGVPSDGENVISTANRNFKGRMGNNRAFIYLGSPATV
FT                   AASVIKGEISDPREYLR"
FT   gene            450965..451465
FT                   /locus_tag="Swol_0377"
FT   CDS_pept        450965..451465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0377"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: chy:CHY_1106 3-isopropylmalate dehydratase,
FT                   small subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67716"
FT                   /db_xref="GOA:Q0AZY8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY8"
FT                   /protein_id="ABI67716.1"
FT                   /translation="MDLKGQVHKFGDDVNTDYIISGRHKFKTLDMKELAKYVMEDLDPE
FT                   FYNKVKAGDFIVAGSNFGCGSSREQAPLAIINANISAVVAKSFARIFYRNCINTGLPLI
FT                   ECDTEQIDEGDELEVDLQKGVLYNRSKGIEIAITPLPDVMLKILSDGGLVEHFKKYGTF
FT                   NFD"
FT   gene            451511..452779
FT                   /locus_tag="Swol_0378"
FT   CDS_pept        451511..452779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0378"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: bcl:ABC2714 isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67717"
FT                   /db_xref="GOA:Q0AZY7"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY7"
FT                   /protein_id="ABI67717.1"
FT                   /translation="MPVGEKIRVENGVLKVPDHPIIPFIEGDGTGPDIWAAASRVLEAA
FT                   VDKAYKGQKSIVWKEVLAGEKAFQQTGEWLPQETIDTIREYIIAIKGPLTTPIGGGIRS
FT                   LNVALRQELDLYTCLRPVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYPRGSEES
FT                   DKLLKFLQEELGVKNIRFPGSSGIGIKPVSEEGSKRLVRAAINYALNEGRRNVTLVHKG
FT                   NIMKYTEGAFKQWGYDLAESEFGDKVFTWDQYDRIKEEKGTAAADQAQKEAEEAGKLII
FT                   KDAIADIFLQQILTRPNEFDVVATLNLNGDYISDALAAQVGGIGIAPGANINYVTGHAI
FT                   FEATHGTAPKYAGLDKVNPSSVILSGELMLRHLGWNEAADLIIMAIGKTIASKVVTYDF
FT                   ARLMEDAQEVKCSGFADALIANM"
FT   gene            complement(452798..452953)
FT                   /pseudo
FT                   /locus_tag="Swol_0379"
FT   gene            453089..453976
FT                   /locus_tag="Swol_0380"
FT   CDS_pept        453089..453976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0380"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="KEGG: aae:aq_1429 5,10-methylenetetrahydrofolate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67718"
FT                   /db_xref="GOA:Q0AZY6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY6"
FT                   /protein_id="ABI67718.1"
FT                   /translation="MRIIELYRQKAPLLSLEIFPPRMAYPLESVFDTVQELKRLNPAYI
FT                   SVTYGAGGSNRERTVEIAARVKKEYGIEAQAHLTCIGHRQEDIKNILARLNREGICNIM
FT                   ALRGDIPEDEPEFDFRRQEYHYAFELIRDIRAAYGDSFGIAAAAHPEGHPECPRLKDDI
FT                   FHLKNKVDNGVDFLITQLFFDNRIFFDFWERCQAMGINCPVIPGIMPVLNAGQIKRMIY
FT                   LCGASMPAGLLKLVDKYEKEPVDMEKAGIDYASQQIKELLENAVAGVHLYSMNKPRQIS
FT                   EIVYNIGLASPGKY"
FT   gene            complement(453973..455466)
FT                   /locus_tag="Swol_0381"
FT   CDS_pept        complement(453973..455466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0381"
FT                   /product="Hpt sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: gsu:GSU2314 sensory box histidine
FT                   kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67719"
FT                   /db_xref="GOA:Q0AZY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY5"
FT                   /protein_id="ABI67719.1"
FT                   /translation="MSGRIWWAESSIVQGNGNPADMAKSQFLANMSHEIRTPIIGILGS
FT                   LDLLDQSDLSQQQATNISIIRECGEQLLQIVDNILDVSKIESDPVTPNLEPCNLGELII
FT                   ATVNRVDTLLKRKGLDFKLNIDSRIPAKIMLDKTKLQQVLLNLLYNSIKFTPQGRVELK
FT                   AKIQPGDSYRLLFTISDTGIGIPSSFVERVFEPFTQADNSNSRQYGGAGLGLYICKKLL
FT                   ELMEGEISLSSMPGVGTTVSFSIPLIEMDKVEIEVPYELNREQFENKEEALLDFTPIRV
FT                   LLVEDNPLNQKIVGQMLYNYGFEVIMASNGLEALRILQDKPVNIVLMDMQMPVMDGYEA
FT                   TQFIRQHSKWRDIPIIAITAHSLPGDREKCLACGCTSYIAKPFKAHELVQLMKEYIKQD
FT                   IKEFVSPQRLIVELLPEFLIILDEMIDDLEAAIKSRNIDKIQAISHDIKGTAGMYGFMK
FT                   FSKLATAIEQASRIKDLTKVKQIFSELYQELEKVKIQVS"
FT   gene            455774..456985
FT                   /locus_tag="Swol_0382"
FT   CDS_pept        455774..456985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0382"
FT                   /product="copper amine oxidase-like protein"
FT                   /note="KEGG: mta:Moth_1790 copper amine oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67720"
FT                   /db_xref="GOA:Q0AZY4"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY4"
FT                   /protein_id="ABI67720.1"
FT                   /translation="MKSKSFLFTLLLAMLFGLAGSGLILPALAADTQPVKIFVDGRQVD
FT                   PGEAAPFIKNDRVMVPLRVISEGLGLNVDWDAENYRVLISSSSPANLSSLPADGKGQFV
FT                   KIYFDGREIKPDDVLPLIENDRTMVPLRSTFEGMGMKVDWDPANYQVIVMTAQALPVDF
FT                   STMVPLRSTFEGMDMKVDRDDTNHQVIVIDSPQPAAVNNDYEISIMGNSTATAEQLKAL
FT                   LQENNPLAPDLVELYLQMGREYGVRGDIAFCQAAKETGWWKFGGLALPEQNNYCGLSVT
FT                   GKAATATEDLRGANPQKVRFIEGKHGAFFDSPASGVEAHIQHLYAYATTAPLPAGKELL
FT                   DPRFILVKRGCAPRWIDLGGKWATPGFDRNKYSCFDEAFAAEDTYGHSILANYYWKALP
FT                   PATI"
FT   sig_peptide     455774..455863
FT                   /locus_tag="Swol_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            complement(457100..457750)
FT                   /locus_tag="Swol_0383"
FT   CDS_pept        complement(457100..457750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0383"
FT                   /product="GPR1/FUN34/YaaH family protein"
FT                   /note="KEGG: btk:BT9727_3301 GPR1/FUN34/YaaH family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67721"
FT                   /db_xref="GOA:Q0AZY3"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY3"
FT                   /protein_id="ABI67721.1"
FT                   /translation="MSNSNEMHVSGHIQELVANPSPLGLLGLAMVTLVASSQKLGITTG
FT                   TAFIIPWAIFLGATAQFVAGLMDYKHNNTFGATAFCGYGFFWFGVAMTWMMANGTIGMS
FT                   AGITPDIHQLGFAFLGYFIFTVYMTVGAAGANKVLFIIFFLIDLLFLGLFMNTLGLGGE
FT                   AWHELAAYSEMGIAIMSFYGSAATVLNSHYGFTVLPVGAPFGSLARKAAQLKK"
FT   gene            458381..460219
FT                   /locus_tag="Swol_0384"
FT   CDS_pept        458381..460219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67722"
FT                   /db_xref="GOA:Q0AZY2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY2"
FT                   /protein_id="ABI67722.1"
FT                   /translation="MAANFAINNIRDFEFIIGEWLPTEGVFNYPQFADYYSKDDIKPVL
FT                   GPILKMCKEVIEPTNDDGENNPIKFENGKVTTPPSFGPLFHQLQSEGWGTSNIDKSPDA
FT                   MVMPEMLHMAVWELIGAANPTFMPYVLLTTGAADLIQSFGDEKLKQMFLPKMMDGTWSG
FT                   TMCLTEPSAGSDVGDILSKAYPTDDPRIFKIKGNKIFITAGDNDFTENIIHLYLARIEG
FT                   ARPGTGGISLFVVPKYWVNEDGSLSDNDFQTTGVEHKMGQAGSVTAALAAGENDGCRGW
FT                   LLGNDPREHEGKGQGMAQMFQMMNLARMETGHMALSCIINAFCNARDNAKERVQGRLLT
FT                   NPKAGRVAIINHEDIKRTLLMGKAHIEAMRAMLYRVYLAFDQRERDPDPEVRKAASDLI
FT                   EITTPLCKAYPSDEGWWLISEAIQSYGGYGYCEEYPVAQIARDMKIYSIWEGTNYIQSM
FT                   DLVGRKMQMKGGSLFGAWVKEMVDFCEANKGNAALSKEFAILDKALKAYQEMLKVYAGY
FT                   AKTNFSLVPLYSRRVLTITSQLYCGRQILDQAVLADKKAKEVGADHYDYNFYIGKVASA
FT                   KYYLHNVVPNVWSVCEIIADGDSSALEVPLEAFEYM"
FT   gene            460627..461115
FT                   /locus_tag="Swol_0385"
FT   CDS_pept        460627..461115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0385"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67723"
FT                   /db_xref="GOA:Q0AZY1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY1"
FT                   /protein_id="ABI67723.1"
FT                   /translation="MQEIYYKISEISEILGVEQYTLRYLENSLGLKIKRNERGDRLYSE
FT                   SDLETLKLVLQLKNKGLNTTAIKMALENIEETEEKAISPLENKGQGMMEVVTMAKKIVE
FT                   QNQTLLEQNRKLEQRMEKLEQKIDKRNLERERKIDEFLELWKAEQARGKSWLSRILSK"
FT   gene            complement(461157..462866)
FT                   /locus_tag="Swol_0386"
FT   CDS_pept        complement(461157..462866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0386"
FT                   /product="Molecular chaperone-like protein"
FT                   /note="KEGG: bbr:BB3934 molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67724"
FT                   /db_xref="GOA:Q0AZY0"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZY0"
FT                   /protein_id="ABI67724.1"
FT                   /translation="MQLGLDFGTSYTKLGLQHNGEFINLLGNEDEGQIPTVAAYLPSQR
FT                   RLCFGPLALRIDEAGAETAFFFKLALKRQASLTLGSYSLPDLLLAFFRFLQEEYLESRG
FT                   IKADSLNISVPNYFGLNSRRILLEAARQAFGVKKVFLVPEPLAAALGYNLLHPLFPLQG
FT                   DILSIDIGGGTSDFSFLTLAHDKREMLVETQFQIGHDAFSGSEIDQAILQHLLFPAFTI
FT                   QTGLRLPREFYSGKFTSSRNRFQYNRLRQLAEKIKIELSKEEYYHLDFPDFHAGYSLNL
FT                   ELTAEVLAARLEPVFERLKSYIEEQVKLRAKALHLFSADKWHIDAVLLLGGASQTRGLK
FT                   DLIAGIFPVLKVICPEDPSFYVLRGLCHWENDGISIKSIYPFNFYIERIGPDGNSHILE
FT                   KIPFDTANLELDLEKHYPIFSLPVDSVYNLSPDSDSVLFRVYEVEEEDNKVNLERFSGQ
FT                   EMVWQWEGPRQELHNYLELYLDLKKSRIESGGALSATRTLPVDSNILSGLLVRQKEIQK
FT                   LMADSHSNPRLAEDFGEHLSRLEKVNKPYYNHSETTLYKLLYLLDFFTRPSN"
FT   gene            complement(463446..465059)
FT                   /locus_tag="Swol_0387"
FT   CDS_pept        complement(463446..465059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67725"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX9"
FT                   /protein_id="ABI67725.1"
FT                   /translation="MKELEINLDFFQDKLESFLQQLFQEINTVSGAQAWKEGELEKMDN
FT                   HLYELNSFYYRSFNEHFFPAYRSELKEELASLLKLNRQQDAIKRDIMANLQRYARLYNQ
FT                   VKSLNFSLQQAQENCLLALETIDEKERERGIELYYRLQKAGDAISYVNELLYQIKQLEQ
FT                   DKEALAALNRESNSIILINILKLDRDNPEELDYYYQWMKNIHHWNNALLDLMDNQESLP
FT                   RKTARFMARFSREYQELKERVLPSFSFMEPYPAYWHTQKLELFDLHLTSLNNSEILRVV
FT                   KALQLFLSDTLLFMTKALSSEDKIMNIGVGASAMMDYCHIKALNLNLKELEEQISKSWQ
FT                   SLNQLIKEFPARGEMDMAYFLERSQEIISDSYAAISTAKSNLGSYQNTVLASSLYRATL
FT                   ELSSLKAHIELLEEKQHYGKAIQQSYLQLAAMLSQHKEWIANFRADLERLLAPRNLSRS
FT                   WKDLSLRVEKINLQKGREFPEEFLYLLDKYQIASRVSPERPNLILEEEGDIFIFKVDDL
FT                   QEELIPFFVVSAGPVDSGSE"
FT   gene            complement(465059..466549)
FT                   /locus_tag="Swol_0388"
FT   CDS_pept        complement(465059..466549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67726"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX8"
FT                   /protein_id="ABI67726.1"
FT                   /translation="MAYSDWPLILDNYRSVQDSPDLFFFWQEELRLRQLGRNLEKSPAR
FT                   VVLRQPEELDFLLRSLYFSGQQPQFFNILLQNMYLTFVLQWLLDSPRYVLEAFLDYLPW
FT                   YLSSNRIKKRNLLFLIQIYQESFKDKFRAIINTLDAEACGYIAARTASPDLRELIQLRE
FT                   EELEQSRKENYYAIKRELYKNNLYPSIFGDKIELFVQAIDSIEATSPEHFTEPYGAPRF
FT                   SSLLETAELVFQCGWPEDSLAILLDVYEDYQQKNRLVKVLDDENIYRQFHKVLRRVIPV
FT                   YSILFGLPDCLNRAKNIYQQAFPRILPDSASLQYLAVYESVLAGLNAVLQHPQWEIIIK
FT                   ASPIQKQRPSEPPLLLANEADSGISPQRWIELQGLIEQKMASLPHEAFITLEYLRFLQL
FT                   YFDLDIEQQLAQRLMAGYLALWKWLPSSLFMNPYLLEQLGPLLPASERAEAQKILTFLD
FT                   DYDKQGLNNELCFRPELFRKKAKSTLREILIGQFSGVW"
FT   gene            complement(466555..467241)
FT                   /locus_tag="Swol_0389"
FT   CDS_pept        complement(466555..467241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67727"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX7"
FT                   /protein_id="ABI67727.1"
FT                   /translation="MRKLDQGQKLGKDEYQRLMEYIEELRDKSPESYMLFYERYALLLY
FT                   QDYSTYLPRFAQGIDHLLNLLMEKPELLPKLKEHQLAMELFPPELHPYLQYSFTQPADS
FT                   LSLSILFNFLDNNQELVNQLPAARKNEVVCKFEDGNPYKEVGLKAHFDRLSRYSFITRL
FT                   QSYRYLSAAKAASDRIEFLAADRLGGIFTNREKSIYYFIFLSEANEIKARNACRLLNMV
FT                   FYGGKG"
FT   gene            467559..468188
FT                   /locus_tag="Swol_0390"
FT   CDS_pept        467559..468188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF1513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67728"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX6"
FT                   /protein_id="ABI67728.1"
FT                   /translation="MLKKSPFQSWISLLIFPSLTIILALSIVVQNQAIFSNSDAVMYTY
FT                   LKNACQGQVGYAYMSNCGNNITFAELEPGDILLGGYPDCAYGRFSHAGIYLGKGQVAEG
FT                   YVDLGITIQTLDHYHSYSDICLLKVKAPQDVKSKAVDYVRKQEGKIFYPLAFKPGDRWW
FT                   NCSKIMWKAYYKQGINLTPEADFWIAPDAFYQSPLVDIIAEEGWFK"
FT   sig_peptide     467559..467654
FT                   /locus_tag="Swol_0390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.919) with cleavage site probability 0.434 at
FT                   residue 32"
FT   gene            468176..468634
FT                   /locus_tag="Swol_0391"
FT   CDS_pept        468176..468634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67729"
FT                   /db_xref="GOA:Q0AZX5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX5"
FT                   /protein_id="ABI67729.1"
FT                   /translation="MVQIILCVARLYIIQLFAFLAIWLSTYYPGMDIFLSILYFLLIAL
FT                   EARSPQNLKKRDILIIIILWQGPAAVLGLMLLSGMNAGFWSLNAPFLLEFWATPLVALL
FT                   SCFKGPLLAGKPLYYYCIIATPVLLGFYYYLLSIPLLLKQKNSIRWPF"
FT   gene            complement(468879..469145)
FT                   /locus_tag="Swol_0392"
FT   CDS_pept        complement(468879..469145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE0662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67730"
FT                   /db_xref="GOA:Q0AZX4"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX4"
FT                   /protein_id="ABI67730.1"
FT                   /translation="MKINFTEMGWADYLYWQMQDKKTIKRINQLIKDIERNGSLNGIGR
FT                   PEPLKGDLTGWCSRRIDDTNRLVYRLRDDSLEIGQCRGHYSNK"
FT   gene            complement(469142..469423)
FT                   /locus_tag="Swol_0393"
FT   CDS_pept        complement(469142..469423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67731"
FT                   /db_xref="GOA:Q0AZX3"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX3"
FT                   /protein_id="ABI67731.1"
FT                   /translation="MHYMAKTTNISIRMDKDLKERADAVFNEMGMNMTTAFNIFVRQTL
FT                   RQGKIPFEIYADPFYGERNMKALHQSIQEAEEGKFVTKTLDELLAMEK"
FT   gene            469861..470430
FT                   /locus_tag="Swol_0394"
FT   CDS_pept        469861..470430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0394"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="KEGG: mta:Moth_0809 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67732"
FT                   /db_xref="GOA:Q0AZX2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX2"
FT                   /protein_id="ABI67732.1"
FT                   /translation="MGNALQLLPATQSDRALLKHLEEEAGTEVNLCYQCGKCSAGCPVG
FT                   FAMDQTPRQVIRLLQLGLLEEALSTESIWICASCETCSARCPRGVDIASLMDALRREAL
FT                   KQGRITDRKVAVFNRAFLSGVKNFGRTYEAGLLLQHNLFTGQLFKDAELGLPMMQKGKL
FT                   SFFPEKIKGREAIKKIFERAENPGGE"
FT   gene            470432..471820
FT                   /locus_tag="Swol_0395"
FT   CDS_pept        470432..471820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0395"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: mta:Moth_0810 protein of unknown function
FT                   DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67733"
FT                   /db_xref="GOA:Q0AZX1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX1"
FT                   /protein_id="ABI67733.1"
FT                   /translation="MKLAYYPGCSLDGSAIEYGISAKRTAELLGVELLEIEDWNCCGAT
FT                   SGHNTNKLLSLALPARNLALAEKTGLDVLAPCAACYNRFRNTEHVVRHDRKMQEKIAAV
FT                   IEMDYAASNQTLSILELIVNKVGLEKLREKVSQPLKAMKAACYYGCLLVRPQDHTGFDD
FT                   NEDPRSMDLIMQALGAESVEWSFKTECCGAALATSRPDVGYRMIYEVLRNAREAGAECL
FT                   VTACPLCMMNLDMRRRGVEKAFNERLDIPVYYITELLAIACGDSPRDVGVHRHFVEAES
FT                   YLASLPEKAARIEAEEAARLEAEQAKKAARAAQAKKAAADKAKKKEAPAAEAAAKAGEE
FT                   KKAAPAAEAAATLAEAGDKGNKATPTQAQAVAPATAEAVDEGALQKKINAMIKAWEKSP
FT                   EKVAARLIEDGERAAILAQVVSGDEKKTARLAELMITDKDKAAKAAEAFVTGELKKRQK
FT                   AQES"
FT   gene            471845..472429
FT                   /locus_tag="Swol_0396"
FT   CDS_pept        471845..472429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0396"
FT                   /product="heterodisulfide reductase subunit"
FT                   /note="KEGG: mta:Moth_0811 heterodisulfide reductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67734"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZX0"
FT                   /protein_id="ABI67734.1"
FT                   /translation="MKKRVGVFVCDCGTNIASVVDTEKVAAAARQFPGVVFATTYKYMC
FT                   SDPGQELVRNAIKEQELEQVVIASCSPRMHEKTFRKAVEDGGINAYMFEMVNIREQDSW
FT                   VHHDREQATQKAIALVRMAVSKVLRNQPLQVSTIPVTRKALVIGGGIAGMQAALDIAEA
FT                   GHQVVLVEKEASIGGKMTQLDKTFPTMDCAA"
FT   gene            472445..473830
FT                   /locus_tag="Swol_0397"
FT   CDS_pept        472445..473830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0397"
FT                   /product="heterodisulfide reductase, subunit A,
FT                   selenocysteine-containing"
FT                   /note="KEGG: chy:CHY_0930 heterodisulfide reductase,
FT                   subunit A, selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67735"
FT                   /db_xref="GOA:Q0AZW9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW9"
FT                   /protein_id="ABI67735.1"
FT                   /translation="MVAVAQHPNIAMITYAEVTQVKGYIGNFKATIKKKPKYVDWDLCT
FT                   GCGTCAEKCPTKKLKDEFDLGLGLRTAIHKVYPQAVPGKFYIDAQNCTKLTSGKCGVCE
FT                   KLCPAKAIRFDDKEEYQEVEVGAIVMATGYDLFKWEEAYGEYGYGKYPDVISSLHFERL
FT                   VSAGGPTGGKIQRPSDGKEPKSVAFIKCVGSRDDTKGKSYCSRACCMYTAKHAYQVKDK
FT                   IEDSEAYVFYMDVRTAGKNYEEFYQRSLNAGAKYIRGRVSKIYPRGERLVLKSEDTLLG
FT                   RPLEVEADLVVLATAMVPSEGAGALAKAIGFSSDKDGFYQEAHPKLQPVETFAAGVYLA
FT                   GCCQGPKDIPDTVAQASAAAVKICGLFSKNELATEPMVTQVDISKCSGCGFCVPICPYN
FT                   AISLEPIQERGHHGPFTRNVAQVNSSLCQGCGACLPACRTLALNLKGFTNDQLVAEVDA
FT                   LCL"
FT   gene            473821..474033
FT                   /locus_tag="Swol_0398"
FT   CDS_pept        473821..474033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0398"
FT                   /product="heterodisulfide reductase subunit"
FT                   /note="KEGG: gsu:GSU0089 heterodisulfide reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67736"
FT                   /db_xref="GOA:Q0AZW8"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW8"
FT                   /protein_id="ABI67736.1"
FT                   /translation="MSIDKSEWQPKIIVFACNWCSYAAADLAGLNHLEYPADVRIIRTP
FT                   CSGRMDPLLVLRAFNRGADGVLLSG"
FT   gene            474094..474252
FT                   /locus_tag="Swol_0399"
FT   CDS_pept        474094..474252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0399"
FT                   /product="hydrogenase, methyl-violgen-reducing type, delta
FT                   subunit, selenocysteine-containing"
FT                   /note="KEGG: chy:CHY_0931 hydrogenase,
FT                   methyl-violgen-reducing type, delta subunit,
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67737"
FT                   /db_xref="GOA:Q0AZW7"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW7"
FT                   /protein_id="ABI67737.1"
FT                   /translation="MKSLMEYLGIEAGRYQTAWISGAEGIKFQQTMQKLVEDVKKLGPN
FT                   YKLREAK"
FT   gene            474252..475154
FT                   /locus_tag="Swol_0400"
FT   CDS_pept        474252..475154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0400"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="KEGG: mta:Moth_0814 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67738"
FT                   /db_xref="GOA:Q0AZW6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW6"
FT                   /protein_id="ABI67738.1"
FT                   /translation="MDITSKIRKIATRLLQNGEVDLFMAWEKGDLPFQSKPFFARRVED
FT                   VERIIFDEYSIHNLSNALLKFRDRQEKIGLVVKGCDSRGVVRLLEDGQIKRDRLYIVGV
FT                   CCPGMKDPLQAMRDYSGFNRNLEAAPLAAKCENCIQPNPVIYDELLGEEQPPRVQGERF
FT                   ARVRELEQLSPDERYRFFEDILSRCIRCYACRQACVACNCRTCIFDETKPQWVGRETSI
FT                   SDNMMYHLVRASHMAGRCIECGECERVCPVNIPLMLINQKLIKDVDNFFGPYEAGMQYV
FT                   EGAKPPLSVYQENDPDDFI"
FT   gene            475167..476186
FT                   /locus_tag="Swol_0401"
FT   CDS_pept        475167..476186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0401"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="KEGG: mta:Moth_0815 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67739"
FT                   /db_xref="GOA:Q0AZW5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW5"
FT                   /protein_id="ABI67739.1"
FT                   /translation="MKVLNKNKLPAVFDKLAQQSELFVPLQKKEQSGFYSWKSFDQASD
FT                   QLALDLLNVYLPPKQVLLPQTEKMYSFRQEEGGVAISEVYEESQARVIFGIRACDLQAI
FT                   NCLDQAFLTRGFVDEYYKARRDNTTIVASACYKPGANCFCSSMGVDPLEPAGADAIIRD
FT                   TGSEFFIWEARTPAGEELSRQLAEYLEEKELPLPQSQAFERQVDMEGVAEKLSQVFSSP
FT                   LWEELSDACQTCGICTYLCPSCYCFDIQVKNQGEAGYRFRCWDSCMYGEYTMMAGGHNP
FT                   RASATERFRNRFLHKLEFFNERYGMPLCTGCGRCIIACPAGIDISKIITAAKEADWSA"
FT   gene            476179..477012
FT                   /locus_tag="Swol_0402"
FT   CDS_pept        476179..477012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0402"
FT                   /product="oxidoreductase FAD/NAD(P)-binding"
FT                   /note="KEGG: mta:Moth_0816 oxidoreductase
FT                   FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67740"
FT                   /db_xref="GOA:Q0AZW4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW4"
FT                   /protein_id="ABI67740.1"
FT                   /translation="MHNCNCENPLVPQIVEIVKIIDETPDVKTFHVRNENGVPFDVRPG
FT                   QLAMVSLLPVGEGMFSVSWQEEKEHLQFAIRRVGLMTDELHSVGVGHKIGVRGPYGNGF
FT                   PVEACQGKDMLFIAGGIGLAPLRSFIKYCLKHRSDYGKIQVLYGARSYADLCFKDELFD
FT                   LWPKEKDTEVFTTLDRPEEGWDGHVGLIPSYLEELNPAPEGKVAVICGPPIMIKFALKS
FT                   LEKMGYNDEQVITTLEMRMKCGIGKCGRCNIGSEYICLDGPVFNLAQLRKLPPEW"
FT   gene            complement(477245..478084)
FT                   /locus_tag="Swol_0403"
FT   CDS_pept        complement(477245..478084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0403"
FT                   /product="putative integral membrane transport protein"
FT                   /note="KEGG: atc:AGR_L_3273 probable integral membrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67741"
FT                   /db_xref="GOA:Q0AZW3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW3"
FT                   /protein_id="ABI67741.1"
FT                   /translation="MIFKKNKLLNNVLMLVLVSTISYVLLFPVIVGIFTSFKPTSEVIT
FT                   LTPTLIPKHWTLVHYKALFATGEYPTYLFNGLFVAFFTTIVTIMLASLAAVAIVWMKVP
FT                   AKKQILQLILFTYMFPRILIIVPLFMMLYKLNLIDNKFGVVLSYLCFTLPFGIWMLKGF
FT                   FESIPSDILDAARIDGCSYFSALRKVIIPVTLPAMAAVGTFSFILGWSEYIFASIIITS
FT                   NSNRTITLGLYTLMGYYRTDYGLLTAACVIMIIPIVIFFIYIQKYLVSGLTAGTTKA"
FT   sig_peptide     complement(478004..478084)
FT                   /locus_tag="Swol_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.930) with cleavage site probability 0.627 at
FT                   residue 27"
FT   gene            complement(478154..479038)
FT                   /locus_tag="Swol_0404"
FT   CDS_pept        complement(478154..479038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0404"
FT                   /product="ABC sugar transporter, inner membrane subunit"
FT                   /note="KEGG: rsp:RSP_3673 ABC sugar transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67742"
FT                   /db_xref="GOA:Q0AZW2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW2"
FT                   /protein_id="ABI67742.1"
FT                   /translation="MKRKELISLIFVIPALAAIFALTLYPILRGIDISLTDKLLSYDKY
FT                   SYIGLENYINILKDDMFWLALQHTAVITIISSIIILILSLALALLLNMKFPLRKFFRGI
FT                   LMIPWVVPSVVSVLIFRWIYNDYYGYINYILVKYHILDQAVNILADEKLAWLGVIIPIV
FT                   WKEYPFAMLIFLASLQSIDKNLYEAAKIDGASRLQVFKEITLPLLKPAFVILGILEIIW
FT                   MFSSFDTIFLLTRGGPDNSTITLSIYTYMQAFESTEFGYGSALATIMFLILFAVSIVYF
FT                   IFVNRESWSKKTS"
FT   sig_peptide     complement(478985..479038)
FT                   /locus_tag="Swol_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.608 at
FT                   residue 18"
FT   gene            complement(479162..480478)
FT                   /locus_tag="Swol_0405"
FT   CDS_pept        complement(479162..480478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0405"
FT                   /product="ABC-type sugar transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: tte:TTE0799 Sugar-binding periplasmic
FT                   proteins/domains"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67743"
FT                   /db_xref="GOA:Q0AZW1"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW1"
FT                   /protein_id="ABI67743.1"
FT                   /translation="MSKSNKKIVVLMLILSLLMGIIAGCGTSADKDAATEVITVKFSYP
FT                   PYGYDSKLEDPFWKKYIAAFEKENPNIKIEMTVESWNNLYTKWNQYFESGDTPDIGYND
FT                   GARAVQYGVNGKIQPINDVIKDLGGEAVFTPIAGSFKQGDTWYAVPNCAASPVLAYRKD
FT                   LLKAAGFNEPPKNWDELVSMSKALTKDGVYGLGMFTSDSGLTRQIMMGFMKAAGGKVID
FT                   EKGNVVINSPENLSAVKFMSDLVTVHKVVPPSAKDWKYGDDVNALGVGKIAMDIMWGGY
FT                   GTLLAEMFPDVYQNIGFVKMPDGPSGHSGSFSGAGGFFLFKNAKHPEEAKKFIKYMCRP
FT                   EISKEWCQISGNVSPFLSIAKDTELMQMEWYKAVSDQSFTAVALDFESGYIPGTEILYE
FT                   ENRYAKLVVDVMLGKMTAEESLKKFHQDAVAAIENAKKH"
FT   sig_peptide     complement(480392..480478)
FT                   /locus_tag="Swol_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.576 at
FT                   residue 29"
FT   gene            complement(480717..481892)
FT                   /locus_tag="Swol_0406"
FT   CDS_pept        complement(480717..481892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67744"
FT                   /db_xref="GOA:Q0AZW0"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZW0"
FT                   /protein_id="ABI67744.1"
FT                   /translation="MKGLYKILPPFAPDYSGVCAVLFELGGLVVVYDAGGCAFNVTNYD
FT                   EPRWYGSSAAILSASLREIEAVIGDDEKLLKKIEDSVRILRRSFVAILGSPASMVIGTD
FT                   YQALADIISKRTGLPALAFNTNGLKYYDQGAAMAFEALARRCINPVCSAANKLVNIIGA
FT                   TPLDIGNQRNMQNLVEKLVEAGCKEVLCWGMGTTLQEIEEKAAQAHLNIVVSNAGLMAA
FT                   RYMQQMYKIPFLAGIPIGHAPSLRFIAEVRSLLGLMERSYTIESLPASSRNALVIGEQV
FT                   MGNSIRTCLGMDFGINQVTVASFFSMDDALTEAGDIFLEDEDDLTALANKHRYNYIIGD
FT                   PLYKKILSSAGNCFIDFPHIAVSSHLYWDNDIEYVGDGGVDFFKQIINTGN"
FT   gene            complement(481913..483220)
FT                   /locus_tag="Swol_0407"
FT   CDS_pept        complement(481913..483220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0407"
FT                   /product="Nitrogenase molybdenum-iron protein alpha and
FT                   beta chains-like protein"
FT                   /note="KEGG: dsy:DSY3837 putative nitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein NifE"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67745"
FT                   /db_xref="GOA:Q0AZV9"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV9"
FT                   /protein_id="ABI67745.1"
FT                   /translation="MHNEPFCVSICELGIDNFYNRKRVKPSGCLEYCFPCAGGWCIPRI
FT                   GSIVPEAVMLLVSPAGCGRHGAITSIQKGYKNRLFFLHMSESDIVNGQHLDKIFAATAN
FT                   ILAEVDPRPKAMMICASCIDDLLGSDYEAIAEELERKHNIPIKACHMDPIAMEGSKPPV
FT                   RTIQQAIYDFIPRVSKKDNAINIIGSFPPLDKDSEFKKIMSAAGIEKIRHIAECSTLEE
FT                   FYQMGCSSYNIVIKPRGLMAAEYMKKRLDIPFCYAPAAYSIETINRTYKKLEEFLGMKL
FT                   DTDRYSEKARQVIDRHYATLGPLTVVVGEIIENDSTYELARALIEYGFKVPYIIANRIL
FT                   DIDLEHINWLKTHAPDIVVFTNAHPSMTDFLQNNLKVDIAIGMDAAYFFPHAKPIPLRL
FT                   DTQLYGYKGIESLLELICQAFDNPQDIKKLMYGLEN"
FT   gene            complement(483213..483977)
FT                   /locus_tag="Swol_0408"
FT   CDS_pept        complement(483213..483977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0408"
FT                   /product="nitrogenase iron protein subunit NifH"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: dsy:DSY3569 nitrogenase subunit NifH"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67746"
FT                   /db_xref="GOA:Q0AZV8"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV8"
FT                   /protein_id="ABI67746.1"
FT                   /translation="MKKIAIYGKGGIGKSTIASALSASISLLGYRVMQIGCDPKADSTI
FT                   NLTHGLTVTPVMNYLARNGICSSLEAIVVEGFNGIACVETGGPTPGLGCAGRGIITTFN
FT                   ILDDLNAYEIYKPDFVLYDVLGDVVCGGFAMPIRHGYADEVIIVTSGEKMSLFAANNIK
FT                   NAIDSFAERKYARLRGLILNRRNIDGEEHIVQEFAREIGTKVIGDIPRDSNIQLYEQQN
FT                   KTVVEGDPNLDISQMIMKIAANIVNDAGVSNA"
FT   gene            484275..485372
FT                   /locus_tag="Swol_0409"
FT   CDS_pept        484275..485372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0409"
FT                   /product="putative maltose ABC transportor"
FT                   /note="KEGG: cpe:CPE2345 probable maltose ABC transportor"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67747"
FT                   /db_xref="GOA:Q0AZV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV7"
FT                   /protein_id="ABI67747.1"
FT                   /translation="MAKLLLKNINKVYENKVHAVRDLNIEIHDKEFLVLVGPSGCGKTT
FT                   TLRMIAGLEDISSGELYIGDRMVNNLEPKDRDIAMVFQNYALYPHMNVYENISFGLRMR
FT                   KIPKKEVHEMVLNIAGILDIEDLLTRKPAQLSGGQRQRVALGRAIIREPQVFLMDEPLS
FT                   NLDAKLRVQMRSEIIKLHNKINTTFIYVTHDQIEAMTMGSRIAIMKDGIIQQIDTPINI
FT                   YNKPANTFVASFIGSPQMNLLDATVVEQDGELKLAFADAVRCINANQQLVLKKSNYVGK
FT                   QIVFGIRVENVSLERKGYMLPFRGSVEVIERPGSETYTYISTQLGTIVSKMPIDTNIKI
FT                   DDNIMVYFDDNKGFMFDKETNCIIR"
FT   gene            485913..487049
FT                   /locus_tag="Swol_0410"
FT   CDS_pept        485913..487049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0410"
FT                   /product="(R)-2-hydroxyglutaryl-CoA dehydratase
FT                   beta-subunit, putative"
FT                   /note="KEGG: gsu:GSU2519 (R)-2-hydroxyglutaryl-CoA
FT                   dehydratase beta-subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67748"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV6"
FT                   /protein_id="ABI67748.1"
FT                   /translation="MLDEFMQGFASAREVNLLRIKEAKENGRKVVGIYCTYCPQELILA
FT                   AGAIPVGLCGMSENPIAAAEETLPRNLCPLIKSSYGFAATDTCPFFHFSDLIVGETTCD
FT                   GKKKMFEIMQDLKPVHVMQLPHLNNTEASFELWVEEVRCLKKRLEKELQVTISDQDIWR
FT                   AVEVINQEKQAIKAMFDLNRADPPPLSGMEMLTAAWSRSFSSDKGELIDNLNGLVREVA
FT                   NQTNNRQVKAPRVLLTGCPVGLGTEKVIRLSEELGAYIVAMENCSGYKTLELQTATNGA
FT                   DPIVALAEKYMAIPCSCMSPNPYRLKLIDNMIDDFRVDAVIDLTWQACHTYNIEAFEVG
FT                   KLVKSKGLPYLHLESDYSNSDLESLKVRIEAMLEMVEK"
FT   gene            487046..487822
FT                   /locus_tag="Swol_0411"
FT   CDS_pept        487046..487822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0411"
FT                   /product="CoA enzyme activase"
FT                   /note="KEGG: mta:Moth_1417 CoA enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67749"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV5"
FT                   /protein_id="ABI67749.1"
FT                   /translation="MIVIGIDIGSVAAKGYIISSGNHHRAMIPTGWSPREAGQAIIDQL
FT                   LEASGLERNQVEQIYVTGYGRVAFEHADKTVTEIKCHARGVAELYPEIRTIIDIGGQDS
FT                   KVISTGEKGQVLDFAMNDKCAAGTGRFLQVMATALGLDVSELGDAEDPGQMQTISSMCT
FT                   VFAESEIIGSLARGNPKGGIIAGLHQSVGKRVAAMARRMGIREQVAFTGGVAINPGVKR
FT                   ALEEEIGTRIIVPEACQYTGALGAALLAWETLRRDL"
FT   gene            487889..489163
FT                   /locus_tag="Swol_0412"
FT   CDS_pept        487889..489163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0412"
FT                   /product="(R)-2-hydroxyglutaryl-CoA dehydratase, beta
FT                   subunit, putative"
FT                   /note="KEGG: tde:TDE0389 (R)-2-hydroxyglutaryl-CoA
FT                   dehydratase, beta subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67750"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV4"
FT                   /protein_id="ABI67750.1"
FT                   /translation="MADYQQMWANLGMDLEKHDVLCEVLPEAFGGVYLTQQDRPKGMDF
FT                   YDFVVSEIHGVRPAEMLQHQKEGGKVFGTFCVYVPDEVVFAAGGIAAGLCGGSQFWVSG
FT                   GEKVLPANTCPLIKASVGARLDKTCPFFLIPDMYVAENTCDGKKKAWEILAGEVPMHII
FT                   DIPQMKRERDVAAFAAEIRDFIGVVEKVTGKKINAESLGEAIKLINNKRRALQRVYNAR
FT                   KASPVPISGKDALLVTQINFYDDPARAAQMANNLADELEQRINNGTGVFPENAPRIMIS
FT                   GTPMAIPNWKLHHIVESLGAAIVVEESCTGTRYFENLVDETASTLDEQIRALAERYMKT
FT                   NCACFTPNSARIDDIIRLADEYKVDGIIDTNLQFCNLYSTESYLIKQVMTERNLPIIHI
FT                   ETDYSEQDFEQLRTRVEAFLEMLRK"
FT   gene            489901..491052
FT                   /locus_tag="Swol_0413"
FT   CDS_pept        489901..491052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0413"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="KEGG: fnu:FN1899 hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67751"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV3"
FT                   /protein_id="ABI67751.1"
FT                   /translation="MKKTISLLVVILLMTTLMTGCTKQTTTTDKEVKEVADYKIGVVTP
FT                   TLSTSEDEFRAADQMAKKYPDIVKHITLPENFSTEIETGLSQITSLADDPKMKAIIVIS
FT                   GQAGLLPALQKVEEKRPEIITMTAPIWDDPALMSKYVDINLDTDWVRRGITIAQKAHEI
FT                   GDKTMIHYSFPTHLAKEVISQRKDAMEKTCKELGMQWVEVVTPDPQTGNGTGPMLQFLR
FT                   EDIPRQIAKYGPDTNIFGTNCPMYDVIIDEAFKLKYTVVEQCCPTPLQAYPTVLGLQIS
FT                   EADAWNFSKVNSMISEKAAAAGMTGRLGGWQVPATVFMPQFAVELAKKVIEDPSFNYKD
FT                   VNKLNQFAKEVMGSEVSFSKFKAKADSPELDNYFVMIMKTILY"
FT   sig_peptide     489901..489972
FT                   /locus_tag="Swol_0413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.733 at
FT                   residue 24"
FT   gene            491155..492741
FT                   /locus_tag="Swol_0414"
FT   CDS_pept        491155..492741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0414"
FT                   /product="sugar transport ATP-binding protein"
FT                   /note="KEGG: fnu:FN1898 sugar transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67752"
FT                   /db_xref="GOA:Q0AZV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV2"
FT                   /protein_id="ABI67752.1"
FT                   /translation="MENILEIVNLNKSYNGIPALSNINLSVKAGEIHGIVGANGSGKTT
FT                   LMNILFGNPIIHETGGYQGQIFFKGNRVNFKNCAEAIRQGIGMVHQEFALIPDMTVGEN
FT                   IKLGRENTHSLTDRLFGRKYSFIDWKQDYENAWQTLKRLGISVAVGIKIMDLSVNIRQF
FT                   IEIAREIDRSDLKLLILDEPTAVLNKNDGLKLIEILKDMSNSEIGIIFISHRLEEVQYV
FT                   CDKVSVLRDGKLVSQYAKGNIYVNDLAQDMIGHTINKAAAEKREIKNKPLITFKDFSVE
FT                   MPGEEVKNLNLSVYKGEILGLTSLSGHGKLALGYGMMDMYPVDGEVYYENKKIVKMNAR
FT                   TNIIKGMYVLPDDRQGLGILADQSLESNIVFTGNQIKNMFIRNSAFNFLGFIDHHKTNL
FT                   HVYKMMLDLDIKCTSIKQKVKELSGGNQQKVCIARALTVDPKLLFVAEPTRGIDISAKE
FT                   KILNMLIEINRTRNTTIIIASSELDELKRVCDRIAVMVEGKIFKILSPDSPDVDFGLVL
FT                   SGEEEVDCEKL"
FT   gene            492728..493759
FT                   /locus_tag="Swol_0415"
FT   CDS_pept        492728..493759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0415"
FT                   /product="ABC transporter integral membrane protein"
FT                   /note="KEGG: fnu:FN1897 ABC transporter integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67753"
FT                   /db_xref="GOA:Q0AZV1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV1"
FT                   /protein_id="ABI67753.1"
FT                   /translation="MKNYRLKPPQIIISAFLILLIALSYILHMDLVVLLNQSMVKLVMN
FT                   GVLVLSLIPMLNVGAGMNFGLPVGIIGGLVGMCLAVNFRMTGFYGFFMSILFTLMICTL
FT                   LGWIYGLILNRVKGREEIAGTFIGFSFIPLMNYFWTLAPFQNREMLYPIGGQGLRPKIS
FT                   LENYFNHILDNFGLISIGNIEIPVGLIFVYAIICLFLYLYFRTKIGRATIAVGENEAFA
FT                   KLSGINISQTRLIAIIISTIIAGFGICIYAQSYGFIQLYDEPLSMAFPAVSAILIGGST
FT                   GKKTFIFEAILGTYLLQSMYLLSVPIANEILVPELTEILRSFITYGIILYALLVRERRG
FT                   INS"
FT   gene            493801..494817
FT                   /locus_tag="Swol_0416"
FT   CDS_pept        493801..494817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0416"
FT                   /product="ABC transporter integral membrane protein"
FT                   /note="KEGG: fnu:FN1896 ABC transporter integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67754"
FT                   /db_xref="GOA:Q0AZV0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZV0"
FT                   /protein_id="ABI67754.1"
FT                   /translation="MVPAIFIILSYFAWQFSGLTGSFVFNQVVTRFIRDGILVLSLIIP
FT                   VVAGMGLNFAITVGAMAIQTALLIVIGYQVEGIKGILLAIIIGVFLSLVLGYVIGRILN
FT                   RVKGKEMITTIIIGFLFNSIYQLIFLVGFGTVIPVANKEIILTRGIGVRNTVDLGMYRN
FT                   TIDKFGLFKIGELEIPLFMIIVVLLFAAIIFYILHTRFGQEVKAVGSDRQTSEILGINT
FT                   NMIRIKVMILSTILAAFGQLAYLQNIGMFDVYTAHMNADIISCAALLAGGASIKKAKIR
FT                   HALMGIFLFHTLFIVSPQAGQNLFNNAALGEYFRSFVAYGTIALALILNIKNENKFS"
FT   gene            495252..496325
FT                   /locus_tag="Swol_0417"
FT   CDS_pept        495252..496325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0417"
FT                   /product="Uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: mmp:MMP0830 uroporphyrinogen decarboxylase
FT                   (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67755"
FT                   /db_xref="GOA:Q0AZU9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU9"
FT                   /protein_id="ABI67755.1"
FT                   /translation="MNAVPKDEMTPLERMAAFAAGKPYDRIPCSSFSGETACHFIGTTV
FT                   SEYRHSAKLMARVETVTYKMFGHDGAGVGPGFLALAEAMGTELKYPEDNIPFVANPVLK
FT                   NWDDFDKLEPADPHKDGKLPIYLEALAMIKDAIGDEVPIGSSVGGPFTTAALVRGTENF
FT                   LKDLRRNPEMAHRLLQLVTNTTLNYIDAVMDMGCSVSIGDPTASGSLLSVKQFREFAKP
FT                   YLSKLADRVIERTGKGPMLHICGDSTPIWSDMADTGAPTLSLDNVIDLAEAKKVVGERV
FT                   CIMGNVKPIDTIMKGSHQQIEAEVKECLRKAYDSPKGFILAVGCQVPLGTTADNFMCFM
FT                   NAARKYGRYPLNPDNFI"
FT   gene            496347..497009
FT                   /locus_tag="Swol_0418"
FT   CDS_pept        496347..497009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0418"
FT                   /product="dimethylamine corrinoid protein"
FT                   /note="KEGG: mmp:MMP0829 coenzyme
FT                   B12-binding:cobalamin-dependent methionine synthase,
FT                   B12-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67756"
FT                   /db_xref="GOA:Q0AZU8"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU8"
FT                   /protein_id="ABI67756.1"
FT                   /translation="MADQQIILDRLAEGVREMDEDLTLEASHEALDNHVDALTAINQGL
FT                   VVGMNQAGSLYEQEEYFVPELLLCSDAMYTGLDILSPHIQRTSAEDKHKVVIGVVEGDT
FT                   HDIGKNLVKLMLEVADFEIYDLGRDVPPADFISKVKEVGADIVCLSTLMSTTMDRMVDV
FT                   IELLKKEGLREKVLVMIGGGPISQAFADRIGADAYSENAIAAVADAKRLIALKKVAV"
FT   gene            497010..498056
FT                   /locus_tag="Swol_0419"
FT   CDS_pept        497010..498056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0419"
FT                   /product="uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="KEGG: mmp:MMP0831 uroporphyrinogen decarboxylase
FT                   (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67757"
FT                   /db_xref="GOA:Q0AZU7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006360"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU7"
FT                   /protein_id="ABI67757.1"
FT                   /translation="MITPQDRLIKALNGQVIDRSPCICPGGMMNMATTEIMQRVGSHWP
FT                   EAHKKPQDMARLALGVCHLTGMENLGVPFCMTVEAEAMGAKVNLGSLANEPRVAEYPLM
FT                   KLEDWETLSGINPGEGRAGIVAEAVSYLTSSKTELPVIANLTGPISLASSLIEPMVFFK
FT                   AMGKKPELVHEFLYFVTDNLIVFGRSMLQAGAQIINIADPGGTEEILGPRHFAEFALPY
FT                   INRILNELQGEYQASMVHICGRLQSIFTEINQLATNAISIDSTTSISKLRSALREKVVV
FT                   GNISTYLLQNAQPGRVKATGFNCLRKGITILSPACGISPATPLANLQAMVSAVHDFDYQ
FT                   NREVSSLG"
FT   gene            498049..499881
FT                   /locus_tag="Swol_0420"
FT   CDS_pept        498049..499881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67758"
FT                   /db_xref="GOA:Q0AZU6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU6"
FT                   /protein_id="ABI67758.1"
FT                   /translation="MGEQHDGLSGVHVVCSSNGEIQLLMDLLDDTGIELESSCAGNGTC
FT                   GKCRVLIISGECLPPGTAEMELLSPKDFKRGIRLACHCLVRGEVELSVENAAQDLRVLE
FT                   KGMLTDFKIEAEISKYQLISTGNEQELSLIEQILQQLNIEQSVPDSLDILRLIAQFKPD
FT                   DTTAIVVGNKLIGLEHGDTTAHCYGVAVDIGTTTVVASLHKLDDGSELAVASALNPQTQ
FT                   YGLDVLGRIQYAGKGSNNLDKLNGLIINCLNGLISELCRRSGIDSQYIYKITVAANTVM
FT                   LHLLLGVSPVSIGRAPYHPVFRQGQVLAADNLSLMASPFASLYCLPSVSGFVGADIVAG
FT                   IIASDLDGAEEIVLFLDLGTNGEIVLSRDGKLIACSTAAGPALEGMNIACGMRAARGAV
FT                   EEVWIEDKSVLWRTIDNAPPLGLCGSGLIDLVAVMLECGLLNSSGRITARNKFAGVYPH
FT                   NPLAGQIDDIAGKRRFWLIPSLDNCPNGIFVSQADIRQVQLAKSAIVTGIKTMMTENGL
FT                   DEIHVNKVYVAGAFGTYLKPSSLIRLGFFPESWHDRITFVGNTSKAGAVMALLSSSTRC
FT                   RMEETAQKVNYVELESCPGFEKMFVENMRFPGKE"
FT   gene            499903..500826
FT                   /locus_tag="Swol_0421"
FT   CDS_pept        499903..500826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67759"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU5"
FT                   /protein_id="ABI67759.1"
FT                   /translation="MTQVHIVSGFLGAGKTTLLLKLLAFVEGNKVIIENEFGEVGIDGD
FT                   VLQRANYDVVEMVQGCICCSMRANFEAMLLSVIEDYHPEHIFIEPTGIGMLSQITALFK
FT                   RKDIADRCSLTMPIVVVDALDYLMLVEDFGLFYKDQIAHAGIIVLSKIQLMREDNLDVI
FT                   IKSLRSINPQADIMARDWEQFSELDYWELTNTEFDPEKTIRIRGAIGVLSGNLQSYSLT
FT                   APRRINRENLQYILDNLQNKQLGRIVRAKGFVEGDDGPLEFNYVNGRYTINDNSLGNSS
FT                   RVCIIGSNLNRDMLSVIWSGDGVGVL"
FT   gene            500823..501704
FT                   /locus_tag="Swol_0422"
FT   CDS_pept        500823..501704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0422"
FT                   /product="uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="KEGG: mmp:MMP0834 uroporphyrinogen decarboxylase
FT                   (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67760"
FT                   /db_xref="GOA:Q0AZU4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU4"
FT                   /protein_id="ABI67760.1"
FT                   /translation="MSVSGINFVCAGRDELEIPREIVEQGGFHFPDLHSDSQEMARLAL
FT                   AIKHNKQNSICMLPFCLTVEAEALGARVNLGNASSGPRISSYSYESIEQLKDLRMVDFN
FT                   SGRIKSVLDAVETLTQSGEVVALNVSGPFTIITSLFDPMVLYKAVKKNREGIDDVLRII
FT                   EGIILRYILEAIKMGARIISYADAVGTADMVGPKIYKDIAGIASLNLLKRLQTSDELDG
FT                   CFVHICGKTSVSLENHGFARSYPIEVSSNQTYGQAITELLYKSQGSRFIGHNCMKRTVN
FT                   KLKDNTVWRIEF"
FT   gene            complement(501783..502841)
FT                   /locus_tag="Swol_0423"
FT   CDS_pept        complement(501783..502841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0423"
FT                   /product="putative sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: ret:RHE_PE00289 probable sugar ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67761"
FT                   /db_xref="GOA:Q0AZU3"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU3"
FT                   /protein_id="ABI67761.1"
FT                   /translation="MGIMKKSRFFIAVLLIWAMSLSVFGCSKEDSATTGDAKKAETGEK
FT                   APATKGKIAFVTFATGVPYFEIGAAGAKQAGQALGYEVVYKGPAKADSAAEIQIINDLV
FT                   TQGEVKAIVVACMDSKSIIPALKKAREADIKVVTWDLDCEPEGRDCYAGLMDLVVMGNE
FT                   WIESMVRSVGDEGEYAIVMATLTNEFMNKRIDNMKKYAAEKYPKLKLVAVESCDADPQK
FT                   AYQISKDLLTKYPNLKCIATSSTEAFSSAAKAIEDDGKIGQVYVVGGLTPNLAKPAFKS
FT                   GAAKEAVLWDPGKWAGFGVTIATQLIEGKTFDKVGKVEITGFPKAELFAPGILYYHELL
FT                   TFTPENVDRYDF"
FT   sig_peptide     complement(502764..502841)
FT                   /locus_tag="Swol_0423"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.961 at
FT                   residue 26"
FT   gene            complement(502942..503871)
FT                   /locus_tag="Swol_0424"
FT   CDS_pept        complement(502942..503871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0424"
FT                   /product="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="KEGG: tte:TTE0764
FT                   Ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67762"
FT                   /db_xref="GOA:Q0AZU2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU2"
FT                   /protein_id="ABI67762.1"
FT                   /translation="MVSKNQNNEITLLFILIVLVIIFSTFSEGFFKIGNMLEISAQMVE
FT                   LSLLTLGMSVCIISGGFDLSIGAMVGLSSVCLAILISSGMNMGLTIALVFGLLLFCGLI
FT                   NGILVGYLRINSMLVTLGTSSVYMGIAIVISQGRAISGLTQEFAVFGQHYLGIIPVQTI
FT                   ILIVVAAFSLLILSYSTWGRRIYLIGSNYEVARFAGINCGFNIMLVYVYSAAMAFLASL
FT                   ILTSRLATGRADFGETYILQSVAAAVFGGIGINGGSGNLFGAILGVAVFAIISNGFNML
FT                   DFSQYAQQIVIGLILIVFLAYRAQHNQV"
FT   sig_peptide     complement(503788..503871)
FT                   /locus_tag="Swol_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.823) with cleavage site probability 0.776 at
FT                   residue 28"
FT   gene            complement(503900..504853)
FT                   /locus_tag="Swol_0425"
FT   CDS_pept        complement(503900..504853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0425"
FT                   /product="putative sugar ABC transporter, permease protein"
FT                   /note="KEGG: eca:ECA1461 putative sugar ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67763"
FT                   /db_xref="GOA:Q0AZU1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU1"
FT                   /protein_id="ABI67763.1"
FT                   /translation="MAANNNLFSKRDLYLIFTIVILGLFISYNAPEFMQQKNLSNILGN
FT                   NSVYGIMAIGMTLILVTGNIDISVGAVFAITGIIAANFANYADIAGITTPLPVFAVSML
FT                   AGAVLGFINGYLVAKIKLPAIIITLGNMSIMRGLLLLLTGGAWVSSMPGWLTTLARSKY
FT                   LGLYASTYLWLFTALLIFILLKCTVLGRNILAVGGNPTAAQRIGINLKKVYVFIFSVFG
FT                   ALTGLASTIYIANLGCAQPVAGMGYELTLIAASIIGGASIFGGKASILGTCLGVILLGI
FT                   IANAMVLAHIPIYWQSLVTGLVIILAILFSYREERI"
FT   gene            complement(504858..506354)
FT                   /locus_tag="Swol_0426"
FT   CDS_pept        complement(504858..506354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0426"
FT                   /product="ABC-type sugar (aldose) transport system, ATPase
FT                   component"
FT                   /note="KEGG: tte:TTE0763 ABC-type sugar (aldose) transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67764"
FT                   /db_xref="GOA:Q0AZU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZU0"
FT                   /protein_id="ABI67764.1"
FT                   /translation="MQESREFILEIAQLNKTYSGNRVLNNINFDLKLGEVHALVGENGA
FT                   GKSTLIKIIAGVEKPDPGAEILFGGCPAINLNPSKSVQMGISVIYQDISLFPNLSVAEN
FT                   ICIGGQKGLFIKWKQVFETARSALIKLGAIDIDPHVPLGEISIGQRQMVALARALTHEA
FT                   RVIIMDEPTSSLSANEIKALYSAIQILKNENKSLIYISHKFEEVFEVADRISVLRDGEM
FT                   IASKAAWEFDEQSLISMMVGREIRFLPMRNDGVAGKKLLEVRGLTKEPLFRNISFSLYE
FT                   NEILGITGLVGAGRSEMAQTLFGLEKADKGRIFMGEKELSIKSAVDAIKSGICYLPEDR
FT                   RGQGIFLIQSMARNITTAKLESILNRCRLLSRPKEMAVSEYYMDRLNIKPRLPDISADK
FT                   MSGGNQQKLLFSRWLNARPQILIADEPSSGIDVATKAEIHGLLRELAASGVGVILISSD
FT                   LPETLAVCDRILVMRNGNIVDQTSSKESSQEELIRKGLMG"
FT   gene            complement(506740..507888)
FT                   /locus_tag="Swol_0427"
FT   CDS_pept        complement(506740..507888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0427"
FT                   /product="(R)-2-hydroxyglutaryl-CoA dehydratase, beta
FT                   subunit, putative"
FT                   /note="KEGG: tde:TDE0392 (R)-2-hydroxyglutaryl-CoA
FT                   dehydratase, beta subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67765"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT9"
FT                   /protein_id="ABI67765.1"
FT                   /translation="MLNLPENFKSYSEARQEGFIRLKGLKESGKKVVGVFCSYTPTELI
FT                   LAADAVPVGLCGASEDPISYAEKTLPKNLCPLIKSSYGFAASDTCPYFYFSDLVVGETT
FT                   CDGKKKMFEWMNEIKPTHVMQLPPGRTSGTALATWHSEMQRLKDVLSRTLQVEITDDDL
FT                   RQAIHLKNRERKAILDFYDIGSLKPTPLSGYEINTLIDNNTFLFDTEEKIAILEKRTAE
FT                   LLEDYEKNFKGKPSRPRILITGCPTGGVREKIIRRIEELGANIVGFENCSGPREQKDLV
FT                   DENKDPLLALAEKYLRVNCSVMSPNPQRIEAMDEMIENYQVDGVIEVILQACHTFAIES
FT                   SRIKKFVTEQKHLPYLCLETDYSQGDTGQIDTRISAFLEILA"
FT   gene            complement(507903..508673)
FT                   /locus_tag="Swol_0428"
FT   CDS_pept        complement(507903..508673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0428"
FT                   /product="(R)-hydroxyglutaryl-CoA dehydratase activator"
FT                   /note="KEGG: tde:TDE0387 (R)-hydroxyglutaryl-CoA
FT                   dehydratase activator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67766"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT8"
FT                   /protein_id="ABI67766.1"
FT                   /translation="MNYVGIDIGSTAAKTIVFNGEKVIASFVMPTGWSSKETAVRIKGQ
FT                   LESLGFNVESADIKTIATGYGRISVEYADMVLTEITCHGKGGYHLFSQDGVIIDVGGQD
FT                   TKVITIKHGTVSNFLMNDKCSAGTGKFIEIMANRLAVDIDELFSLAEGGTPIPISSMCT
FT                   VFAESEIISHIGAGQPKTDLAAGIVQSVVSRVALLVERHDIKGICILTGGLSHNQYFRK
FT                   QLGEKLRREIHTHDLGKYAGALGAALIAADKFKH"
FT   gene            509123..509482
FT                   /locus_tag="Swol_0429"
FT   CDS_pept        509123..509482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0429"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="KEGG: dsy:DSY1088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67767"
FT                   /db_xref="GOA:Q0AZT7"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT7"
FT                   /protein_id="ABI67767.1"
FT                   /translation="MEIKLFDSELRIMDVLWREGDTTAKKISDILNKQVGWNVNTTYTL
FT                   IKRCIAKGAIKRSEPNFMCHALIAKEKVQEQETTELINKVFDGSADLLFASLLSRKNLS
FT                   PEEIERLKQIVNNLK"
FT   gene            510188..511000
FT                   /locus_tag="Swol_0430"
FT   CDS_pept        510188..511000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0430"
FT                   /product="transposase"
FT                   /note="KEGG: gka:GK3441 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67768"
FT                   /db_xref="GOA:Q0AV82"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AV82"
FT                   /protein_id="ABI67768.1"
FT                   /translation="MCKFYNVSRRGFYDFRKRQQGENPDQELINLISECHKKHKRRYGY
FT                   RRLTLWLKQEKNLVVNKKKVLRITSRNNLLSAIRRRKVTKFKPNGNLKYENVLNREFYS
FT                   EIPNEKWVTDISYIIMPDGTAYLSAIRDLCGNFIVAYRTAKKQDYSIVKNTISNAIQAE
FT                   KPQKPPLLHSDGGGQYRSFDYREQTTEHGITPSMSKPSTPGDNACAENFFSIFKTECIY
FT                   LEKPKTLDEALKLTDEFVHYYNYERIQGNGLTPYEERQIAFVKQKADI"
FT   gene            511222..512550
FT                   /locus_tag="Swol_0431"
FT   CDS_pept        511222..512550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0431"
FT                   /product="Antirepressor regulating drug resistance
FT                   predicted signal transduction N-terminal membrane
FT                   component-like protein"
FT                   /note="KEGG: dsy:DSY1015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67769"
FT                   /db_xref="GOA:Q0AZT5"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT5"
FT                   /protein_id="ABI67769.1"
FT                   /translation="MHFICAELWGQYLEIVDMGKHAATGASTISMFMSPLISIWIAGIC
FT                   ICTIFFLLSYIKCRREFQTALPVENDFINRWQQRHSLRRTVQIRQSDRIKAPLTYGVWH
FT                   PVVLLPKAIDWTDETTMQYILTHEYVHIRRFDALAKLLITSAVCIHWFNPLVWAMYMLA
FT                   NRDIELTCDESVVRAFGDTAKSTYALALIGLEEKKSRLIPLFNNFSKNAIEERIIAIMK
FT                   IKKYSLPVIIVAVLLIAGVTVGFACSKATVGQNSYLTEKSEELNPASPSPVSEKTPVNN
FT                   GETIAEPASNNDGNSSSSEIRKVYYSDGQHKTEIDGVPVYPVHCVVIGKYYYKRIDRET
FT                   GKNQVSFDDGSTWLSTRNNPESKKIEVSADGVTWKDLIATIQEPKYSEFCNHKYFYMRS
FT                   DPDTGQEMASYDDGVTWLFYHENVITGRAEISSDGVKWREWIR"
FT   gene            complement(512815..513069)
FT                   /locus_tag="Swol_0432"
FT   CDS_pept        complement(512815..513069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE0713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67770"
FT                   /db_xref="GOA:Q0AZT4"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT4"
FT                   /protein_id="ABI67770.1"
FT                   /translation="MNKVFTHTAWEEYQYWQKENRKMTSRINELIRDIERNGNTGIGKP
FT                   EALRHELSGYWSRRINNEHRLIYSIEGKNINIISCRRHY"
FT   gene            complement(513062..513316)
FT                   /locus_tag="Swol_0433"
FT   CDS_pept        complement(513062..513316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0433"
FT                   /product="prevent-host-death protein"
FT                   /note="KEGG: pfo:Pfl_4634 prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67771"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT3"
FT                   /protein_id="ABI67771.1"
FT                   /translation="MMAVNYSTLRENLKKYCDAANQDLEPIIVTRKNGGNVVLISESEY
FT                   NNLLENLYIRSDPEYYNKLLKSIEELKSGKTLRSELADE"
FT   gene            complement(513349..513642)
FT                   /locus_tag="Swol_0434"
FT   CDS_pept        complement(513349..513642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT2"
FT                   /protein_id="ABI67772.1"
FT                   /translation="MEFRPNTYPPIGVYDARICLGGGFGPLAKTQCAILCLKHQKKLRS
FT                   SFNTPLQQGGGIEPTACFVNRRPLSGGHISPRYKKSDKREVSNIHWIDREHD"
FT   gene            513862..514485
FT                   /locus_tag="Swol_0435"
FT   CDS_pept        513862..514485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0435"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="KEGG: chy:CHY_1603 3-hydroxybutyryl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67773"
FT                   /db_xref="GOA:Q0AZT1"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT1"
FT                   /protein_id="ABI67773.1"
FT                   /translation="MEIKKIGVLGAGTMGAGIAQVAAEAGFSVILVDIETAIIEKALKG
FT                   IKKAWKKAVEKGKLDEGEMQKREGNLATGSSMADFKDCDVVIEAIVEKIEVKKVVFKEL
FT                   DGICPEHTILASNTSALSITEIAAATGRPDRVVGMHFFNPVPVMKLVEVIPGAETSEAV
FT                   SSAIVELCKKLKKEPVLAREFPGFIVNRILVPYITETCSENPAP"
FT   sig_peptide     513862..513927
FT                   /locus_tag="Swol_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.451 at
FT                   residue 22"
FT   gene            514604..515944
FT                   /locus_tag="Swol_0436"
FT   CDS_pept        514604..515944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0436"
FT                   /product="4-hydroxybutyrate coenzyme A transferase"
FT                   /note="KEGG: pca:Pcar_2447 4-hydroxybutyrate coenzyme A
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67774"
FT                   /db_xref="GOA:Q0AZT0"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZT0"
FT                   /protein_id="ABI67774.1"
FT                   /translation="MNYVNEYRKKLVSADEAVKVVNSGDWIDYGSMCGQVVMLDEALAR
FT                   RKEELKDVKIWTLLTLRRPRVMDVDPEEESFVWHSWHLSAMDRKIASERAVYYSPIRYS
FT                   ELPRYVREHIEPLAVAMLQVAPMDKHGYFNFGPQNSHTRAVCERARIVIVEVNNQLPRC
FT                   LGGYEESIHISEVDYIVEGNNPPLPQLPDAASSEVDKKAAELIIEEMKDECCVQLGIGG
FT                   MPNAVGKMIAESDLKDLGCHTEMLVDAYVHMYEAGRLTGRKKNIDPGKMVYDFAVGSQR
FT                   LYDFIDNNPLCASYPVNYTNRPSIAALNDNLITINNAIEVDLYGQVCAESVGTRIISGT
FT                   GGQLDFVLAAYESRGGKSFVCLPSCSEREGKLKSKIVPTLKPGAIVTDPRSVAHYIVTE
FT                   YGKFAMKGMSVWQRAEGLINLAHPQLRDELIQAAQAQGIWRRSNKIS"
FT   gene            516278..517639
FT                   /locus_tag="Swol_0437"
FT   CDS_pept        516278..517639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67775"
FT                   /db_xref="GOA:Q0AZS9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS9"
FT                   /protein_id="ABI67775.1"
FT                   /translation="MNIGSVLEGLFTQNQFMAAIIVDNKGIVLSVSETYLQVLNLTKEE
FT                   VVGKPIKEVTPHTRVFTILATGKAMVGYNWKVNGHNMIASTIPIIKDGETVGAFAYSVF
FT                   PDIWDAKNLVENLLSELNMYRDEVDSLYTAKYTFDDIVSKDKGMEMLKSFARQIANHPF
FT                   TTVLITGESGTGKDLFANAIHNASPRSRFPFLRINCAAIPENLLEAELFGYEEGAYTGA
FT                   KKGGKPGKFELAHGGTIFLDEIGEMSLSMQSKLLIVLQEQEIERLGGSFPIKIKVRVIA
FT                   ATNRSLEQLIQEKKFREDLYYRLNVVRLEVPPLRQRKQDIPVLIRHFIDKLNPRLRTMI
FT                   ANISPKSLKLLEQYHWPGNVREMENMLERAIIMADMENGRSLDCRHFKFLQNRCSSEAP
FT                   LELQSLKVASQKFEEELIARALETSNFNLAKAAEQLEIDLSTLYKKIKKYGIET"
FT   gene            complement(518101..519087)
FT                   /locus_tag="Swol_0438"
FT   CDS_pept        complement(518101..519087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67776"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS8"
FT                   /protein_id="ABI67776.1"
FT                   /translation="MIEELLPGIFCLQVPLPRNPLRALNAYLIKGQDRHLLIDTGFDWP
FT                   ECKKALLTGLNSLGVTISQVDFFITHVHGDHSGLVCDLLTGDSKVYASETDAEILRKTT
FT                   TREYWQEIDALFEMNGFPRNKSKNQGSRIKGYISGSEMDITYVREGQLLEIGPYRLRCI
FT                   MTPGHTPGHVCLYEPEHKFFISGDHILGDISPNITAWPEMEDALGSYLDNLEKVEKMDI
FT                   TLILPGHRSLIYHHRQRIAELRKHHEARLQEVRDILKKGAMSAYQVASFMSWDLDYKSW
FT                   EDFPMFQRWFATGEAVAHLEHLLHLKQVQVNKGEVFLFSYPSDLRQP"
FT   gene            complement(519186..519443)
FT                   /pseudo
FT                   /locus_tag="Swol_0439"
FT   gene            519639..522314
FT                   /locus_tag="Swol_0440"
FT   CDS_pept        519639..522314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0440"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="KEGG: sth:STH768 putative class-III
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67777"
FT                   /db_xref="GOA:Q0AZS7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS7"
FT                   /protein_id="ABI67777.1"
FT                   /translation="MNQRKDLLNPTLYKIFQSFQLDKNYLSGEGSYLVDEKGISYLDFI
FT                   AQFGAIPFGYNPDFIWDKLEEIRSKALPSLVQPSLPGEALKLANALAAVSPGKLAYCTF
FT                   CQSGTEAVEAAIKLARSTTGREIVLSTFNSFHGKSLGSLSATGKVSYQSPFRAPAPGFI
FT                   YIPYDDIAALQAVLDEQSDRIAAFIVEPVQGEGGIIVPRPGYLKAAEQLCRQYGVLFIV
FT                   DEIQTGLGRSGALFACEHEKVEPDIMLLAKALGGGIFPLGVCLSSEGVWNDDFGFLHSS
FT                   TFANNNVSCAVGLAVLDKLLEDDRRIIKEVAAKGEYLLGKLQELAAKYPEVIKEVRGKG
FT                   LMLALEFQDLDDCGSYDMSFMVDQGAFTTILAGFLLNVFKIRLAPYLNNSMTLRLEPSL
FT                   NIGREEMDYVLAALDKLCQILKYRDYALLYGYLLGDYSPPARITDYRAVSRPVKASPLS
FT                   PEEKISHKFAFIIHYPAPEDVIANNPSFNTFERPDLYHFLEWQSSFREAGVCCHMPALR
FT                   SHTGAVVEGWLIGVPFGAREMMNLPREETLGVIKKAVELGRELGAEIVGLGALTSVVSR
FT                   GGRALTGQGVAITSGNSFTTLMAMEALLAGARKMRIDFTIARGAVLGATGSIGRACALL
FT                   LSQDITNIVLLGNPRHPRSSRNRLNSLTLEILVLAYQRRSQGIITGLSEWLDGLINSYR
FT                   KKDELRSLELEKALSQADGSSLELIKGVCREMAMEFPLEISMDLDASLPQCDMIVAASN
FT                   SPEFIVYPRHLQPGAVVCDVARPADVAPEVRERDDVLVLEGGLVSYPEPVAFGPNLGYR
FT                   DGVNLGCLSETILLALEGDCRDFSIGSRLSLDTIEYLRRLGEKHGFTLAGLMTGNREIG
FT                   DKEIEEIYRKSLSFKQANNL"
FT   gene            522347..522832
FT                   /locus_tag="Swol_0441"
FT   CDS_pept        522347..522832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_1645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67778"
FT                   /db_xref="InterPro:IPR010707"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS6"
FT                   /protein_id="ABI67778.1"
FT                   /translation="MPGAEENNIINCNEGLSKGGAGLDLKEIVIRKNGKWYFGQAEMFR
FT                   RNILNILAAHIQKEDGDYVIRLGNDVNPITVEDCPFLAMGYIEEEDGTIKLRFHDLQEM
FT                   KLDHELKITFKGDVPYIDFKWEADTRLSRGVYWKLSNYFDFRGDEVYIVPPGARLEQ"
FT   gene            522832..523707
FT                   /locus_tag="Swol_0442"
FT   CDS_pept        522832..523707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0442"
FT                   /product="DegV family protein"
FT                   /note="KEGG: chy:CHY_2418 DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67779"
FT                   /db_xref="GOA:Q0AZS5"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS5"
FT                   /protein_id="ABI67779.1"
FT                   /translation="MPVTAGRSGAAVGIKIITDTSCDLPQEVLEQYNIEMIPLKVTFAN
FT                   GETYLDRFEICPRTFVEKMSSSATLPKTSAPDPHTFVKYFEQGIRETGAVIFVSLSSGL
FT                   SSTSQIAQMACNMMNSSKVKVFDSLTASLGTGIMAIRAAQMAARGMSLEAVLEKLAAIR
FT                   ATREVIFVLDTLENVVKGGRLSKFEGMAGTILNIKPILRGNQLGIPEIVEKVRGRKKAM
FT                   KRLVAMVGELAGASLLHRIVGISHVNCLEDADKLAWEINSQYQQEAVLISDMSATIGTY
FT                   AGEGGLMINF"
FT   gene            complement(523704..524579)
FT                   /locus_tag="Swol_0443"
FT   CDS_pept        complement(523704..524579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0443"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase, putative"
FT                   /note="KEGG: afu:AF1311 oxygen-independent
FT                   coproporphyrinogen III oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67780"
FT                   /db_xref="GOA:Q0AZS4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS4"
FT                   /protein_id="ABI67780.1"
FT                   /translation="MRYEGMVYRPPSEAQSLIIQATIGCPHNRCTFCSLYKNTKFRIRP
FT                   VEEIKEDLRMARDYYGEYIESVFFADGNTIIMKTEQLLDIFEYTRSLFPYLERITVYGS
FT                   SRFVNKKSLEDLKRLRAAGLKRIHTGMESGDDIILERIKKGTNSQEIISAGLKLKEAGI
FT                   SVSEYYLVGIGGKERSREHALNSALTLSAFSPDFIRLRTYVPMPNTPLYDDYQNGVFAL
FT                   LSPHEALREVRLLIENLNCDNSQLLSDHINNYWNVYGILPQDKDKMLAEIDRALAIDES
FT                   RFRRPEQGRL"
FT   gene            524930..525718
FT                   /locus_tag="Swol_0444"
FT   CDS_pept        524930..525718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0444"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: mta:Moth_2172 transcriptional regulator,
FT                   LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67781"
FT                   /db_xref="GOA:Q0AZS3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS3"
FT                   /protein_id="ABI67781.1"
FT                   /translation="MPLRVLIVDDDERERIVLRYLLEQINELEIVGEALHGLEALMICQ
FT                   EKKVDLVFLDITMPEMGGLETAEKLRELKSPPLFAFVTVKKDMAVKAFEMGALDYIVKP
FT                   IEQKRIDKTIQRARFQIAHWTAIEDMVRNRVKDRIDFILETCKDMESYSNRLIVREKGK
FT                   ISLVNQPDIIYCESQGKKVQICTCRQNFMSNYTLNALENILDERYFFRAHQAFIVNVNY
FT                   IREVINLGEGSYILHLANCDKDIILSRAKARLLRNKMGIT"
FT   gene            526159..527367
FT                   /locus_tag="Swol_0445"
FT   CDS_pept        526159..527367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0445"
FT                   /product="Magnesium chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: sth:STH2441 putative chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67782"
FT                   /db_xref="GOA:Q0AZS2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS2"
FT                   /protein_id="ABI67782.1"
FT                   /translation="MIPFYKLERYEGNAPLFDLTMMSIVSTYVGEPLHVHAEGVRGTGK
FT                   TTIARAARGILPKIKRIKDCIYNCDPDNPHCPQHRDLTAAEIEALGVEEITMPFLEISQ
FT                   SAKVGTVAGSIDLARLTDPLHPEARLLPGLIPQAHRGIIFIDEINRLADTSPEITDILL
FT                   DVMGNKPGHIQIEEAGLPVVEIPVSVSVWAASNPDEEPGPLEEIRRQLSDRFDMVYYMG
FT                   RPDSVEAIARILKENSYAFKVSQAKKKYSTAEDEAQNDVYRQKILKWAENYRNADLPDY
FT                   LRNYISRLYIKHNLESIRATEAMQQGALLHSIIKGHDKVLISDVTDMIPLVLKHRVNGD
FT                   VLVRMLNDVDMKGAKEGILSFKSKKNKKDEETSPDYFQQVARPLKDMSRGELVNTEKTL
FT                   TPT"
FT   gene            527388..529166
FT                   /locus_tag="Swol_0446"
FT   CDS_pept        527388..529166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0446"
FT                   /product="Mg-chelatase subunit ChlD-like protein"
FT                   /note="KEGG: sth:STH2440 magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67783"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS1"
FT                   /protein_id="ABI67783.1"
FT                   /translation="MLGENTNVDKSASVGNYLNLYFGQNQGVRLGESSVVSLRGHARMP
FT                   EKRVKGQVKILLNRDAGKMYLDFVEANQVVHIDVFHQPGEIDPRDVARAIFWALDEHFL
FT                   EKDPQLQFAEDERVKMVTEYAKKIFITTSLGKGVIYELYQDQVKPFIEGEEGFDHVHVL
FT                   ARLDREEYYLVYVIAEAVEEVIISSGIKPVKVRNIIHGNQKQAEDSFAGYIKLPWKNFK
FT                   GQNAYKLPDKENVNQLILKLAEKFGGVDEIEEFMENYSTNIFKRKGVDQQKKKWGDVEH
FT                   YVEQLEELGLIKDTILGKVMTRKGLQLKDFVINHKCELETEIRRNMRKMPSGGNSRFRK
FT                   LGQVDQKQTQVEFTNRNKTVNNPDKNWSGDLAVPETIVQAMKNSFLRNDPHFTIKKEDL
FT                   HYYDKKSYVPIDVCLLIDASGSMAGDKRQAACFLAQNLLLSGKEKVAVVTFQERSSEVV
FT                   VPFTRNQNILNKGLSTISPAGLTPMADGIMTAVNLIKNNRVRNPLLVLISDGIPNIPLW
FT                   TLDAQADALEAATHIRENKIHFICIGLESNRFYLEKLSANAGGALYLVDDLNKDNLINI
FT                   VRHEKKNMLESGKKMA"
FT   gene            529408..529995
FT                   /locus_tag="Swol_0447"
FT   CDS_pept        529408..529995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0447"
FT                   /product="putative germination protein GerM"
FT                   /note="KEGG: chy:CHY_0305 putative germination protein
FT                   GerM"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67784"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZS0"
FT                   /protein_id="ABI67784.1"
FT                   /translation="MTSKVVSILAVILLVLCLLSGGCSSVAPEQNLKAWKDLIKLAPED
FT                   KSKTEVKKNPEELIPTREKGESINIKLYFAQADKEELVMERREITRTEGIARSTLQELL
FT                   KGPDNPAYRNVFPEGTRLLDINLKPDGTCILDFSSELRRLENEVEEKQMLDAVCQTLAQ
FT                   FPAVKQLVFMIDGREIDIIKGEVDFTSPIKVS"
FT   sig_peptide     529408..529485
FT                   /locus_tag="Swol_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.518 at
FT                   residue 26"
FT   gene            complement(530018..530500)
FT                   /pseudo
FT                   /locus_tag="Swol_0448"
FT   gene            530502..531305
FT                   /locus_tag="Swol_0449"
FT   CDS_pept        530502..531305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0449"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: mta:Moth_0518 glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67785"
FT                   /db_xref="GOA:Q0AZR9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR9"
FT                   /protein_id="ABI67785.1"
FT                   /translation="MGKNEPIGIFDSGVGGLTVVKSLMEKMPDESFIYFGDTAHVPYGN
FT                   KSEQQLFNYAHKIISFLISKQVKAIIVACGTHSSVTLPSVLQEYSLPMLGVVKAGARSA
FT                   ARLSRNGKIGVAATQATVNKKAYTREIQELEPDFQVYETACPRFVPLVEAGKLNNSESR
FT                   EAVAEYLGPLLAQGIDTLVLGCTHYPFLATAISEFAGEKLELVDTSCETIDELQEIFGA
FT                   QDLFNNSGKKPRHEFYVSGHDDSFFNVGRLLMGDIIKEIHKLDWD"
FT   gene            531316..532293
FT                   /locus_tag="Swol_0450"
FT   CDS_pept        531316..532293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67786"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR8"
FT                   /protein_id="ABI67786.1"
FT                   /translation="MSRVGFTTSIPVEVILAAGKTPVDLNNVFINSLSPQSMVDLAEEE
FT                   GYPRNCCGWIKGLYATSLNYDMEALIAVMHGDCSNTQALMETLQLRNKKIIPFAFPFDR
FT                   ERSQLEAQVDKLMQFFEVDMEEVLKARARLEKIRSLCRELDRMTWRDNLVTGQENHYYL
FT                   LCSSDFNGNPAEFEAELHSFVEEAGKRRPIQEEVRLAYIGVPPIFTDLHQLLELMGARV
FT                   VFNEVQRQFSMPVESSDIIEQYLHYTYPYGAFARLEDIEEQLAVRDVQGVIHYTQTFCF
FT                   RQIEDLIFRERLKIPFLTLEGDRPGKVDARSRMRLESFVSMLKK"
FT   gene            complement(532320..532527)
FT                   /pseudo
FT                   /locus_tag="Swol_0451"
FT   gene            532553..533308
FT                   /locus_tag="Swol_0452"
FT   CDS_pept        532553..533308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0452"
FT                   /product="putative CoA-substrate-specific enzyme activase"
FT                   /note="KEGG: chy:CHY_0311 putative CoA-substrate-specific
FT                   enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67787"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR7"
FT                   /protein_id="ABI67787.1"
FT                   /translation="MSVTGIDLGSRTVKIIEMDGQEIINHSLYDTVFFYRNCGRIADGE
FT                   MRVDLAGLGFSQERIIATGYGKISVKIAGAEQIPEIQAHVYGALWQSGLQDFTLLDIGG
FT                   QDTKVVQVRQGQMLDFLTNDRCAASSGRYLENMAAVLGMSLEELSSFSEEAVELNATCA
FT                   IFGETELIARIVEGHPVSHLAAGVNYSLYRRVSAMLNRLRSKNIILAGGGALNSALAKI
FT                   IVRETGSEVYQLPQPQYNGAIGCCAWAWR"
FT   gene            533390..534109
FT                   /locus_tag="Swol_0453"
FT   CDS_pept        533390..534109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0453"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: chy:CHY_0314 ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67788"
FT                   /db_xref="GOA:Q0AZR6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZR6"
FT                   /protein_id="ABI67788.1"
FT                   /translation="MERPQNRGNDQMRTVRIIPGFQKYPDGSVLIEAGDTRVMCSAMME
FT                   EKVPPFLRGKGSGWVTAEYSLLPSSTETRTQREASKGKISGRTSEIQRLIGRSLRAVVD
FT                   MPAMGERTLWIDCDVLQADGGTRTAAITGSFVALYLAFKKFKEQGIIETIPVKDFVAAI
FT                   SVGIIDGTPILDLEYIEDSQADVDMNVVMTGNGDFIEIQGTAEGTVFSRAELDQLLELA
FT                   GKGIQELIALQKTILGV"
FT   gene            534114..534722
FT                   /locus_tag="Swol_0454"
FT   CDS_pept        534114..534722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0454"
FT                   /product="HAM1 protein"
FT                   /note="KEGG: gsu:GSU1794 HAM1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67789"
FT                   /db_xref="GOA:Q0AZR5"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR5"
FT                   /protein_id="ABI67789.1"
FT                   /translation="MPRELLLATRNRKKKLELQEILRELNLNILTLEELPYLAEVEEDG
FT                   NSFAENAIKKAVLTAKASGKICLADDSGLVVDALGGQPGIYSARFAGELASDEENNQKL
FT                   LKLMEMIEEDKRTARFVCVIALSDAQGNVETVEGICEGRIALATAGKGGFGYDPLFIPQ
FT                   GYTQSFAELPSATKNLISHRGKALEQARPLIERLFLGST"
FT   gene            534911..535384
FT                   /locus_tag="Swol_0455"
FT   CDS_pept        534911..535384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE2252 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67790"
FT                   /db_xref="GOA:Q0AZR4"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR4"
FT                   /protein_id="ABI67790.1"
FT                   /translation="MKIAVIGDTHGRIEKICRELKLVKADQIFFTGDFLSDAKRIAHHL
FT                   GGVMLHAVAGNCDFYESGPAERILDLEGKRFYMVHGHQYGVKISVNSLYYRGLELGADV
FT                   VLFGHTHIPFCKQIEGIWLINPGSPSRPRLDKKGSYVLLYLEKGKIEVAIEYI"
FT   gene            535502..537262
FT                   /locus_tag="Swol_0456"
FT   CDS_pept        535502..537262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67791"
FT                   /db_xref="GOA:Q0AZR3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR3"
FT                   /protein_id="ABI67791.1"
FT                   /translation="MSDLTVNEITSILEGLIENPYMFYVIVDSDGIISSINQTYLDILE
FT                   MKKEDVVGRNILDITPSSGLPEVLRTGRMDKADIWTVKGRDTIVTRVPIIKNGKIIGAI
FT                   ASSLFLDMSGAKILMKKLQETEKEFTAILEGLIESPHMAYVIVDKEGYITVMNQTFLDI
FT                   LEMKKEEVIGKYVLEILPHSKMIEILKTGRVDKADIWPIRGQDTIVTRTPIIKHGKIIG
FT                   AIGHSLFLDMSGAKILAKKLQETEKELSLYRDEVSQIYSARWIFDDLVGCSQEFLAVKS
FT                   MARQLSYSISTILITGESGTGKELFAQAIHNGSERKNWPFVRINCAALPENLLESELFG
FT                   YEEGAFTGARKGGKPGKFELAKGGTIFLDEIGDMPLTMQTKLLTVLQEKVVERVGGTTP
FT                   IAINVRVIAATNRDLEKMVENQEFREDLYYRLNVVGLNIPPLRRRMDDIPLLVNDLIHR
FT                   INQCLKTDISGIEPEAIDLLQEYSWPGNVRELENLLERAINLALMHGEQLIRMEHFPSL
FT                   NQKNKDKKFAKIEILDDGQSSLPQLIEKIEKQMIIQYLQESGGNKQQTAKMLGIHSSAL
FT                   YRKLSKYGLE"
FT   gene            537854..538204
FT                   /locus_tag="Swol_0457"
FT   CDS_pept        537854..538204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67792"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR2"
FT                   /protein_id="ABI67792.1"
FT                   /translation="MIDKKAFAGTNLIVDDSYLQELEKMNFPVVKSQLLSMEDFNEEIR
FT                   QGLIASEDKKDLAAIYLEELELMEFPVIKTQRLSLEEFNEELRKGIVEDSSAVEADFVA
FT                   KGIKVKNLALVS"
FT   gene            538560..539972
FT                   /locus_tag="Swol_0458"
FT   CDS_pept        538560..539972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PF10_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67793"
FT                   /db_xref="GOA:Q0AZR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR1"
FT                   /protein_id="ABI67793.1"
FT                   /translation="MREYIIYVLLIFLPIGSIMAYFLRREGLGKRNMAIILTLSLLIII
FT                   TFPITVVRLGILSSFLSYILLIVVITRYLLANEGEFAPQSKGRLVTGPELEKLMETIET
FT                   RLDSDLSGLRVEAFENLEGDSVPTGLIEGVPEAALVLESTVTTEEMREEEFAAAELLEE
FT                   DSGELAVKPVVTEEESEAETLHFAIDESRSLDAEIEVETTALEEKAIDGVGSIEEEVIL
FT                   EEIDIMAELELADTGGKGIDLLVEELEEEGEEVEESLEAEEGAEEEKEEIVEEIEEVVE
FT                   EREETAEGTETEDRIEAKIEPAEYDNDLPDDGAEKIIEKLDEDISIESVENLAEKTIEE
FT                   LADEGESILDEEAANEEVVGVLEAAAVAEPVEEAAWMEEQDLPVAVHDEEPMKIEQADT
FT                   FKEEDTLIMNNANARILELIEQGFLHKEAANLPEAAACFEEAWDITMDDELKRNLSIEL
FT                   LNIYQFIDENQL"
FT   gene            540335..541141
FT                   /locus_tag="Swol_0459"
FT   CDS_pept        540335..541141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67794"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZR0"
FT                   /protein_id="ABI67794.1"
FT                   /translation="MKGAGTMKKTQEIIGLPVFAILDGKKIGQVKDLVINPEEGKVDFI
FT                   LVSNRNWYDGARVLGYKSVMGIGEHAVTTESENLLTTINETANANKLLERHIELKGNRV
FT                   LTNKGNLIGVISEYIVDEDTGAIACLEFRTAEDESKIEIIDAKQVMTYGVDVIVIKHEE
FT                   STEVSLQQKAVEAEKLVSPVAVTAVTSSEPTPLATPTASPSAGSSDGAAFFKQKQRQFL
FT                   LGKKLIQDIKDAIGNVLIAQETVITEEILDLAERNNRFIELTQCAR"
FT   gene            541165..542397
FT                   /locus_tag="Swol_0460"
FT   CDS_pept        541165..542397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY3269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67795"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZQ9"
FT                   /protein_id="ABI67795.1"
FT                   /translation="MTDAGKLWLKVISMAVIAISASLLIVSFALAARDQDYYPSNLWLG
FT                   GISLADMSKEEAYALLQSELASNLGDKLSLVVGKQEISLPMEEIGISYDVAASLDKIEE
FT                   ELFPGQGVATLVKHSVARGQRQEIKPALSWSKKAILEKILQIKRDYDQPAIDARIVYNH
FT                   DFLEYRAHQNGYSINVNASMNHISDALGKGILGPIEIIATEVHPRVKIEDIETVKDVIA
FT                   VSARRIDHVSQETSALLEKLNGLIIMHGEKLDLPTIMDSGREAAMDVGSETKAQIKGAI
FT                   VQACLQAGMQEKDKQSVMENKLQYPLLLTTSMSEHTLLVKIYGCQTELGKEITLLSERE
FT                   DVYPEVQIKLNHRLSPQQRIIQQEGKKGFILRNYRVVTSGGKVVEKSLLSEELTPASDT
FT                   IIVVGPGNTRK"
FT   sig_peptide     541165..541260
FT                   /locus_tag="Swol_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.716 at
FT                   residue 32"
FT   gene            542708..542983
FT                   /locus_tag="Swol_0461"
FT   CDS_pept        542708..542983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67796"
FT                   /db_xref="GOA:Q0AZQ8"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZQ8"
FT                   /protein_id="ABI67796.1"
FT                   /translation="MDKNKEKTRKNILVRLRRIEGQVRGIQRMMEEEADCMDILTQISA
FT                   VKSAINQVGIIVFEKHAQECIVKAMDEERQEENLKEIVNMMGRLIK"
FT   gene            543005..543334
FT                   /locus_tag="Swol_0462"
FT   CDS_pept        543005..543334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0462"
FT                   /product="thioredoxin"
FT                   /note="KEGG: sth:STH2404 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67797"
FT                   /db_xref="GOA:Q0AZQ7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZQ7"
FT                   /protein_id="ABI67797.1"
FT                   /translation="MADIKIFNQDNWEKEVMQSDLPVLVDFWAPWCGPCKMVGPVVESL
FT                   AAENAGKINIGKVNVDENQDLAARFGIRGIPTLAFFQGGSEVKRIVGAQNKAQLQKAID
FT                   EVSGS"
FT   gene            complement(543356..544678)
FT                   /locus_tag="Swol_0463"
FT   CDS_pept        complement(543356..544678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0463"
FT                   /product="Recombination protein MgsA"
FT                   /note="KEGG: chy:CHY_2201 ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67798"
FT                   /db_xref="GOA:Q0AZQ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZQ6"
FT                   /protein_id="ABI67798.1"
FT                   /translation="MDLFSLADEKKFDAHAPLAWRMRPRSLDEVVGQEHIIGPDSPLHQ
FT                   AIENDRLQSFVLYGPPGSGKTTIAHIIARTTSSHYAAIKAVSSGVGEIRKIAADAADHL
FT                   KYYQQSSIIFVDEIHRFNKSQQDVLLPYVEDGTLILIGATTENPLYEINNALLSRMKLY
FT                   IMEALNANSLRRIVEQALADPERGLGKHNISIDEQSMVMIVQAAQGDARTALNILDTLH
FT                   NSYSSKDGSLRITPELLEKVTGRLILKYDRSGDYHYDTISAFIKSIRGSDPDAALFWLA
FT                   VMLEGGEDPKFIARRLIVHAAEDIGLADPYALTLAASTARALEFVGMPEARIPLAEATI
FT                   YLATAPKSNSSKMAIDKAINTVQNTPRIIVPPHIADSSHSQSASLGKGKGYKYPHDYGG
FT                   YVKQEYLPQEIEGITLYEPGKNGYEQNIRDFLQKIKKQPPP"
FT   gene            544966..545982
FT                   /locus_tag="Swol_0464"
FT   CDS_pept        544966..545982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0464"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="KEGG: chy:CHY_2197 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67799"
FT                   /db_xref="GOA:Q0AZQ5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZQ5"
FT                   /protein_id="ABI67799.1"
FT                   /translation="MKVAVLMSGGIDSTVSALLLREQGYEVTGLTMVHLEREAGEKAAR
FT                   IANELQIEHKVVDLREPFQSAVVDYFCREYEQGHTPNPCVKCNEEIKFGLLLKAALDLG
FT                   ADKVASGHYARIDYDDKSQCYRLMKGVDPRKDQSYFLYRLKQQQLSRLIFPLGGYRKEE
FT                   VREMARRYHLQLAEEKESQEVCFIPGDYREFIRPHVSYKEGSFLDRTGKILGRHRGIPF
FT                   YTIGQRRGLAVSAGRPLYVLKIDPEKNQILLGENEVLFSKLLRFKQNHFICSQDFELLI
FT                   KVKAKIRYAARESEAILHCIEDDIWELVFDEAQRAATPGQSVVYYQGDYVLGGGTIY"
FT   gene            546010..546477
FT                   /locus_tag="Swol_0465"
FT   CDS_pept        546010..546477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67800"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZQ4"
FT                   /protein_id="ABI67800.1"
FT                   /translation="MKTRNIQHLPVFLASRAEVVAVVQKAVIGDDFGLLYLVVKGEDGK
FT                   AGLIFRDDFDLTLDAVKIWDLHCIKSYAYGEELSVYEKKLGDTVFDRQGKELGIVSDFI
FT                   LSPTEKQVQGLEISSGTINDILKGRRELSLQEVSWKSVKSGVLAGEGSQEE"
FT   gene            546474..546650
FT                   /locus_tag="Swol_0466"
FT   CDS_pept        546474..546650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67801"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZQ3"
FT                   /protein_id="ABI67801.1"
FT                   /translation="MIIKCPVCGGLQVGRVGSDQYYCWNCFLEFNFRKGMLNLYEVAED
FT                   GTLVAMESSSQLI"
FT   gene            546673..547692
FT                   /locus_tag="Swol_0467"
FT   CDS_pept        546673..547692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67802"
FT                   /db_xref="GOA:Q0AZQ2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZQ2"
FT                   /protein_id="ABI67802.1"
FT                   /translation="MLPASSKIYRYFFFIVVVLATIYFLFLVREVLLTFFLGAVLAYLL
FT                   FRPISFLERKGLKRVWAILLLYLLLLTVFSLFFSLAVPAMVVELNQMAGILPDYADQAR
FT                   NMAKSIDGMELGKLTPVLKENLNQIENKLFEGLKNFLGGFYSFLGKFLALAFSPILAFY
FT                   IINDWEKIRDSFLGLFSPSFRREIKAVLDKIDEALIEFLKGHLIIATFVGIFTGTAAAL
FT                   LGVKFPLLIGLVAGVADLVPYFGAFLGGFFAILIALSESLQLSLYMGLAVVIIQQVESN
FT                   IITPRIMGGKLGMHPLLIVFALLAGGKLMGIWGMLLAVPLAAALKVVIQWAFLKMVES"
FT   gene            547849..550491
FT                   /locus_tag="Swol_0468"
FT   CDS_pept        547849..550491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0468"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: mta:Moth_1644 alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67803"
FT                   /db_xref="GOA:Q0AZQ1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZQ1"
FT                   /protein_id="ABI67803.1"
FT                   /translation="MWSSAEIRKTFLEYFEERGHSVVESSSLVPVNDPTLLFTNAGMNQ
FT                   FKDVFLGLDKRKYVRATSSQKCVRAGGKHNDLDTVGRTPRHHTFFEMLGNFSFGDYFKR
FT                   EAIGYAWEFLTEVVGLPEEKLWVTIYQDDDEAADLWPEISGIDPGRIVRLGEKDNFWSM
FT                   GDTGPCGPCSEILYDRGIEYSCGAPDCGIGVCDCDRWLEIWNLVFMQFNRDESGEMTPL
FT                   PRPSIDTGMGLERLSSILQGVDSNFDTDLFIPIIKRIEELTGKAYEQGERGFPFRVIAD
FT                   HSRACSFLIADGVLPSNDGRGYVLRRILRRALRFGRFLGIEGSFLYKNVDVVCDIMQEA
FT                   YPELLEKQDFIKEVIRLEEERFLLTLNDGLKKAEEIMERARQRGDNVIPGEEAFMLYDT
FT                   YGFPLDLTEDMAEENQFTLDKAGFDRSMEEQRQRARQANKGEDLLGQERLLSEKLAGIA
FT                   PSSFTGYENSRDESVLLAIIKGSELMDKALNGEEVILITARTPFYAESGGQVADCGIIK
FT                   GQEGLLRVQDVKKLSAWILHYGIVEGVLTTGEGVSLQLDDPARMDTARNHTATHLLHRA
FT                   LREVLGEHAQQKGSLVEPARLRFDFSHLKALSSEELSRIEQMVNEAIWKLYPVTTTVTA
FT                   LGQAREMGAMALFGEKYGEEVRVVQVDTYSSELCGGTHVQNTGQIGLFKITGEGSIGSG
FT                   LRRIEAITGSYALEYIKQLEDELKKAASALRSSPLELAKRIENLNNSLKEKDKEIENLL
FT                   QRLSRSSSDELVNKAFQLNDAWILIEEVDIEDPGSLRQNAEMLKDKLGRAIVMLASIKG
FT                   EKVSFVCFVSKDLLEQGLHAGKIVAAAAQVAGGGGGGRPDMAQAGGRDKSKISEALAEA
FT                   RKMVKKTLS"
FT   gene            550547..550819
FT                   /locus_tag="Swol_0469"
FT   CDS_pept        550547..550819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_0540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67804"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZQ0"
FT                   /protein_id="ABI67804.1"
FT                   /translation="MPQLPGETVSFKLERDDENKVRAILHTVYQALQEKGYNPINQLVG
FT                   YMISGEPAYITSHSEARNLICKVDRDEIMEVLLKSYLQNSMGKGE"
FT   gene            550914..551339
FT                   /locus_tag="Swol_0470"
FT   CDS_pept        550914..551339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0470"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="KEGG: mta:Moth_1640 Holliday junction resolvase
FT                   YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67805"
FT                   /db_xref="GOA:Q0AZP9"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZP9"
FT                   /protein_id="ABI67805.1"
FT                   /translation="MRIMGLDLGEKRIGIAFSDPMGWTAQGHSILQRKGLKKDLSYLQE
FT                   LCQEFQVEKIVLGLPLNMNGTMGPKALETQEFARALQEALKIPVDFWDERLSSKSAERV
FT                   LLEADLSRKRRKELIDKIAAVHILQAYLDGGSLGKDY"
FT   gene            551422..551718
FT                   /locus_tag="Swol_0471"
FT   CDS_pept        551422..551718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_0543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67806"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP8"
FT                   /protein_id="ABI67806.1"
FT                   /translation="MTEEFLEEDFPILVLVDEDGIEHLFELLAELEIENDKYRVLVPLD
FT                   EEDEEYDEEDGEVVILKVIIDEEGNELLSDIDDETEWEMVVEAWQELVDSEEL"
FT   gene            551770..553302
FT                   /locus_tag="Swol_0472"
FT   CDS_pept        551770..553302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67807"
FT                   /db_xref="GOA:Q0AZP7"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP7"
FT                   /protein_id="ABI67807.1"
FT                   /translation="MGGRILASERVKTSIFFSLILLLGIASAGAMYFFQVFYKSPYFMP
FT                   GVKIASTTVGGYTNKQAASRLERDLEDCKKTPVIFYYQGYSFASKLEELSYPINYEEAV
FT                   NKVWQQEQERDWPSKLTNLDGSREIFYPLKLEYKPEIKAQMIDEWNKVLGVAAEDARLE
FT                   IDKQKGLVLIPARKGLKVDPEQTFANLPQEWGAMKEIKIPITMQEEWPQVKDEDLSNMG
FT                   ELSSFSTWFNVNEINRSHNLYLASSAINTSMLPPGEIFSFNRRVGERVIETGYRDAMVI
FT                   VNGKFEPGLGGGVCQVSSTLYNTVLLAGLEIVERHNHALAVAYVPVGRDATVVYGLQDF
FT                   RFKNNSPYPLYIRAWAQAGKLTMTIYGNLTEKRNINLSTIVDRVIPFKEIRENDPSLNP
FT                   GQEKIDHAGIQGYVVRSFRNYMDDEGRLLKSEQLASDYYKPLDKLIYVGPGIKVESPPE
FT                   NVDNPENPPNEVEPDPLGDSTGEAAPLVEPGPPETPSPQPENGDEGTPPITI"
FT   sig_peptide     551770..551856
FT                   /locus_tag="Swol_0472"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.771) with cleavage site probability 0.496 at
FT                   residue 29"
FT   gene            553645..554682
FT                   /locus_tag="Swol_0473"
FT   CDS_pept        553645..554682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0473"
FT                   /product="periplasmic solute-binding protein"
FT                   /note="KEGG: tte:TTE1255 predicted periplasmic
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67808"
FT                   /db_xref="GOA:Q0AZP6"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP6"
FT                   /protein_id="ABI67808.1"
FT                   /translation="MSEIKLRLEKPKVVAIILAVLFIILAGVFFTGQMIARQYQPVDPS
FT                   DKTMVDIVIPEKTGARQVADLLYYERLIHKQSVFLAYCQKNGYDSSLKAGHYRFSRSQS
FT                   LKEIVDDLVQGRIVNISFTIPEGYTLEQIGRLLIKKQLCSQEEWNMSIRQDYDFAFLKA
FT                   LPLENENRLEGFLYPETYFVPEDYNCQQVIVLMLNNFEQVWQKKFAEQAQAKNWSVYHT
FT                   ITLASLIEKEAQVPEERAMIAGVILNRLNAGMLLQIDASVLYALQRHKELVTYADLEVN
FT                   SPYNTYKYAGLPPGPIACPGEASINAALNPKEHSYYYYVAKGDGSHFFSRTYREHLQAQ
FT                   EKYGQ"
FT   gene            555024..556259
FT                   /locus_tag="Swol_0474"
FT   CDS_pept        555024..556259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0474"
FT                   /product="collagenase family protease"
FT                   /note="KEGG: cac:CAC1687 collagenase family protease"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67809"
FT                   /db_xref="GOA:Q0AZP5"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP5"
FT                   /protein_id="ABI67809.1"
FT                   /translation="MQGPELVLPAGTLEKLKTAVLFGADAVYFAGKEFGLRAYAGNLSR
FT                   AEIAEGLAFAHSRKKKAYLAVNILAHNQDMHKLPAYLEEMASLQPDGFIISDLGVLRLA
FT                   QKYAPSIPLTISTQANISNYEAACFFQDLGARRIVLARELKLGEIEEIKKKSSVEIEIF
FT                   IHGAMCVSYSGRCLLSYYMTGRSANQGACAHPCRYRYALVEEKRPGEYFGIEEDERGSY
FT                   ILNSRDLCLLEYIPRLLEAGVDALKVEGRMKSPLYLASVASVYRQAIDRYRERTTPFTA
FT                   EELSVWMAELHKTATRPFTSAFIGEEEDRAQDIDKEEISLRAQFCAIVTGYREQEGLIE
FT                   VEQRANFGCGDYLEFLLPGGELLGFVLEKLYDEDLAVLDRARHPQQKVLIPFDHALPEF
FT                   SILRKGGTVNQG"
FT   gene            557042..559195
FT                   /locus_tag="Swol_0475"
FT   CDS_pept        557042..559195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0475"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /note="KEGG: dvu:DVUA0129 CRISPR-associated helicase Cas3
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67810"
FT                   /db_xref="GOA:Q0AZP4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP4"
FT                   /protein_id="ABI67810.1"
FT                   /translation="MIKYYAHSTEGEEENWQLLKKHLENVSHRAGIYASCFGAEEWGEL
FT                   AGLLHDGGKYSDDFQDKLKGMNLNVDHSTAGAQIASELYGNRGCLLAYVSAGHHGGLPN
FT                   GGSDADEASLMGRLARNLPNYDAFYKEILLQPQLPRLNLGRSDKPGFSLSFFVRMLFSC
FT                   LVDADFLDTEKFYTKEKNEIRKKFPDIKTLNYKLEQYIYKISKKAKSPIIKRERAHVRA
FT                   CCRQAAKKEKGLFSLSVPTGGGKTLSSLEFALRHACKHGMERVIYAVPFTSIIEQNAAV
FT                   FREALGDDAVLEHHRNYDFEEDENNPNYKHRLAAENWDAPVIVTTNVQFFESLLAYKPS
FT                   RCRKLHNIANSIVILDEAQTLPDRLLLPCLAILEELLLRYGATIVLCTATQPHLEKLWS
FT                   KELQATEIIPDSERLYEVLSKRVTVRTAGILKDEELAKKLAAQKQVLCIVNTRKHARTL
FT                   YKLLPEAEGNYHLSAYMYPKHRSDKIAEIRQRLAEGRTCRVISTQLIEAGVDVDFPVVY
FT                   RAIAGIDAIAQAAGRCNREGIGGQGEVWVFIPEQGVPEGWFQRMAALGEKVLHKYDDPL
FT                   SPQAIKSFFELRFDLAGEQLDELGILKDFEECASKLLFPFRDVAEKFRFIDDISVPIVI
FT                   AIDNECKDIIKKAAYSDNPGGLARSLQRYTVGITPWEAIAYEKAGGIRKVAGLFNVMEE
FT                   VNNYDDNMGLLPLSNVETDIYVV"
FT   gene            559220..559882
FT                   /locus_tag="Swol_0476"
FT   CDS_pept        559220..559882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0476"
FT                   /product="CRISPR-associated protein, Csd5d family"
FT                   /note="KEGG: hch:HCH_02814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67811"
FT                   /db_xref="GOA:Q0AZP3"
FT                   /db_xref="InterPro:IPR010155"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP3"
FT                   /protein_id="ABI67811.1"
FT                   /translation="MGYGVKLKVWGDFACFTRPEMKVERVSYDVITPSAARGILEAIHW
FT                   KPAIRWVIERITILNEIKFDSFRRNELSGRISAVTMKSAMNGREVLLRQTIEDNRQQRA
FT                   TLLLRNVAYIIEAHFEMTEKAEADDSEEKHYNMFLRRARQGQCFHRPYFGCREFPVEFA
FT                   LLEEEVPPSHYRDLEEKDLGWILLDIDFKNDMTPLFFRAIMRHGVIEVPPLYEEVNA"
FT   gene            559879..561681
FT                   /locus_tag="Swol_0477"
FT   CDS_pept        559879..561681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0477"
FT                   /product="CRISPR-associated protein, Csd1 family"
FT                   /note="KEGG: msu:MS0987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67812"
FT                   /db_xref="InterPro:IPR010144"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP2"
FT                   /protein_id="ABI67812.1"
FT                   /translation="MIIQSLQEYYERLDKDPLSGIAPMGYSKAKVAFAFNLSENGELLD
FT                   IFPLYEVKGNKKISREMLVPEQVKRSSGVNANCLCDNSSYVLGIDNKGKEQRSRDCFMA
FT                   FKELHNEILTGVVDEGAKAVLVFLNSREAGQFSEKTLQDNMEQLLEGGNIVFRLDGADG
FT                   YIHERAPIKKAWEKYQETDKTDAYIAQCLVSGEKGPVALLHPSIKGVRGAQSSGASIVS
FT                   FNDDAYVSYGKKQSYNAPVSVNTTFAYTTALNYLLSNPKNRIKIGDTTVVFWAEREPEE
FT                   NLIAAFFDPPEEPKEQEMAQIDHASIQKIRDILMQLRDGKKPPNVDIDERTRFYILGLA
FT                   PNAARISIRYYYQGEFGTLMKNVGLHYADMLVVLPKDYRPVFPPVWRILMETATGGNTE
FT                   NIPPILGGALMRTILSGGAYPQSLYSVILSRIRADSIVNPIRTGIIKACLLRQFRINGQ
FT                   KEKEDVIKMSLNPENTAPGYLLGRLFALLEIAQQDSADTKLNATIVDRCYGTASTTPAA
FT                   IFPMLVKLSKHHLKKIKSTKPGLGYALDNKMQEVVNVLDDTKGLPRYLNLDEQGLFVLG
FT                   YYQQKQDWYTSKEKQGGIIDGDNN"
FT   gene            561665..562531
FT                   /locus_tag="Swol_0478"
FT   CDS_pept        561665..562531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0478"
FT                   /product="CRISPR-associated protein, Csd2 family"
FT                   /note="KEGG: cvi:CV1227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67813"
FT                   /db_xref="GOA:Q0AZP1"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP1"
FT                   /protein_id="ABI67813.1"
FT                   /translation="MATTIKNRYEFVLFFDVENGNPNGDPDADNMPRIDPETSFGLVSD
FT                   VCIKRKIRNYVALLKENEDDYQIYVQEKAVLNNQHKKAYEHFKIKPESKKLPKDTAQAE
FT                   AITQFMCKNFYDIRTFGAVMTTEVNCGQVRGPVQLGFSRSLDPIVPQEITITRMAVTNE
FT                   RDLEKERTMGRKHIVNYALYRAEGFISAPLADKTGFSEEDLELLWDALINMFDHDRSAA
FT                   RGKMSSRKLYVFKHDSKLGNAPASILFDAITVKKINGNKPVRNFSDYEISVTGNEIPQG
FT                   VEVLELL"
FT   gene            562518..563222
FT                   /locus_tag="Swol_0479"
FT   CDS_pept        562518..563222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0479"
FT                   /product="CRISPR-associated exonuclease, Cas4 family"
FT                   /note="KEGG: bcl:ABC3593 exonuclease, RecB family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67814"
FT                   /db_xref="GOA:Q0AZP0"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZP0"
FT                   /protein_id="ABI67814.1"
FT                   /translation="MSYSKKYREDELLAISGLQHIAFCERQWALIHIEQQWDENLRTAE
FT                   GRILHERVHDQEYKTYKPGAIIVRGMPLQSFGLGLYGVADLVEFVEQQGGAGISLPDRA
FT                   GLYLPRPVEYKRGKSKKGDYDRIQLCAQAMCLEEMLHCDIEEGDLYYGETRRREKVKLD
FT                   SELKEEVIRLSQHMHRLYSEEVTPKPDMRLSVCKSCSVMNVCMPRIRLKSSVRSYWNKA
FT                   LEELSPVENEVR"
FT   gene            563223..564251
FT                   /locus_tag="Swol_0480"
FT   CDS_pept        563223..564251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0480"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="KEGG: bcl:ABC3592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67815"
FT                   /db_xref="GOA:Q0AZN9"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZN9"
FT                   /protein_id="ABI67815.1"
FT                   /translation="MRRLLNTLYVTTPDSYLAREGENILIRLEEKIVFRIPSHNIEAIV
FT                   YFGYPGASPSLLGLCAEKGITVSFFSPNGRFLARVEGPQTGNVLLRRKQYRMADEENQV
FT                   PVLAKYFIAAKILNSRAVLQRGRRDHPDKVGDSIERSIALLAGSVKKVFDSENLNDIRG
FT                   LEGDAAQRYFSEVDNLILEQKQDFFMAARSRRPPLDNVNALLSFFYTLLVHECRAALES
FT                   VGLDPAVGFLHRDRPGRPSLALDLMEELRPYLGDRMVLSLINRKQINKDDFITKENGAV
FT                   YVLPDTRKMLLTVWQKRKQEEIIHPYLEEKIPIGLLPYTQALLLARFLRGDLDAYPAFI
FT                   WK"
FT   gene            564264..564554
FT                   /locus_tag="Swol_0481"
FT   CDS_pept        564264..564554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0481"
FT                   /product="CRISPR-associated protein, Cas2 family"
FT                   /note="KEGG: smu:SMU.1753c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67816"
FT                   /db_xref="GOA:Q0AZN8"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZN8"
FT                   /protein_id="ABI67816.1"
FT                   /translation="MMVLITYDVNTTDKDGQKRLRKVAKKCVDYGQRVQNSVFECLLEP
FT                   AQFVMLKNELEAIIDANKDSLRYYMLGSNWKRRVEHVGAKETYDPEGVMVL"
FT   repeat_region   complement(564991..568859)
FT                   /rpt_unit_range=564991..565023
FT                   /note="CRISPRs"
FT   gene            569050..569346
FT                   /locus_tag="Swol_0482"
FT   CDS_pept        569050..569346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67817"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZN7"
FT                   /protein_id="ABI67817.1"
FT                   /translation="MQIEYKSRGIEKVCTNAHEAEKKHGKNMAAKIHQRIDEITAADSV
FT                   EMLIQYKIGGCHILKGDRKKQYAMVLIQPYRLVFEMKGSEIQIVRVIEIIDYH"
FT   gene            569376..570428
FT                   /locus_tag="Swol_0483"
FT   CDS_pept        569376..570428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0483"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /note="KEGG: rru:Rru_A0006 plasmid maintenance system
FT                   antidote protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67818"
FT                   /db_xref="GOA:Q0AZN6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZN6"
FT                   /protein_id="ABI67818.1"
FT                   /translation="MVRSRTIIASPPGATIKEQLVDRGMSQKEFARRMDMSEKHISRLI
FT                   NGEVQLTPDMAMRLEMVLGAPAQFWSRLESVYREKLAKANAENEMDADIEIAKKFPYKE
FT                   MSKNGWVPETSKAKEKVVHLRKHFEVVQLGLLQGTLIPGIACRRLADHKKADYALYAWA
FT                   QKAKLEARHIDTKPININKLSNIIPHIRKMTRENPGIFCGELVSMLADCGIAIVFLPHI
FT                   GGSFLHGATFYDGGKIVMGLTVRGKDADRFWFSLFHEFAHIIYGHIGQPNGTSDADESA
FT                   ADEFAKETLIPSKEFNSFIAKKDFSKSSLVQFANVVGIDAGIVVGRLQKEGYIEYSWYN
FT                   DLKTKYKITA"
FT   gene            complement(570662..571384)
FT                   /locus_tag="Swol_0484"
FT   CDS_pept        complement(570662..571384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67819"
FT                   /db_xref="GOA:Q0AUU4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AUU4"
FT                   /protein_id="ABI67819.1"
FT                   /translation="MKELIKDYCKQLRWGNSIVQNYADIKADTHEEFLAKLLEIEVKGR
FT                   ELNRKNRCLRQAGFDVIKTFNGYSFDHIEIPASIPLDDLKTAALLKNRENLILYGPVGT
FT                   GKTHMATAIGVEACNQGKKVGFYRTSTLVNELNDAQNAGNLGKMLKQLAKLDLLICDEW
FT                   GYIPLDRQGAQLLFQVVADCYEKRSIIITTNLEFSKWNGIFYDEKLTSAIIDRLIHHSH
FT                   LLVFGGQSYRLTHSTIRK"
FT   gene            complement(571381..572886)
FT                   /locus_tag="Swol_0485"
FT   CDS_pept        complement(571381..572886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0485"
FT                   /product="transposase (25)"
FT                   /note="KEGG: bha:BH3998 transposase (25)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67820"
FT                   /db_xref="GOA:Q0AUU5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AUU5"
FT                   /protein_id="ABI67820.1"
FT                   /translation="MLTMIQQYHIKHLNFHKGKSLRSIAEETGHDFRTVKKYAEQTDFN
FT                   EIRKPKRGRPSKLDPVKPIIDAWLKEDLNRPVKQRHTARRIYDRLCDEHQDIFNACERT
FT                   VRTYVSARKKELYGEEEGYLPLEHPAGEAQVDFGEIVMIEQGQKVKGYELILSLPYSNA
FT                   GYPQIFRGQNQECLLTGLKDIFEYLEHVPRIIWFDNMSAAVAGIGEKGERKLVDQFYRF
FT                   ALHYGFKPQFCNPGKGHEKGHVENKVGYSRRNYFVPEPSFSDIEEFNQGLFAVAEKDHC
FT                   RKHYRKGRVINELLQDDLTAMLPLPAKPFTIGRMQKLSANKYGKVCVDTNVYSASPQVA
FT                   NKELYMRLGAHQVELLNEQYQPIVKHKRLYGQNQELMDWLPYLTTLAKRPNALKYTGFY
FT                   RELPDPWQDYFNNLDYAEKKKSLNLLVRMITETDMDTATICLLETLDSGKADADSILLS
FT                   YRRLTEPTFNDFLPLLSAGINSPAIYTPDLTCYDTFLKAGECR"
FT   gene            573065..573274
FT                   /locus_tag="Swol_0486"
FT   CDS_pept        573065..573274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67821"
FT                   /db_xref="InterPro:IPR032587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZN3"
FT                   /protein_id="ABI67821.1"
FT                   /translation="MQTTAVYACEAYDHLGVVSTIESGSGLVIIRGTEDTIPEIREILD
FT                   NLPFPVEVLDFNETEFPALVKARE"
FT   gene            complement(573427..573882)
FT                   /locus_tag="Swol_0487"
FT   CDS_pept        complement(573427..573882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0487"
FT                   /product="MaoC-like dehydratase"
FT                   /note="KEGG: reu:Reut_B3869 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67822"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZN2"
FT                   /protein_id="ABI67822.1"
FT                   /translation="MSSVAAGTKIPCRVSRTLDVGDFSILHQLTWFNMAVHSNSEYAKG
FT                   TWFKERSLAGPIIFTVADGLVHNADNIAELLAKDGYEIYAYIGVDNVKITSPVLFGDTL
FT                   TADAEVVDFRPTKNPRMNLFIYKNKTYNQRGEQVIEYQTTMLAQKIE"
FT   gene            complement(574113..575252)
FT                   /locus_tag="Swol_0488"
FT   CDS_pept        complement(574113..575252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0488"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="KEGG: tte:TTE0545 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67823"
FT                   /db_xref="GOA:Q0AZN1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZN1"
FT                   /protein_id="ABI67823.1"
FT                   /translation="MNFMLSEEQELIRSNAREFALKYIEPVATKIDQESRHPVEVFDKL
FT                   AELDMMGISYPSEYGGGGAEFLTTMIVTEELARSCATTGFLHGYSYGLIGHPILTFGNE
FT                   EQKQKWMPGLAAGKLVGSFALTEPGAGTDVSSATTTAVKKGDKYILNGTKTFITNAILA
FT                   DVFVVFAYTDRSAGAKGMSCFLVPQGSSGLNVGQHFDKMGVRGSQTSEVVFKDCVVAAD
FT                   CMLGKEGDGFKIAMSALDVGRIGIAAMSTGITQGCLDESIKYSKERVQFKKPIASQQAI
FT                   QWFIANMATDIDAARFLYMNAAFIKDQGKPFSVAASKAKLFCSECAARHTTKAVQIQGG
FT                   YGFMKGAKVERFYRDVKLTEIGEGTSEAQRMIIAGSVLR"
FT   gene            575668..577374
FT                   /locus_tag="Swol_0489"
FT   CDS_pept        575668..577374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0489"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: tte:TTE1258 cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67824"
FT                   /db_xref="GOA:Q0AZN0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZN0"
FT                   /protein_id="ABI67824.1"
FT                   /translation="MSLRRLYLLMSFFLLLYMILVLRIAYFQVIKGQDLAAQATAMRSQ
FT                   GIRLSEYSRGEILDRNYQPLTGSYTSTALYGLPAGMRSNRSVSDKVYGRDTLQVTGEIL
FT                   GQILDKQDSKAIQEQLRLAAKNGTTFVRIASDLSEAEVQRVISHNLPGITVAPLIKRYR
FT                   QDGFCCHVLGYVGGYQNNEGQAGIEKRYNALLQKGSSPQELLSVYDARGALIKGLNFKF
FT                   YEEEDRARGSVVLTIDKRIQEIVEEEISAQVKSGAVVVMDVDSREVLAMASRPSFNPYH
FT                   IEYLLKHDQNSSLINRALSRYHPGSLFKILVTTAALEENLVSERDKFHCSGKYVFNETQ
FT                   STSCWKEEGHGELSFAQAFACSCNPSFIEVGQRLGREKLLTYVDKLHLCDETLLGYAYH
FT                   PGSYVRINPGKIALSNACLGQEGVMLSPLQISSLLATVADDGLWQAPSLLRYTINSKGE
FT                   RSRIASSRKERVISPETAGKVQELMELVVSEGTGKNAALAEIKVAGKTASSETGNWKED
FT                   GEQSLDTWFGGYFPADNPRWVVLVLVQEGESGAVDAAPVFKNIAREMLKIL"
FT   gene            577551..579422
FT                   /locus_tag="Swol_0490"
FT   CDS_pept        577551..579422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0490"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: cya:CYA_0130 chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67825"
FT                   /db_xref="GOA:Q0AZM9"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM9"
FT                   /protein_id="ABI67825.1"
FT                   /translation="MAKAVGIDLGTTNSVVAIIEAGDPVVIVNAEGNRTTPSVVAFKDN
FT                   NERLVGQIARRQGALNPENTFYSVKRFMGRRYSEVESERKLLPYTVVSGPNDAVRFKSR
FT                   DKLLAPEEISAMVLKKLVEDASQYLGEKVKDAVITVPAYFNDAQRQATKDAGRIAGLNV
FT                   LRIINEPTAAALAYGLDKKANQTILVFDLGGGTFDVSILEVGDGVFEVKSTNGDTHLGG
FT                   DNFDKAIVDWLAEEFKKDYGIDLRKDKQALQRLVETAEKAKIELSSVLETSISLPFITA
FT                   DASGAKHLDMKLSRAKFEDLIHKDLERLRGPVKAALDDARLSARDIDEVILVGGSTRVP
FT                   AVQKLVRELNGKEPNLGVNPDEVVAVGAAIQAGVLAGEVRDVLLLDVTPLSLGVETMGG
FT                   IMTRIIERNTTIPARRSEIFSTAEDKQPAVDIHVLQGEREMARDNRSLGQFKLEGITPA
FT                   PRGVPQIEVSFDIDANGILTVSARDQATGKEQSVTISGSSNLDKAEVDRMVKDAQTYSE
FT                   EDKKRRQEVEVMNQGDSLCYTVERKLKAVGEQLPLHEKARIEELLQELKKVLEEKAGLD
FT                   KLKELIDELGQAAYSLDNIEPAAAGPDRSGPAAEGNAEVVDAEFEEN"
FT   gene            579438..580460
FT                   /locus_tag="Swol_0491"
FT   CDS_pept        579438..580460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0491"
FT                   /product="dnaJ domain protein"
FT                   /note="KEGG: gsu:GSU2406 dnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67826"
FT                   /db_xref="GOA:Q0AZM8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM8"
FT                   /protein_id="ABI67826.1"
FT                   /translation="MAVKYLDYYKILGVERDADAKKIKAAYRKLARKWHPDLHSGKKRE
FT                   EAEEKIKEINEAYEVLSDPEKKALYDRLGPNWKNGERVDSSGFGDGVFYRSSNIDPEDL
FT                   QGFSEFFSSLFGAEPGRQSRRASYRSAPVRGQDIESTIELSLEEAYHGLSKSITLSTAA
FT                   ACPECQGSGFVGRGFCRRCGGTGSISEARTLQVRIPPGVHEGSSIRLKGQGGEGLGGAE
FT                   RGDLYLQVHILPHPVFTLRGRDLETEITLRPEQAVLGDRVTVATLDRQLTLKVPPGSRS
FT                   GQKLRLKGKGMPARQGENGDLYARIKIDLPRDLSEEEKELYRQLAELRAPRQAERGVAE
FT                   "
FT   gene            580457..580735
FT                   /locus_tag="Swol_0492"
FT   CDS_pept        580457..580735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wsu:WS1254 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67827"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM7"
FT                   /protein_id="ABI67827.1"
FT                   /translation="MRLVKIYYHSKEEEIPLSWLNLHPDLLKIMEEMGIIELAGDSIKA
FT                   DGLQKIYKMMRLKNLLGVNFNGAAIIVDLLERIEELEDEIEELKRKR"
FT   gene            580741..583335
FT                   /locus_tag="Swol_0493"
FT   CDS_pept        580741..583335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0493"
FT                   /product="putative ATPase with chaperone activity, two
FT                   ATP-binding domains"
FT                   /note="KEGG: sma:SAV7241 putative ATPase with chaperone
FT                   activity, two ATP-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67828"
FT                   /db_xref="GOA:Q0AZM6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM6"
FT                   /protein_id="ABI67828.1"
FT                   /translation="MNMERLTQKSRQALLAAQNLALEKRQQEVQGKHLMMALLEQESGL
FT                   VPRLLQQAGISIPAFTQQLGQRLDKIPSVYGYEGSVYLSGSLGRVLNRAEKEAQELKDD
FT                   YISVEHLLLALLEEGEPDLKDLLQKAGLTREGIFQVLHGIRGSQRVSSDNPEDSYEALE
FT                   RYSRDLTRLAREGKLDPVIGRDEEIRRTIEILSRRTKNNPVLIGEPGVGKTAIAEGLAR
FT                   RIVARDVPEGLKDKRLLALDMGSLVAGAKYRGEFEERLKAVLKEVEDSAGQVILFIDEL
FT                   HTVVGAGAAEGAMDASNLLKPMLARGELRAIGATTISEYRKHIEKDAALERRFQPIMVN
FT                   PPSVEDTISILRGLKERYEVHHGVRIQDSALVAAAVLSDRYISDRFLPDKAIDLMDEAA
FT                   ARLRTEIDSMPAELDEITRRIMQLEIEAAALGKEKDEASRERLEDLLKELQDLKSEAEV
FT                   MQAQWQAEKEAISRVGQLKRDIEDCRYEMEKAEREYDLNRIAELKYGRLNELERKLKAE
FT                   EELLAGKEKHSALIKEEVDEEDIARVVSRWTGIQVSRLMEGEKEKLMNLEEILHQRVVG
FT                   QEEAVNAVADAVIRSRSGLKDPNRPAGSFIFMGPTGVGKTELSKALAEALFDDEKNIIR
FT                   LDMSEYMEKHSVARLIGAPPGYVGYEEGGQLTEAIRRKPYSVILFDEIEKAHSDVFNIL
FT                   LQILDDGRLTDGKGRVVDFRNSIVIMTSNIGSQEILNFQQAGGDYEDMKNRVLGLLRLN
FT                   FRPEFLNRLDEIIVFHALGAEQIKEIAEILLQKLALRFRQNTRASLEWDEKALDYLAEK
FT                   GYDPAYGARPLKRLIQHEIETALSRAMVKGEIRNEGEVIISAEGGKIALKIG"
FT   gene            complement(583413..583547)
FT                   /pseudo
FT                   /locus_tag="Swol_0494"
FT   gene            583694..583957
FT                   /locus_tag="Swol_0495"
FT   CDS_pept        583694..583957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE1455 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67829"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM5"
FT                   /protein_id="ABI67829.1"
FT                   /translation="MLIKSSSALRNDYDSLVKLAHEKAEPIYITRNGEGEMVFLPIEMY
FT                   EKREAEIKLLQQLIAAERNRLAGSPTFTTSALRFELEEIYNE"
FT   gene            583950..584258
FT                   /locus_tag="Swol_0496"
FT   CDS_pept        583950..584258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67830"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM4"
FT                   /protein_id="ABI67830.1"
FT                   /translation="MSKLKVELLNEARLQLRDIAAYYKMKIGPSSARKITSRILDAIEK
FT                   LADFPEMGMVPHAKMIADAGYRVLIIEDYLCFYHVVNDVVFVSHIVHTSTDYIKRIF"
FT   gene            complement(584305..586365)
FT                   /locus_tag="Swol_0497"
FT   CDS_pept        complement(584305..586365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0497"
FT                   /product="DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: dsy:DSY4907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67831"
FT                   /db_xref="GOA:Q0AZM3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM3"
FT                   /protein_id="ABI67831.1"
FT                   /translation="MKSLVLAEKPSVAREIARVLQCSKKSKGYIEGPRYVVTWALGHLV
FT                   TLAEPDDYDKRLKQWRIEDLPMLPEKMKLKVIKQTSHQFQVVKELMKRNDIEELVIATD
FT                   AGREGELVARWIMEMVRWRKPFKRLWISSQTDNAIREGFARLQPGTQYNSLYAAAACRA
FT                   EADWLIGLNVTRSLSCKFNAQLNAGRVQTPTLAMIVKREKEIKAFVPRDYWTIRADFGD
FT                   YYGDWRGKDGGRIFDYARAEEILSRIKGRMAAIKEVKTEARSEAPPLAYDLTELQREAN
FT                   RRLGWSAQKTLSILQELYEVHKLVTYPRTDSRYITDDIVPTLPLRLKSMGVGPYADLAH
FT                   PLLQKPLKPGKRLVDNSKVSDHHAIIPTEQPLQLKSLNEEERRLYDLIARRFLAVLYPP
FT                   YRYEQTTIITVVEGENFHSRGKVEIDRGWRAVQAVPSDKDEKDEEQLPEQTLARHKKGE
FT                   TLEVKSGKASKHKTKAPARYTEATLLTAMENCGKLVEDKKLRESIKGSGLGTPATRAEI
FT                   IEKLIRTSYIERQRKELVPTSKGIQLMDLAPPDLRSPELTAQWEQRLAEIARGQGKRLD
FT                   FMADIRRDTVQLVQNIKSDSSSTYRADNVSKSKCPQCGRFMLLVNGRKGKILACPERSC
FT                   GYRQPEAEDFSGKGGNSRANRRLMAKYSNQEELETNLGELLKAALAKKEQG"
FT   gene            586929..587405
FT                   /locus_tag="Swol_0498"
FT   CDS_pept        586929..587405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll1543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67832"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM2"
FT                   /protein_id="ABI67832.1"
FT                   /translation="MKIYFDMNIYNRVFDDQTQMRIRFESMAIDILFELVEKGDYELVW
FT                   SFILEYENNRNFFIERKPYIRQISTLCKETIKPDDEIKLIAKEIVKGSNTKDKDALHLA
FT                   SAVYSDCDYFITCDDKFIRTVEKNRDSLKDTIGSIKLYNPVDFLRKEMDINVIE"
FT   gene            588218..588526
FT                   /locus_tag="Swol_0499"
FT   CDS_pept        588218..588526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0499"
FT                   /product="nucleotidyltransferase domain protein"
FT                   /note="KEGG: chy:CHY_0080 nucleotidyltransferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67833"
FT                   /db_xref="GOA:Q0AZM1"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM1"
FT                   /protein_id="ABI67833.1"
FT                   /translation="MIDSQEIESIKNQLIEKYRPLRIILFGSQAKATAGRKSDIDLCIV
FT                   KETENKRALAVEMSLNIESTRPMDIIVYTPDEWDSSKQDSTSFASLVWKRGVEIYGG"
FT   gene            588507..588836
FT                   /locus_tag="Swol_0500"
FT   CDS_pept        588507..588836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0500"
FT                   /product="protein if unknown function (DUF712) superfamily"
FT                   /note="KEGG: bca:BCE_A0103 protein if unknown function
FT                   (DUF712) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67834"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZM0"
FT                   /protein_id="ABI67834.1"
FT                   /translation="MKYMVDSKRYLDWVRKSAADIKAAGILKKYEAGNDYVAFHSQQAI
FT                   EKALKGYLLYHTGELEEGHSLIFLCKKAIAYEPYFKEFLKECAYVNQYYIETRYPADFP
FT                   LEVSD"
FT   gene            589147..589527
FT                   /locus_tag="Swol_0501"
FT   CDS_pept        589147..589527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0501"
FT                   /product="sigma 28 (flagella/sporulation)"
FT                   /note="KEGG: mta:Moth_1582 sigma 28 (flagella/sporulation)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67835"
FT                   /db_xref="GOA:Q0AZL9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL9"
FT                   /protein_id="ABI67835.1"
FT                   /translation="MSFLLWALAITGILKGSLCLFAYLNNQVFPQPLSEEDERKCLQEM
FT                   QRGGEEARNILIEHNLRLVAHVVKKYESSGEDLEDLISIGTIGPIKAIRTYNFERGVRL
FT                   ATYAARCIDNEVSMSAPGGIYW"
FT   gene            589856..590527
FT                   /locus_tag="Swol_0502"
FT   CDS_pept        589856..590527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67836"
FT                   /db_xref="InterPro:IPR022009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL8"
FT                   /protein_id="ABI67836.1"
FT                   /translation="MVTIDAASFFFSPGTKWTTLTEVRLNDINGHTAGNIDIVLVAYDD
FT                   YGKITDFGALEIQSVYISGNIRRPFEAYIQEPELMYNMDWLSKPNYPRPDYLSSSRKRL
FT                   VPQLIYKGKILNVWSKKIAVALHSGFFSTLPQLPRVSADKAEIAWLIYDIELKQETNRY
FT                   NLVHTDTIYTLFQNSLDRIVTPESGLIDDFIEVLQGKLDKKLEKMEINDDDINKTMDML
FT                   L"
FT   gene            590542..591435
FT                   /locus_tag="Swol_0503"
FT   CDS_pept        590542..591435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0503"
FT                   /product="Site-specific DNA methylase-like protein"
FT                   /note="KEGG: lac:LBA0477 putative DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67837"
FT                   /db_xref="GOA:Q0AZL7"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL7"
FT                   /protein_id="ABI67837.1"
FT                   /translation="MLKQASLFVDEPTINPNQIINVAQVTQLSPFRYPGGKTWLIPYIK
FT                   TWLSNLRYKPEYFIEPFAGGGIVSLTVAYEGLADKVIMSEIDEDVAAVWHTIFAGDVEW
FT                   LIERIINFKLTAENIQAVLLEPAKSNKEKAFQTILRNRISHGGILAPGAGIVKHGENGK
FT                   GLASRWYPQTLKKRLHIISKLSKIITFVQGDGFDVCNQYIDNPHAVFFFDPPYTAGGKS
FT                   AGRRLYTHSVIDHPKLFELASKIPGKFLMTYEISDEVRGLAKDHHFEFKPIPMQNRRNA
FT                   VMKELLISRSLEWLVP"
FT   gene            complement(591468..591620)
FT                   /locus_tag="Swol_0504"
FT   CDS_pept        complement(591468..591620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0504"
FT                   /product="adenine-specific DNA methylase containing a
FT                   Zn-ribbon-like protein"
FT                   /note="KEGG: mta:Moth_2281 adenine-specific DNA methylase
FT                   containing a Zn-ribbon-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67838"
FT                   /db_xref="GOA:Q0AZL6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL6"
FT                   /protein_id="ABI67838.1"
FT                   /translation="MGGGTPVLEANRLGCKIIGCDINPMAYWIVERELADLNIEEYRRA
FT                   TCKLT"
FT   gene            complement(592062..592334)
FT                   /locus_tag="Swol_0505"
FT   CDS_pept        complement(592062..592334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0505"
FT                   /product="transposase"
FT                   /note="KEGG: tte:TTE1104 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67839"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL5"
FT                   /protein_id="ABI67839.1"
FT                   /translation="MAGHLKNTYFSAQYSRIAARRGKNRATVAVAHAILTIVYQMLKAN
FT                   VLYQELGLDFFEQRRKNEIVKKSIKRLEAFGYTVTIDQQIGISTA"
FT   gene            complement(592361..592879)
FT                   /locus_tag="Swol_0506"
FT   CDS_pept        complement(592361..592879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0506"
FT                   /product="transposase"
FT                   /note="KEGG: tte:TTE1104 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67840"
FT                   /db_xref="GOA:Q0AZL4"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL4"
FT                   /protein_id="ABI67840.1"
FT                   /translation="MVQERARELNRIQKVLEGANIKLSSVVSEIDGKSSRDMLTMLAAG
FT                   CNDAKAMANKARRQMRKKIPQLEEALHGFMGEHQRLMLDSMLKHIDFLESHILLLDKEI
FT                   HEKMEPVSEQITLIDSIPGIGERSAQVIIAEIGTNMNQFPSAAHLASWAGICPGNNESA
FT                   GKPAREAIF"
FT   gene            592963..594228
FT                   /locus_tag="Swol_0507"
FT   CDS_pept        592963..594228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0507"
FT                   /product="UvrD/REP helicase family protein"
FT                   /note="KEGG: sde:Sde_0195 UvrD/REP helicase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67841"
FT                   /db_xref="GOA:Q0AZL3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL3"
FT                   /protein_id="ABI67841.1"
FT                   /translation="MINRLVELLIRENPSILKALHLTYPVVFLDEFQDTTFAQFQLLHT
FT                   AFDGSETIFTAVGDDKQRIMVWAGAMPDAFSQFEQQFDALRISLIFNWRSHEDLVQIQH
FT                   VIASRIDPNVEEPEARADRLVDGDIAGIWEFASEDMQSDYLAKWIEGEVQAGCIEPHDV
FT                   AILVRMRPDLVESQLSPTFEANGLRLRNVARTVGDIAIQDLLGEELTQILLRLLRLGAT
FT                   KRSPENWNASLRDLQFLEAVEPNDEEGLRRLQKRLQVFTREIRRTMQHLEPEPDSATEI
FT                   TRAALDFIGDQVLRRAFPSYQRQHDFDRVWNGFLLLLRECLVNTETWSGTLDEFEGIGQ
FT                   TALMTIHKSKGLEFHTMIFCGLDNQTWWSLTPNRMEELNSFFVAFTRARQRAFFTLCKD
FT                   QGRTVAWIENLLTSAGVQKRFL"
FT   gene            594494..595255
FT                   /locus_tag="Swol_0508"
FT   CDS_pept        594494..595255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bfs:BF1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67842"
FT                   /db_xref="InterPro:IPR026001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL2"
FT                   /protein_id="ABI67842.1"
FT                   /translation="MKLFNRGGYVLDFSTNDFDVFTLESVGVPLCETYKLSKGKSLMAY
FT                   INQASQDDIIKLLKDLLDYYEAHYEYQIENDDEYSKTYSRCKDIMDRILYNKNPLASTA
FT                   VELKEKFSSAYLSAQIDLMLKMQSENPTEAIGKAKELIESCCKTILDDNTVEWDKNWDV
FT                   GQLTGETVKLLKLMPKDIPDTAPASTELKAILGNLRAIATNLAALRNPYGSGHGKSATY
FT                   KGLEERHAKLAVGSSITLVSFLWDTHERRGI"
FT   gene            595260..596558
FT                   /locus_tag="Swol_0509"
FT   CDS_pept        595260..596558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lla:L186034 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67843"
FT                   /db_xref="InterPro:IPR041427"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL1"
FT                   /protein_id="ABI67843.1"
FT                   /translation="MHRISEITKRDILDLFNNGIEIEEYFETKKVTYLYFGRMEELEFL
FT                   KRLYDLKSMPSLDSRFSDAESDIRQHTVNNNDYPFCWVFEDERFQLKDGSDEVYLKFIC
FT                   EIFHPTVRFEKGYWKKFLDEINKLLQNDAYELYPSEKISNRDIYGWRIFQPEENKMFIP
FT                   YSQRNEKAIKEKKIVLSIKRSARNQIYQLLERYNEIYRETSETGWQYNISTSDKVFNDI
FT                   SQFYPPRCYNDQKQYVETNSLQDFIYYSSPNCVMDAIEFYEKYNRSNDFEMEINAILKL
FT                   NGIALKLCHGKITSTFDIPIKTGIFTPIQEAGLKELLQEATKYYDEGNFKNAVEKLWDA
FT                   FERLKTYYSPALDKKESINKIIRNMGSNKEPYKELFEKEFHELTTIGNNFRIRHHETTK
FT                   TDIEDNRHYDYFYKRCLSLISVAIQYLDSGGML"
FT   gene            597038..599830
FT                   /locus_tag="Swol_0510"
FT   CDS_pept        597038..599830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67844"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZL0"
FT                   /protein_id="ABI67844.1"
FT                   /translation="MDLFKRITEHLNNPSVKLLCQIPINDEEYKNLLKHIRLRATNVQN
FT                   QTTFSADIYLSVAMVQIAIREYAEGNYWGCFLETLGISLSQNKLNWLGQIFVVTLKHYH
FT                   LFELERIDGASNKYVENIKAHSFVPNNYLSGYFDFLFSFYDRNLFRQLPDDLESDIYEM
FT                   VDYMAETLSESGDSIKLEKSGNRHSKSYRLLKATRCVIAQSSVITVCEIIEKHLRMIDS
FT                   YYYDGIEPAILDRFSEAFIQWSENKNSEINIQDKKRIRQSAEVLNHKPYFEINKAQNTA
FT                   YLIIPEQKFREHNFNGQAFVSIISSEHTEQFRLDIYKAFGVLVSEKCYVPINDIFTEYV
FT                   IQIISGSTKSYLIPAKPYRVFNDNWYELQRLRKGHCYILTDKQSHVNSGEQAVYAQLLF
FT                   DRWNEYSYTILDDTVIYINDLPISIAGEFSEKPLFDCVSKEYRLLDEDGNQIQATYRHP
FT                   IISFKVNKQAANGAFLYCNDGRFRIFAEGTSSFIEFPHDTDNIGVSMILDNLLPVEDGV
FT                   YNIVLDEPGKHRRTICRYVLIKELRCRTEKRRFTFCETAAVMLSGKYEIEPCNCISSVK
FT                   GKYIVDLTMGTEQAEFALKLNGHKFVLIVPLNVFKFGFSRQWIYKRPDYVWYSNIRNDL
FT                   YIFMPGATKTSVYLNKNVTKKIHGEEIDKNLFKFDISEFVHVITQGSRAFYYINLCYSD
FT                   NLDRRMTLCLVQKVIWVNKFKLHQVNGVVYLNTAYQGDAELLVKFFEQDSGKLVLEKIV
FT                   TNGINPMPNLRTTGLYKVERFMVETDEFGFSEKRTFLGGIIYKFGVIDYTNLHNCRVII
FT                   KEIYVDGEKLNLNNEYTVRNLYRVSDYEYTGTMTIKTLVGRVKKVFEKVLIQFSDIGME
FT                   SCFIYVNDNQDWVPMSYDKNSRVLISSEDDLLYYSKEYSRFCDLYSDITEFKIVIRRDR
FT                   "
FT   gene            599833..604569
FT                   /locus_tag="Swol_0511"
FT   CDS_pept        599833..604569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0511"
FT                   /product="helicase"
FT                   /note="KEGG: cgb:cg0838 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67845"
FT                   /db_xref="GOA:Q0AZK9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK9"
FT                   /protein_id="ABI67845.1"
FT                   /translation="MIFRPAESSKNIVDFYRNYLLTTFQTNNENYNRQLQEQLAVDGTI
FT                   ANGPFISLNDSFAKEESLRDLVDKRIISRELLKITAMHLDRNLYKHQTEAIRKANEGKN
FT                   LVITTGTGSGKTECFLIPVINHLIREKEAGTLGKGIRTLIIYPMNALVNDQIRRLRELF
FT                   NECGDLDITFGKFTGETQEKFSDARKEYMEREGSAPGKNELISREQMRTTPPNILITNY
FT                   AMLEYLLLRPGDNVFFNEQNAINWHSIIIDEAHTYGGAKGIEVGSLIKRVKAMLARNDI
FT                   QFILTSATLGDEKSNSEIIKFAEALCNAKFDDSSIVRAYTIAPQKVSDVHLLDFSIYRD
FT                   LAEKIRNNISAKEILYYLNKRNIAILSDISEEKTLERTLFSMILHDEFYYKVRIKLLNR
FT                   IKPLNKLATELNLPVQDVTDFIAVASNAQIEGNKIFEARYHMFLRGLEGIFITLKPSNK
FT                   LFVTKMETYKEDPFSNDCGYKAYEISFCHNCNALFIIGQKEDGHLVQKNKFNADYDPEV
FT                   YLLDGDYEGDDNDEDEEAKSYIVCAKCGAIKRSTSIDDLTCGHGKENYNRLIKVKDKGT
FT                   KLHTCPCCHTINTQRSIMRPYFLGNEASTAVIATALYNELPNTKITKETVKFEDDFFGE
FT                   SSKKIIEKREHIVKQFLTFSDNRQAAAFFASYLETTYRDNLVKRLMTRVCEDNAQAMAS
FT                   GISLENFVDHLEAIMAEYRIYAQDNRHKEAWIAVAKETINYKAKNSLQNKGILFFDVDI
FT                   DMPANNKLNLSAHETTDLFKIFARYFIKNAAIKFPISLTRADDQRLTFNGITIGFDLSS
FT                   SSKSYIQAWVPAAGRENIRTKLLQKIFPDKDAAFIYKLLESLWYALNTKGIISYYDEKF
FT                   MLSSSAIKVKAVQVLYKCNECKTITPYNIQNICPNPKCTGDLQTFDFKKTIHRDHYYNV
FT                   FRNLKIDDLIAKEHTAQLGSEKAYTYQNDFKNEKINVLSCSTTFEMGVDVGSLETVFMR
FT                   NMPPSPANYAQRAGRAGRSLKSAAYSLTYCPNNSHDLNYFKQPLSMIKGTIQPPAFNVS
FT                   NEKIVLRHIFASAFSFFWKKCPELYKKYVGEFFDLDGYGEFKAYLNSHPKDLHQYLKHV
FT                   VSVDLYDYFGIEEFSWINRLFNIDEINPGVFVIARRKYDLDLQDLEKARNVCVERQKTA
FT                   KPGSKEEKNLNWKIISIGNSINTVRNQQMIEFLSRNNLIPKYGFPVDTVELKSSGKGGV
FT                   LDSLRLDRDLFSAISEYAPDSEVVADGKLITSRYVRVLNGYAWPEFNYSVCEHCHTLNK
FT                   TLWIEESLKNCKQCGYELPIIKKKYIIPKFGFITENGEPKDARTDKPERTYKGSISYIG
FT                   DENHIEFNNYDICGKRVVVGSSKMDELAVLNTSAFYICKSCGYGIVKDGCYDSAFEKPH
FT                   QKPDGYPCNNKLYPYSLGHEFQTDVVLLKFISENIMELNAAWTILYSLLEGLSRHLCID
FT                   RNELSGCLHWYRNEAFGDRGNFGFILFDNTPGGAGYVRQLHSVSTFVKMLECGADIVNN
FT                   CECGGNEADTACYSCLCNYYNQRQHENLKRKLAIDFFSSVKNGNTMWFGSTILDKEFR"
FT   gene            605532..607001
FT                   /locus_tag="Swol_0512"
FT   CDS_pept        605532..607001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0512"
FT                   /product="type I restriction modification system M subunit
FT                   (site-specific DNA-methyltransferase subunit)"
FT                   /note="KEGG: gka:GK0343 type I restriction modification
FT                   system M subunit (site-specific DNA-methyltransferase
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67846"
FT                   /db_xref="GOA:Q0AZK8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK8"
FT                   /protein_id="ABI67846.1"
FT                   /translation="MITGEIRNKIDKIWTDMWAGGITNPLTVIEQLTYLMFIRSLDEKE
FT                   LEMESVEALSGEEMPKIFPQDKAGQDMRWSKFKTKDSRAIYDIVGSKVFPFIKAMNGKN
FT                   TSAFSRYMQDAMFLIPTPQVLQKIITGLDELYEHDIKDLDMQGDVYEYMLGKLSTAGQN
FT                   GQFRTPKQIRDMMVRLLDPAPDNKVCDPACGTAGFLVSIAEYIREKYETEMTPEQWEHF
FT                   GGAMFTGFDTDRTMLRISAMNLMLHSITQPRIEYVDSVSKQNSISSAYDIILANPPFTG
FT                   TIDTESINDNLKAVCSSKKTELLFVALFLRMLRKGGRCSCIVPDGVLFGTTRAHKALRK
FT                   ELVENHQLQTVISMPSGVFKPYAGVSTAILVFTKTGAGGTDKVWFYDMRADGYSLDDKR
FT                   TPIEDNDIPDIIARFHNPEGEADRKPTEQSFFVEKSAIVANDYDLSINRYKEIVYEKVV
FT                   YDAPAVIMDRLDKLNLDIAAKMEELRGLIGE"
FT   gene            606994..607455
FT                   /locus_tag="Swol_0513"
FT   CDS_pept        606994..607455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF0296 type I restriction-modification
FT                   system specificity determinant"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67847"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK7"
FT                   /protein_id="ABI67847.1"
FT                   /translation="MSKLYEIIEKPISGEWGSEDKLGGGVPVLRTTNFTNIGVIDYSNV
FT                   VTRVINTDKIKNKYLQKGDIIIEKSGGSPAQPVGRVVVFEGEDGKYLFNNFTSVLRIKD
FT                   QKIYFYKYVFYHLFSDYKEGKTRKFQNKTTMSLQKVKKVVSASRKNLTE"
FT   gene            607520..609166
FT                   /locus_tag="Swol_0514"
FT   CDS_pept        607520..609166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67848"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AW49"
FT                   /protein_id="ABI67848.1"
FT                   /translation="MFKPNNDHLQGKVFSDFQRFNSVVAKRLKNSWSMVFYEQVFCLIR
FT                   EELFAPLYSLEWGRPNFPINILVGLEIIKHLFDYTDQELLDQYYFNYQVQYALGIENIG
FT                   EIYLGERTLYNFRERVVRYSKEYPEKEALAFQQFEILTRNFLGLVGLKTDELRIDSTLI
FT                   SPNIKKAGRLSLAHDVLAQAVRAIPVAYRSENLNKVLEDSFKNKLLYQTKNSQLDSRLQ
FT                   AVLDLMSEIYVLSQNHKTIADLEKVKILLRFLNEQANCDENSGRFKAKASKEVSSDSLQ
FT                   SAYDTDATYRDKAGKKESGYTATFTETCNSENDVQIIVDYTVEPNNKSDVEIFQDRMDI
FT                   IKDNTNASDIYADGGYYGENVINKANSKGIEIQLHYTDMTGKTAPEGQLPAHHFVFNKD
FT                   MEMVQCPGGQIPSSSKYNSKTKITTSHFPKEVCNNCPHRCNCPLKEQKRDMVVRISKKS
FT                   ILASQVRETVNDPHIKHENISKRAAIEGTNSAIKGCQGAKRLRVRGKIKCTLQIGFKVI
FT                   GHNFKQIFRALTKQIKKPKIKTKGLLCPNPN"
FT   gene            609301..610092
FT                   /locus_tag="Swol_0515"
FT   CDS_pept        609301..610092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0515"
FT                   /product="type I restriction-modification system
FT                   (specificity subunit)"
FT                   /note="KEGG: eba:p2A50 type I restriction-modification
FT                   system (specificity subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67849"
FT                   /db_xref="GOA:Q0AZK5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK5"
FT                   /protein_id="ABI67849.1"
FT                   /translation="MAVTSTTGILNLKLERFVKETEIKYRPLETQKQIAKTLDTVSELL
FT                   AILKQQLAELDNLIKTTFYDMFGDPVTNEKGWEIKTIAEIAEQKLSYGSGASAIEYDGI
FT                   TRYIRITDINDNGSLNDDIVSPSETSAKYNLNDGDILFARSGATVGKTLRYRRSFGRCI
FT                   YAGYLIRLVPKKALVLPDYIYYFTKTDYYKGFIESNMKTVAQPNINAQQYGTFKICVPP
FT                   LNLQTQFAEIVTKTEEQKALVQKAINETQYLFDSLMSGYFD"
FT   gene            610339..613686
FT                   /locus_tag="Swol_0516"
FT   CDS_pept        610339..613686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0516"
FT                   /product="type I restriction-modification system R subunit
FT                   (endonuclease)"
FT                   /note="KEGG: gka:GK0346 type I restriction-modification
FT                   system R subunit (endonuclease)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67850"
FT                   /db_xref="GOA:Q0AZK4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK4"
FT                   /protein_id="ABI67850.1"
FT                   /translation="MSANFDFLKGQAEYTLFATACIEAERVLATSPAMAAMGSRKACEL
FT                   AVKWVYSADNTITMPYRDNLQSLIHEPSFRFVLDNQTWSKLLYIIKLGNLAVHTEKAIS
FT                   RSDAVLSLSFLFEFIQWIDYCYGFNYVERSFDEAKIPAEQVILDVTKLKEIDSLIDQKD
FT                   TEIEALRAKIEAMSPQLTADKEHHKEERHFTPLDISELLTRKKYIDVDLKLLGWVFGDD
FT                   VQEEVELYGMPNPEGKGYADYVLYGKDGLPLAVIEAKRTSKDPKIGTQQAKLYADCLEK
FT                   MTGRRPMMFTTNGFETYLWDDLTSPQRKVSGVFSKADLEKLMNRRNERKPLDEIPIDDK
FT                   ITDRYYQKEAIRAVCENIETGHRKSLLVMATGTGKTRTASSLTDVLSRGGYITNTLFLA
FT                   DRTALVRQAKNDFKTNLPDMSLCNLLINKEDKTARIVFSTYPTMLNAIDSAKNENGQRL
FT                   FTPAHFDLIIVDEAHRSIFKKYRAIFEYFDSMLIGLTATPKQEVDRNTYDFFEMESGVP
FT                   TYAYAYETAVDKDHVLVPYHNIEVRTRFLEEGITYDELSEEDKARYEEDFTDEDGEMPD
FT                   FIPSPAVNEFIFNQCTVDMVLEDLMTKGIKVAGGDRLGKTIIFAQNKKHAEYIVERFNK
FT                   LYPQYHGSFAKRVVCDDNYVQTIIDDFKIAEKEPHIAVSVDMLDTGIDVPELVNLVFFK
FT                   RIRSKIKFWQMIGRGTRLCKNLFGDGQDKTHFLIFDYLGNFEFFRTNKDGVKGNETQSI
FT                   SEAIFAKRVRLIHHLQQSAFMEEPYQAIRTNLIDTVVQQINTLNTELISVKLQLQYIEK
FT                   YKNKDAFVFLSDLDKHDLIVHLAPLVYMDDMDEFAKRFDNFMYGLMIAQIEGAPHFNKG
FT                   KKQLINVCSSLSQRITIPQIKEKIELINNVGTDDFWQNSDILDFEKARIELRSLIKFIV
FT                   DEGGVSPIYTNLNDIVLEVKEGEGLDPAYTFEDYKLKVNRYIEENRDHIAIYKLRNNIP
FT                   LTAFDYNSLEHIFTGELGTPEDYEREYQDTPFGLLVRKIAKMEYEAACAAFSEFINDQS
FT                   LSQGQIVFVKKVIDYIMQNGYIENVSTLMKPPFDKPKSFIKLFDGSKQKQIVEAVNQVR
FT                   DNAVKIVG"
FT   gene            613841..614575
FT                   /locus_tag="Swol_0517"
FT   CDS_pept        613841..614575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0517"
FT                   /product="sigma 28 (flagella/sporulation)"
FT                   /note="KEGG: mta:Moth_1582 sigma 28 (flagella/sporulation)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67851"
FT                   /db_xref="GOA:Q0AZK3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014209"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK3"
FT                   /protein_id="ABI67851.1"
FT                   /translation="MSFLLWALAITGILKGSLCLFAYLNNQVFPQPLSEEDERKCLQEM
FT                   QRGGEEARNILIEHNLRLVAHVVKKYESSGEDLEDLISIGTIGLIKAIRTYNFERGVRL
FT                   ATYAARCIDNEVLMHLRSSKKQKQEVSLYDPIGHDKEGNEISLIDILTNDNEIVDLVEA
FT                   KMQEEKIKEKINLLSRRERQVIEMRYGLFNGLKETQRDIAKKLGISRSYVSRIEKKAIK
FT                   KLIKEIYNRDIDSQDLCQSTEV"
FT   gene            complement(614901..615209)
FT                   /locus_tag="Swol_0518"
FT   CDS_pept        complement(614901..615209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0518"
FT                   /product="glycine reductase complex protein GrdD"
FT                   /note="KEGG: tde:TDE0239 glycine reductase complex protein
FT                   GrdD"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK2"
FT                   /protein_id="ABI67852.1"
FT                   /translation="MLFFIFKGVAAEISKAKQAGWIVEIAKPAQEAAGKEVAPPPEKVV
FT                   DSQIPGIDILELEDAVKVLWKEQIFTSSGMSCTGPVILVAGEDRDKALEILKSNGYL"
FT   gene            615705..619139
FT                   /locus_tag="Swol_0519"
FT   CDS_pept        615705..619139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0519"
FT                   /product="pyruvate carboxylase, PYKA"
FT                   /note="KEGG: cac:CAC2660 pyruvate carboxylase, PYKA"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67853"
FT                   /db_xref="GOA:Q0AZK1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK1"
FT                   /protein_id="ABI67853.1"
FT                   /translation="MKSFRKVLIANRGEIAIRIIRACQELGIRTVSVYSKEDKLALFRT
FT                   KSDESYLIGNNKGPVEAYLSIEEIISLAIKKAVDAIHPGYGFLAENPEFAQKCIESGIE
FT                   FIGPTPEMMDKLGDKIKSKLIAQSIGVPTIPGVEKAIKSDQEAIKFAQKCGYPIMLKAS
FT                   AGGGGRGMRIVRNETDLLQEFHSAKNEAQKAFGIDDIFIEKYLESPKHIEVQVLGDNYG
FT                   NIVYLYERDCSIQRRHQKVIEFAPAFKISAEQRKAICADALKIARSVNYRNAGTVEFLL
FT                   DKQGNHYFIEMNPRIQVEHTVTEIVTGIDIVQSQILIAQGYKLNSKEVGIPRQSAIQTR
FT                   GYAIQCRVTTEDPSNSFAPDTGKIDVYRTGAGFGIRLDGGNGYTGSVISPYYDSLLVKI
FT                   TSWSRTFEDAINKSQRAIRETLINGVKTNEAFLLNVLSHPRFKNGECDTGFIDASPELF
FT                   DITPREDHEAKILNFIGEKVVNESKGVKRDYDIPRVPKINGNYKLNGTKQILDKKGPEG
FT                   VVKWIQSQNKLLLTDTTMRDAHQSLTATRIRTVDMLRIAEATAYLGKDLFSLEMWGGAT
FT                   FDVAYRFLHESPWERLAELRQRIPNIMFQMLLRGANAVGYTNYPDNVVREFIKESAQAG
FT                   IDVFRIFDSLNWLKGMEVAIDETLKSNKIAEACICYTGDILDDRKDKYSLAYYVQTAKE
FT                   IEKMGAHILGIKDMAGLLKPYAAVRLIKALKDEIAIPIHLHTHDTSGNGVATLLMAAEA
FT                   GVDIVDTAFSSMAGITSQPALNSVVAALENTSRATGINLDEIQEIADYWDDIRPIYSQF
FT                   ESDLKSGTAEVYKYEIPGGQYSNLKPQVESFGLGHKFKEVKEMYKAVNEMLGDIVKVTP
FT                   SSKLVGDLAIFMVRNDLTPQNIIEKGKGMAFPDSTIAYFEGMMGQPVGGFPEALQKVVL
FT                   KDKQPISTRPGELLKPADFEAIKNYLQEEYNLPAIRQDILSYALYPKVFEEYLEFKKSY
FT                   GDLSRMNSSVFFDGISQGEVCEVELEEGKTFIIKLVNIGKVNKEGYRKIYFEVNGNQRE
FT                   ITILDKQYHKTFDVEIGSTLMADPNNKKDIGASIPGTVVQILVKAGDSVEAGQSLIIIE
FT                   AMKMETRIAAPVSGKVGNITVQEGQQVKNGELLMQLE"
FT   gene            620319..620669
FT                   /locus_tag="Swol_0520"
FT   CDS_pept        620319..620669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0520"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /note="KEGG: aba:Acid345_0343 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67854"
FT                   /db_xref="GOA:Q0AZK0"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZK0"
FT                   /protein_id="ABI67854.1"
FT                   /translation="MPELRKDLLHDKWVLIATEQALEPRFFPINRNGTYVRKDKVCPFC
FT                   AGNESLTPPEIAAVRKDNSVPDSPGWIVRTVPSKYSAFKLEGELQEERSGIYFSCNGLG
FT                   KQEVVIGNSDHN"
FT   gene            620795..622015
FT                   /locus_tag="Swol_0521"
FT   CDS_pept        620795..622015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH3985 transposase (13)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67855"
FT                   /db_xref="GOA:Q0AU13"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AU13"
FT                   /protein_id="ABI67855.1"
FT                   /translation="MNIRQNCIFSFEDALKIQPKSRLEKIINTLDLKPVLCKLDKPGEI
FT                   RVGPKPYPAYAMLNALIAMRLENMGTFTQLVERLTYDPHLRYVCGFEPFGTAPSKSCFS
FT                   RFYSKLAQSGCLETLFTSLVKQAEEMGLLDLSSVAIDATKVEAYEKSVPRKNIIQDGNA
FT                   ADWGIKSDTNGNPIKWFGYKLHIGTDVRSGLPIAMKVTPANCSDSSVALELVEKCCANT
FT                   QSKIVYFLMDAGYDHREIYSVIRDKYHAQAIIALNKRGAKQPPEGFDWDGTPICSARYR
FT                   MVYWGSYQGVNKFRCPHIMGKCDCPFGSAWCSDSNYGMVVKTKVKDDPRLFSSPHRGSA
FT                   NWQKQYNLRTYSERCFSRFKENLGLEDGLNVRKITKVETHAYLCAITMIAAVIAINQDS
FT                   STRSSAA"
FT   gene            622130..622858
FT                   /locus_tag="Swol_0522"
FT   CDS_pept        622130..622858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0522"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /note="KEGG: tma:TM0896 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67856"
FT                   /db_xref="GOA:Q0AZJ8"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZJ8"
FT                   /protein_id="ABI67856.1"
FT                   /translation="MALCYSNICFCYTDFFELCKSLNYEFHQFSQERIELIYRMFKERY
FT                   QALAVDPRIKYIQIYKNQGLFAGASQEHSHSQIVALPMVPLHVTIPASYYQQNQKCLLC
FT                   SIMEQEQENGERIIYESEHFLLLSPYASRFSYETWIIPKEHKEHFGDISEKEISDLART
FT                   LKTFLTIMLDSLSNPSYNIVINTGPVNGVSSEGAHWFMEVNPRFIVTNGFEMATGYYTN
FT                   PVAPELSAALLRQRMLENHQ"
FT   gene            622874..623398
FT                   /locus_tag="Swol_0523"
FT   CDS_pept        622874..623398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0523"
FT                   /product="HAD-superfamily phosphatase subfamily IIIA"
FT                   /note="KEGG: mta:Moth_1559 HAD-superfamily phosphatase
FT                   subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67857"
FT                   /db_xref="GOA:Q0AZJ7"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027706"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZJ7"
FT                   /protein_id="ABI67857.1"
FT                   /translation="MFEFLYPQIYVKSLLDIPLDKLREIKINTFILDLDNTITEWNRRE
FT                   VRQEIAEWFENIKGQGFKACILSNNGEQRVLAVARSLGIPYLHRAQKPRRRAFFQALSL
FT                   MESQAAETAVIGDQIFTDVLGGNRAGLFTILVVPLDKREFPGTKISRCLEYFVLRRLRQ
FT                   ELVVGRRTSDE"
FT   gene            623557..624429
FT                   /locus_tag="Swol_0524"
FT   CDS_pept        623557..624429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0524"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: mka:MK0117 shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67858"
FT                   /db_xref="GOA:Q0AZJ6"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZJ6"
FT                   /protein_id="ABI67858.1"
FT                   /translation="MPLDIKTELMGLIGYPLQHSLSPLMHNLTLKKMGLNCIYLALEIE
FT                   EGKLPEIPSAIRTLNFRGLNVTIPYKEKIIPFLDELSPEAAAFGAVNVIKNKNGHLHGY
FT                   NTDGRGFVEALREEGIDPGERALFIGAGGAARSVAFALAGLGVSRLDFLDLDFSRARQL
FT                   AEFITSRSSSLASAFLMNTLEFQRLSRTASIIINCSPVGMFPDTGKSPVSKEDLRGSRA
FT                   VLCDLIYNPLQSRFLSLGQELGLETMNGLGMFVQQGALTLEILLGQKPPLDYMKEVVQN
FT                   QLEKRVDPD"
FT   gene            624458..624856
FT                   /locus_tag="Swol_0525"
FT   CDS_pept        624458..624856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0525"
FT                   /product="pilin assembly protein"
FT                   /note="KEGG: sat:SYN_01761 pilin assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67859"
FT                   /db_xref="GOA:Q0AZJ5"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZJ5"
FT                   /protein_id="ABI67859.1"
FT                   /translation="MVLALAAPEFSTIIQKQRLQSDAQRMSRVLRMARQEAISCGQSQV
FT                   IYFYTSDTKYKVKNGSTYQLSPGITYLGLTTFAKHDNKAACIFLPSGVPSHAGTVTLEN
FT                   QKGERRYIIVSVAAGRIRVSDKPPLNWE"
FT   gene            624867..625373
FT                   /locus_tag="Swol_0526"
FT   CDS_pept        624867..625373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67860"
FT                   /db_xref="GOA:Q0AZJ4"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZJ4"
FT                   /protein_id="ABI67860.1"
FT                   /translation="MLFELIFIFLARVLDVSLGTVRMILVIRGDRIPAAIIGFFEILIY
FT                   TVALGLVIGSLNEPLKLLVFCSGFALGILLGSILEEKIALGYRGVQVTIDSEHGHIVEE
FT                   LREEGFPVTCWEASGKAGSKLVLNIFLKRNMAVAVADKIYEKDPDAFVVFMEPKHFQGG
FT                   YIKKK"
FT   gene            625384..626574
FT                   /locus_tag="Swol_0527"
FT   CDS_pept        625384..626574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0527"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="KEGG: aae:aq_081 chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67861"
FT                   /db_xref="GOA:Q0AZJ3"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZJ3"
FT                   /protein_id="ABI67861.1"
FT                   /translation="MVLRFITSGESHGKGLIGIVEQMPAGVEIGEEDINRELQRRQKGY
FT                   GRGGRMKIESDRVEIFSGIRNGYSLGTPISYLIRNQDFENWQEIMATGECKRHEEKIVN
FT                   RPRPGHADLAGAMKYNQSDMRNILERASARETAARVAAGAMFKKLLESFNIRVYSQVKS
FT                   IGPVQVKTWQVNEQNWQDLREKVDESPLHSVDTEKEPLMREAIDQARSKGESLGGSFEV
FT                   GVIGVPPGLGSYISWESRLDSQICALLMSIPAIKAAEIGEGIANSAEPGSRVHDEIFYS
FT                   EEGGLHRKSNRAGGIEGGISNGETVWARAYMKPIPTLYKPLTSVNTKLWQEEKADIERS
FT                   DICAVPAAAIVGESMLAFAIARAFLEKFSGDSLDEIRKSYTTYQAYLKRVWKWEKI"
FT   gene            626559..627065
FT                   /locus_tag="Swol_0528"
FT   CDS_pept        626559..627065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0528"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="KEGG: tte:TTE1275 Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67862"
FT                   /db_xref="GOA:Q0AZJ2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZJ2"
FT                   /protein_id="ABI67862.1"
FT                   /translation="MGKNIVLIGFMGTGKSSVGQRLAEKLKMAFIDMDREIEKITGLSI
FT                   NQIFRKHGEIRFRSEEKLLAQKLGHESNLVIATGGGVVLRQENIEALRENGILICLEAS
FT                   PEEILKRVKRKKASRPLIKKEYGEEEIKAMLEEREAFYACTDFRINTNNKEPREIVEEI
FT                   TRRLR"
FT   gene            627081..628181
FT                   /locus_tag="Swol_0529"
FT   CDS_pept        627081..628181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0529"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="KEGG: mta:Moth_1555 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67863"
FT                   /db_xref="GOA:Q0AZJ1"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZJ1"
FT                   /protein_id="ABI67863.1"
FT                   /translation="MYSLRELEVSLGERSYPIYIEGGLLKSSGILLRQVSRTDKILLVS
FT                   NPTVFALYGRKVQEAMEKQGFSVSVALMPDGEQYKNQEEAFKVLDQAVEAQLERSSLVL
FT                   ALGGGVVGDLAGLVAALYQRGIDYVQIPTTLLSQVDSSVGGKVAINHPQGKNLIGAFHQ
FT                   PRMVIIDYLTLATLDKREYKSGLAEVVKYGIIHDINFFDYLESHAEAIKAQEAGSLEKI
FT                   IYESCRIKSEVVAKDERETGLRAILNLGHTFGHSLEKLGNYSRLRHGEAVAMGTIAASF
FT                   LAREKNYLTVDELERIIKLYRCLGIPIRWPDFEPPAIYEGMLNDKKVINHKLRLVLPRG
FT                   IGNFVLSEDISREELLAAIRQAQNSL"
FT   gene            complement(628591..629910)
FT                   /locus_tag="Swol_0530"
FT   CDS_pept        complement(628591..629910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF2239 A. fulgidus predicted coding region
FT                   AF2239"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67864"
FT                   /db_xref="GOA:Q0AZJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZJ0"
FT                   /protein_id="ABI67864.1"
FT                   /translation="MADELWRYYYFLEDDADNFTPLKEILQKNKVNYYPNYSFKLLEEE
FT                   KSFSYQLKQDNLCILVLCCLVEKSDWANCLASIEAWEEESGINTADIIAETSVFLSTKM
FT                   AWDEFLLFTQKLSRQKEALNIGIEEGQMARLCRLWPQGKAFYACHLDKYTRQNRNFLGS
FT                   ELPLLEASLLRLRMISSFLREQKNTVLREREQLDQELSAILHTQLVMEKGSMEEAMELE
FT                   EQVEGLSRAYGKIAGDYNTLLSAAKRLSSLLQSFKQQISSLRGADLSEGFISDMINPYL
FT                   IRLREIEEAQNSVIISRENHRAAIEVARSKIDIMNARSNIATQKEIRNLMQLNVTIQKQ
FT                   SLVFQYAAGLIEFIVLAYYSHSLWSHLAHGAYAVIPGWIQFLVVIAFSGNTVYCTHLMA
FT                   EYMQGDHHVKNKLIAAAIPLFLILLIVIAASSLLSSPLPH"
FT   gene            630309..631562
FT                   /locus_tag="Swol_0531"
FT   CDS_pept        630309..631562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0531"
FT                   /product="type II secretion system protein E"
FT                   /note="KEGG: mta:Moth_1554 type II secretion system protein
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67865"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI9"
FT                   /protein_id="ABI67865.1"
FT                   /translation="MSKNLLGNYPQDDNFVNIRKNPRFLKLDQDAPIVLLVNSILTQAV
FT                   EEGCSDIHIEPEQQDIRLRFRLDGELYEAARLPLSLLSPIVSRIKIMAGMDISEKRLPQ
FT                   DGRFRATIEEREVDFRTSTLPTAWGEKLALRILDRANALTEIRQLGFSSNNQANLLALS
FT                   HCSQGMVLVTGPSGSGKTTTLYSILTQINSIEKNIITLEDPVEYTLPGVNQVQINPKAG
FT                   LTFASGLRAILRQDPDVIMVGEIRDRETARLAVQAALTGHLVFSTLHTNSAAGSITRLR
FT                   DMGIEDFLLASSLAGVVSQRLVRKLCCYCRQEYTIEEQLAKKLGLPLDIGRVFFRSKGC
FT                   RACRNTGYRGRIALQEIMLLGSEIRDLLNRGESSEDRLQKTAIKNGMISIMLDAITKAR
FT                   EGRSSLEEVMKTIFMGGL"
FT   gene            631564..632616
FT                   /locus_tag="Swol_0532"
FT   CDS_pept        631564..632616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0532"
FT                   /product="twitching motility protein"
FT                   /note="KEGG: mta:Moth_1553 twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67866"
FT                   /db_xref="GOA:Q0AZI8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI8"
FT                   /protein_id="ABI67866.1"
FT                   /translation="MAFIKLEEILKKAVEMGASDVHLGYSQPPLYRVNGHLVSLPEDLL
FT                   LGKEEVQSLAREIIPHKGIMEAFQKQGEVDFAYSIPGIARFRVNLFKQRSSWALAIRII
FT                   PLKIPEWDELGLPPIVRELAMQEKGLVLISGSSGSGKSTTLAAMIDLLNQSRKFHILTL
FT                   EDPIEYLHSNHNCIVNQREIGADSKSFPQALRAALRQDPDVIMLGEMRDLETISTTITA
FT                   AETGHLVLASLHSGTAIQTLERIIDIFPPHQQTQLRLQLANCLQGVINQQLLCRADGKG
FT                   RILAVEVMIATPAVRNLIRENKIHQIYSSMQTGSSFGMVTMEKAMQELWHQRLISDEEA
FT                   SKQGLVWGRS"
FT   gene            632684..633892
FT                   /locus_tag="Swol_0533"
FT   CDS_pept        632684..633892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0533"
FT                   /product="type II secretion system protein"
FT                   /note="KEGG: mta:Moth_1552 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67867"
FT                   /db_xref="GOA:Q0AZI7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI7"
FT                   /protein_id="ABI67867.1"
FT                   /translation="MEFTYKVRDSRGKVLRGLQEAKDRDSLIRNLLRQGYYIISLQEVN
FT                   RTSPVINRELFSLKVSKKEVLMITRQFLAMLTAGFSIIKAFKVMGQKNRNRTLKKALLK
FT                   IHDDIEQGQALWVALSQHPKVFSSIYINMIKAGEMGGTLETVLKNLSHHLEREQDINAK
FT                   IKAASIYPLIITLMALLVIFFIISFIMPAFVNVFASAGAEIPLPTQLLLNLGLFLNKYW
FT                   IALLLAIIAIALIHRIWIQTNPGKQFTDKFLLRLPLWGTFLSRIIAAHFARIMAILLQA
FT                   GIPILQALEVAGGVVGNEVVIQAIRQAGREISEGKSISVPLEATAIFDTMFAQMIAIGE
FT                   ESGSLDSMFAQIADYYEQEVIYTINILLAAVEPVMIIFVAILVTGIIIATILPVFDLMK
FT                   IMA"
FT   gene            633974..634396
FT                   /locus_tag="Swol_0534"
FT   CDS_pept        633974..634396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1265 type IV pilus assembly protein
FT                   PilA"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67868"
FT                   /db_xref="GOA:Q0AZI6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI6"
FT                   /protein_id="ABI67868.1"
FT                   /translation="MLKFLDLGQRKVGEKGFTLVELILVMAIVGILAGLAVPRFTGVLE
FT                   TAKEKADEANKKIIREAAELWYMQTGQTGKIPENGNAVPLSNDTFFRAEGQTGEKLVPD
FT                   FLKEIPENPMDTGEYRLKIDEGGKAIVTHAKDTAKD"
FT   gene            634489..634920
FT                   /locus_tag="Swol_0535"
FT   CDS_pept        634489..634920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67869"
FT                   /db_xref="GOA:Q0AZI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI5"
FT                   /protein_id="ABI67869.1"
FT                   /translation="MSRKIQRSWPGQEAMTLLEVLLALVIFTIISNMALAIFSTTTIWI
FT                   KHSRYESTATYYAASLLEELREKPEKIKSVSMAEPEILGLGEGYTPAIPPGISARIDME
FT                   KVDALDRLYRIRVTLSWYEGEQKQKLCLLTMMRKGESGL"
FT   gene            634917..635387
FT                   /locus_tag="Swol_0536"
FT   CDS_pept        634917..635387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67870"
FT                   /db_xref="GOA:Q0AZI4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI4"
FT                   /protein_id="ABI67870.1"
FT                   /translation="MNRYSSQGFTLLEVLLALSLVSLVGSGLFLLNWLMFTGSERQSAA
FT                   CEAHHYARTAMQWITRDILSSCPPQGGSSLNSEQLILHLPVEGKPAEEIHYFLHSNNLR
FT                   RNNLALVQNINYLNFQSSSDSDLITITVESSVNNEIYRLSTAVRSRISTTPE"
FT   gene            635439..635951
FT                   /locus_tag="Swol_0537"
FT   CDS_pept        635439..635951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67871"
FT                   /db_xref="GOA:Q0AZI3"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI3"
FT                   /protein_id="ABI67871.1"
FT                   /translation="MNAFKNEDGALMLMALMVMLLCTIWGIAAIELASIEKKLSFYLFQ
FT                   SQQAQQAADGGVEWAIEEIWHRGLPAEFEEEVTISDGIKAQIKVTEKAEEFACSPVDLE
FT                   SNNGKPQEDELQESGKKKCRYCLTSTAVYNQAKKKLKVKLLYTYTASSPQPYESAVIEY
FT                   YCLETDS"
FT   sig_peptide     635439..635540
FT                   /locus_tag="Swol_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.708) with cleavage site probability 0.374 at
FT                   residue 34"
FT   gene            636004..636756
FT                   /locus_tag="Swol_0538"
FT   CDS_pept        636004..636756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0538"
FT                   /product="type 4 prepilin peptidase 1. Aspartic peptidase.
FT                   MEROPS family A24A"
FT                   /EC_number="3.4.23.43"
FT                   /note="KEGG: tte:TTE1266 leader peptidase (prepilin
FT                   peptidase) / N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67872"
FT                   /db_xref="GOA:Q0AZI2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI2"
FT                   /protein_id="ABI67872.1"
FT                   /translation="MYYYVLMAIFFLLLASFLNVVIYRLPRGESLLYPSSRCPACGHRL
FT                   YLLDLLPLLSFILLRGKCRYCRESIPAQYLLVEIITPILWMLVFLKWGFSMQTFSGVVL
FT                   TAILVAAAFTDINKGIIPDTLSLTGLLLGLGLGFVTIGIKQSLLGAVGFGLIFLFIALI
FT                   SRGGMGGGDIKLAALIGAFTGFSGALMVILISSWLGGLWAVVLLIQGQAGLKTAIKFAP
FT                   FLAIAAWLVWMYQIELISFYRDMLWRLC"
FT   gene            636741..637802
FT                   /locus_tag="Swol_0539"
FT   CDS_pept        636741..637802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0539"
FT                   /product="Tfp pilus assembly protein ATPase PilM-like
FT                   protein"
FT                   /note="KEGG: dra:DR0770 fimbrial assembly protein PilM,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67873"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI1"
FT                   /protein_id="ABI67873.1"
FT                   /translation="METLLNAKKFSKQFSSNEGGGIVMLFRATGIGLDIGSKKIKLARV
FT                   KKVKKGLELMDFASMPTPNGVIEYGKIIAPVELGKAISSLVKEMGWKGQKVISALSNQE
FT                   IFFDNFILPRMNRRESRKAALYQSSSFLPFPLDEAAFDIFFLREIENGQGRKREVFFAA
FT                   AQSLQVEHLKKVCTLAGLRLTVVEIPALALNRLWNNNNGKDLTVFLNIGYSYACFSVFQ
FT                   QEKLLFQRSFVSFLEGMIDILGDNILLEEVDITENLQLQELMEEFLARVKQMLSLFQPQ
FT                   EREMIIARILLCGGGAKLKGLAGYLSMVLNAIVPTLNLPATLALPPKFEQYKQELSCDF
FT                   SVAIGLASRGVLG"
FT   gene            637883..638347
FT                   /locus_tag="Swol_0540"
FT   CDS_pept        637883..638347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67874"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZI0"
FT                   /protein_id="ABI67874.1"
FT                   /translation="MLLLLLSGGMYYYYQSAHEEMLLQQKLNINLEARAKELLPIARAG
FT                   RMEEKNEENAWRKRKFLEETRLQQISYVAVFKEIERSLSPGILLLGIEMEKGRIAIQGY
FT                   AADNQELSFLMAGIREKSSFGNPVLLSSSLDENKEEIEFRVEINWGEEAD"
FT   gene            638344..639138
FT                   /locus_tag="Swol_0541"
FT   CDS_pept        638344..639138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1274 Fimbrial assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67875"
FT                   /db_xref="GOA:Q0AZH9"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH9"
FT                   /protein_id="ABI67875.1"
FT                   /translation="MKLSKREIVLSCFLGFMVIIYFYYRFCLIPLEEETERLRDENQAL
FT                   QMKIQQDEKLIQSHIEYDSAYLLPKESDNMEIAIPSSPCVPEILSFFHISAKENGISIS
FT                   ALRYSLLGSVAGQKEKTGPSSNEEGKFQELELSISAKGTYLSLLNFISAIEESPRVFVI
FT                   KHCKMSRNRVQAAKEAIAQTESQEEKNKSQYQYVSEEEEIPPTPSVQSLQSSTAYEAED
FT                   IVLNLSISSFFDQSALPSLAGKKEGNAYSQLQGVRNPFFRAD"
FT   gene            639262..640689
FT                   /locus_tag="Swol_0542"
FT   CDS_pept        639262..640689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0542"
FT                   /product="microcin-processing peptidase 2. Unknown type
FT                   peptidase. MEROPS family U62"
FT                   /note="KEGG: mta:Moth_1542 peptidase U62, modulator of DNA
FT                   gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67876"
FT                   /db_xref="GOA:Q0AZH8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH8"
FT                   /protein_id="ABI67876.1"
FT                   /translation="MLERSVLQRALDEAMKKGGDFAELYYEEKQMSQVIYEDERVDKIT
FT                   SGREKGAGIRVIKEGNTAYVYTNDLSEEGLLKAAATAGKALGKAEPAQEKALSLSSQEP
FT                   AIGRISRDLLWDLTYADKINQLLAANQVVRDLGEEIRQVTMALSDIHKEIQIANSDGEL
FT                   LEDAYSRVRLGVNAVASRNGLIQSAYESAGAVSGWEILDKIDFTTMAEKAGRLALKMLS
FT                   AAPAPAGSMPVVLAGEAGGTMVHEACGHGLEADLVQKGLSVYQGKYGEMVAAPGVTVID
FT                   DATLEGHYGSFRMDDEGQAAERSVLIQDGELQGFMYDRLTANREKKDSSGNGRRESYQH
FT                   KPIPRMSNTFIAPGREEAEKIIKATPRGLLVKKMGGGQVNTINGDFVFDVQEAYLIEGG
FT                   EIKEAVRGATLTGNGPRVLRDIDMLGNDLGFTIGVCGKDGQGVPVSDGQPTMRIKELTV
FT                   GGTASPGGPQMKKIKRK"
FT   gene            640699..642039
FT                   /locus_tag="Swol_0543"
FT   CDS_pept        640699..642039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0543"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="KEGG: mta:Moth_1541 peptidase U62, modulator of DNA
FT                   gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67877"
FT                   /db_xref="GOA:Q0AZH7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH7"
FT                   /protein_id="ABI67877.1"
FT                   /translation="MEDLLREAGERALQAAHKKGIQAEVFLSQQRSMNLELRDGQVETL
FT                   KKAEEMGLGLRLLNAGRLAFVYSADLSMEAIEQAVNDAVDISRYTPADGWNSFPAGPYL
FT                   YSTMELYDENIPVSPLEEKIEMAQAAEEAARRSDKRVKFIEKSGYEEGEYNSLLMNSHG
FT                   LYAWGKANYTLLYLSLVAREDDESQSGFSMMIKRKIKDLEAEAVGEEAAMRAVRGLKSR
FT                   RIDSASLPCIIEPYVMARFLGLIAHLVSAEAVQKGKSLLAGKIGEKIASGVLSISDDAT
FT                   LGEGLGSFPFDGEGVPSRKTPVIRDGVLMTYLYDHYNACKAGVESTGHGRRASFRHLPA
FT                   VGSSNFILEAGEESPEQMIATVDKGLYITEIMGLHTANPVSGDFSLGAAGLLIEKGALS
FT                   YPVRGITIGGNLLDFLQNIDAVGNDQRSFGARFAPSVRLRSLSVAGN"
FT   gene            642052..642510
FT                   /locus_tag="Swol_0544"
FT   CDS_pept        642052..642510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0544"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: sth:STH1866 3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67878"
FT                   /db_xref="GOA:Q0AZH6"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH6"
FT                   /protein_id="ABI67878.1"
FT                   /translation="MNLKICFINGPNLNMLGIREPEIYGESSLAEIEKEMQILAQQQGA
FT                   EIDFFQSNHEGKIVDYIQEARDRFDCILINAGALSHYSIAIYDALKAVEIPVIEIHLSN
FT                   IYARESFRQQSLISPLAVGGVFGFGALSYKMAFLAACELLAAGQKGKG"
FT   gene            642520..643593
FT                   /locus_tag="Swol_0545"
FT   CDS_pept        642520..643593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0545"
FT                   /product="aminopeptidase P"
FT                   /note="KEGG: chy:CHY_1873 aminopeptidase P"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67879"
FT                   /db_xref="GOA:Q0AZH5"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH5"
FT                   /protein_id="ABI67879.1"
FT                   /translation="MDSIFSKRLLRLYKLLQEKEIEAFLVSKGENIRYLSGFTGGSDAR
FT                   LLISPGEKYILTDSRYQEQVEQECPDWQLLVERPPGLKQLVELSQAYKRIGVEAHAISY
FT                   SFFMELQQSLTSDLQPVSQLIEGLRQVKDEAELKLIRESARIADAVFSDICLKLKPGIS
FT                   ERDIASEIVYLLRQKGCDKESFDVIVVSAENAALPHGQPGNRRLVPGDMVTLDFGGFYE
FT                   GYTADMSRTIAISKASARLQELYQALLLAQEKGIAMVRAGQSCREIDWAVRESLKAYGL
FT                   DQYFIHGTGHGLGLEIHEQPRLSPLSEAVLEENMVVTIEPGIYIAGWGGLRIEDSVIVK
FT                   DQYGEVITRSEKNLLVL"
FT   gene            643776..644333
FT                   /locus_tag="Swol_0546"
FT   CDS_pept        643776..644333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0546"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="KEGG: mta:Moth_1538 translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67880"
FT                   /db_xref="GOA:Q0AZH4"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZH4"
FT                   /protein_id="ABI67880.1"
FT                   /translation="MISVNDFKTGVTIELEGQAFQVVEFMHVKPGKGSAFVRAKLKNVK
FT                   TGGTVEKTFRGGEKVPRAHLDKREMQYLYNDGEGYVCMDTENYEQISISKESIGEGAKW
FT                   LMENMILGVLFFQGNIIGVDLPNFVEMLVVDTEPGVKGDTATGAVKNATLESGAVVQVP
FT                   LFVNTGDRLRIDIRTGEYMERV"
FT   gene            644564..644998
FT                   /locus_tag="Swol_0547"
FT   CDS_pept        644564..644998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67881"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH3"
FT                   /protein_id="ABI67881.1"
FT                   /translation="MQDISEKVSYLQGLSEGLNIREGSPQGKIISGVLSVLDEIAESFL
FT                   VMQDRFDELQEYVESMDTDLQELEEKWSEELDFAEEIRCSHCGELICFDPEVLDDEDVV
FT                   EIICPYCDEVVFVNDGSFDYQPSFIGDEKGENEEHSGAPI"
FT   gene            645213..645494
FT                   /locus_tag="Swol_0548"
FT   CDS_pept        645213..645494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0548"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="KEGG: chy:CHY_2536 nucleotidyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67882"
FT                   /db_xref="GOA:Q0AZH2"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH2"
FT                   /protein_id="ABI67882.1"
FT                   /translation="MNPADCIREHMPELRNEYLVSKIGIFGSFARGEASNASDVDVLVE
FT                   FSRPVDIFHFIGLQDRLAEILGRQVDLATIRALKPLIKEQILREVLYL"
FT   gene            645491..645829
FT                   /locus_tag="Swol_0549"
FT   CDS_pept        645491..645829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_2535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67883"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH1"
FT                   /protein_id="ABI67883.1"
FT                   /translation="MTRDLRLYLQDIVDSIEKIQRYTENMTFAEFELNNMAIDAVIRNF
FT                   EIIGEATGHLPDELYDKNPEIPWHKMKAMRNIMAHEYFRVDLEIIWNTARESLPPLAEK
FT                   IMYLSRLM"
FT   gene            646005..646946
FT                   /locus_tag="Swol_0550"
FT   CDS_pept        646005..646946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0550"
FT                   /product="stage III sporulation protein spoIIIAA"
FT                   /note="KEGG: tte:TTE1283 stage III sporulation protein
FT                   spoIIIAA"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67884"
FT                   /db_xref="InterPro:IPR014217"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZH0"
FT                   /protein_id="ABI67884.1"
FT                   /translation="MDGQALKQAVTPYFAGVLHEGLSRLKAEVYQEMEEIRLRAAQPLL
FT                   LKIGESEWGLTSRGELTKKLPEAINASREDLYRTIASISDNSLYALEEEIRRGFITIPG
FT                   GHRVGLAGQVIVQAAGIKGIKEFSSICFRLAREKKGCARTILPHIISTGTIVNTLIISP
FT                   PRCGKTTILRDIARSISTGSSACPPHNIAIIDERSEIAGTHRGLAQLDVGIRSDVLDAC
FT                   PKSWGMMMAIRSLSPQVLIADEIGRKEDVEALQECVNAGVAVICSIHARNLEELSKRPL
FT                   IKKLLSQGAFRLGVVLSRRNGPGTVEEIIRWD"
FT   gene            646948..647472
FT                   /locus_tag="Swol_0551"
FT   CDS_pept        646948..647472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67885"
FT                   /db_xref="InterPro:IPR014198"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG9"
FT                   /protein_id="ABI67885.1"
FT                   /translation="MLGLKLMGAASIITGFGCWGLKAARRMDRRVEQLQELRLALGFLE
FT                   KEISCIYSPLSQALAKTADFSRPPVSYLFAASSSLLQEKTGMTAAEAWNAGIEGLRLHS
FT                   DLQEMEIGLMATASLQLGISDASQQKKLLTLLQEELALLEQKAMQQAEGGRKMWTYSGF
FT                   ILGAMVVLLLI"
FT   gene            647613..647807
FT                   /locus_tag="Swol_0552"
FT   CDS_pept        647613..647807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67886"
FT                   /db_xref="GOA:Q0AZG8"
FT                   /db_xref="InterPro:IPR009570"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG8"
FT                   /protein_id="ABI67886.1"
FT                   /translation="MDVDIIFRVAGIGILISVLSIVLKQAKKEEQAEMLTLAGVVVVLI
FT                   IVVQLMNQLFSVVRSVFSL"
FT   gene            647952..648344
FT                   /locus_tag="Swol_0553"
FT   CDS_pept        647952..648344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0553"
FT                   /product="putative sporulation protein"
FT                   /note="KEGG: chy:CHY_2004 putative sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67887"
FT                   /db_xref="GOA:Q0AZG7"
FT                   /db_xref="InterPro:IPR014211"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG7"
FT                   /protein_id="ABI67887.1"
FT                   /translation="MKVEIAQVIGLALVTTILLLILRQEKPVMAVVLSITFSIVIFLFM
FT                   MGKMAAIIALMQELTRRAQINYFFMATILKIIGVAYLGEFAAAICQDAGEHAVAKKVEF
FT                   AAKIIIVVLSLPIMVAILESMMELMV"
FT   gene            648373..649557
FT                   /locus_tag="Swol_0554"
FT   CDS_pept        648373..649557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67888"
FT                   /db_xref="GOA:Q0AZG6"
FT                   /db_xref="InterPro:IPR014194"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG6"
FT                   /protein_id="ABI67888.1"
FT                   /translation="MKKYFLLFLLLITGILIFSFPAWAGEIDNESEQVAPLETTLKNLN
FT                   LSVFDEYKKNIDEEISSSMKGKTVKELLLDFSQGQLDLKIQDIMGGILQLFFKEVRANS
FT                   GLMAKLLVLSVLTALLVNLQNSFSSGVAQISYLSCYLALGAIALGSFRLVLEIGHQSIN
FT                   NMVAFMMGMLPQMLVLTAGLGNINASAMLFPILMTTATAFANAIKNVVFPLIIMSAILS
FT                   LLNHMSISLKVEKLASFFGQMARVSLGFCLTIFAGFITLRALYASVLDKVALRTTKFVT
FT                   DNAIPVVGKILSDTIEVTAGYVVMLKQALGFLGVLIIIGIIALPLIKVAAIALIYKITA
FT                   AVVEPLGDAKTAAILDIMSAHIFLMLAALASVGLMFLIMISIVAGMSNGLGALR"
FT   sig_peptide     648373..648447
FT                   /locus_tag="Swol_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            649575..650159
FT                   /locus_tag="Swol_0555"
FT   CDS_pept        649575..650159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67889"
FT                   /db_xref="GOA:Q0AZG5"
FT                   /db_xref="InterPro:IPR014245"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG5"
FT                   /protein_id="ABI67889.1"
FT                   /translation="MQLLQEIVRNVLVIIILTSFLELLLPEGGVRPFVRFAVGMFIIIA
FT                   VLNPVLSLLFSERELKVNLWDYQLEEGKSEEIIDNGKQIQQEIIAQHNEIAREKLQGQI
FT                   DAVAVLVPGVEEVKSEIEIGQDGKVQAVNILLQSGSPEIKKGQDGIEVFSGENSNLSRE
FT                   EKKVIEDKVISIIGNFYGLSTSQIKVEFEGG"
FT   gene            650163..650744
FT                   /locus_tag="Swol_0556"
FT   CDS_pept        650163..650744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1530 stage III sporulation protein
FT                   AG"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67890"
FT                   /db_xref="GOA:Q0AZG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG4"
FT                   /protein_id="ABI67890.1"
FT                   /translation="MLDEWLRKSQDGPGRNSWFSGKKNRYILVILICFGLLALIWPMSK
FT                   VEKNPPAPASGEHQREEARSVKSQMAGELEAILSEINGAGKVEVSLSLSSDGHKTFASN
FT                   RRDEKRETEESQTRGIKKNSSEESRVEDLAVSSGAPVLVEERFPEVLGVLVVADGGGRA
FT                   EVKERLTDATATLLNISPHRVRVMPRKGGE"
FT   gene            650749..651324
FT                   /locus_tag="Swol_0557"
FT   CDS_pept        650749..651324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1290 stage III sporulation protein AH"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67891"
FT                   /db_xref="GOA:Q0AZG3"
FT                   /db_xref="InterPro:IPR024232"
FT                   /db_xref="InterPro:IPR038503"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG3"
FT                   /protein_id="ABI67891.1"
FT                   /translation="MKKERNIRPLLLRIRLKNICLIIVIFVLLLFGTIWIINGKEERTA
FT                   ILPLSEENKILEEFSAADLSQVNKKETAPNDFFSTYRLDRERIRGKQLDILKAIMENKD
FT                   SDDKAREVASLRMVKISEEMEKEMRLESLVKSEGIEECVALVQAGTATVIVPAGTLNPQ
FT                   REEGLREILLSLADFPEDKVWLKEAGKE"
FT   sig_peptide     650749..650868
FT                   /locus_tag="Swol_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.661) with cleavage site probability 0.497 at
FT                   residue 40"
FT   gene            652052..653962
FT                   /locus_tag="Swol_0558"
FT   CDS_pept        652052..653962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0558"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /note="KEGG: chy:CHY_1999 oxaloacetate decarboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67892"
FT                   /db_xref="GOA:Q0AZG2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG2"
FT                   /protein_id="ABI67892.1"
FT                   /translation="MELGKIKITDTSLRDGHQSLWATRMTTEDMLPILENIDEVGYHSL
FT                   EVWGGATFDVCIRYLNEDPWERLRKIRRGIKKTKLQMLLRGQSIVGYTHYPDDIVEKFV
FT                   EKAAENGIDIFRVFDALNDIRNLETCMRAAKKSGKHVQACVVYTVSPVHTMQHFVETAL
FT                   RLKDMGADSICIKDMAGLLSPYASFELVKALKDNVQLPLQLHTHYIGGLAIAALLKAAE
FT                   AGVDIIDTASVPMAFGSSQPPVETIVRALQDTPWDTGLDLHALFNIATHFEQIRKHKGF
FT                   ERGVTRIADMKVFEHQVPGGMITNLYSQLEEQKASHRIDEVLAEIPRVRADLGYPPLVT
FT                   PTSQIIGIQAVLNILMGERYKLCPGEVKDYVRGYYGKPAVAIKDEIRKKIIGDEEVITV
FT                   RPADLLEPAWERSRQELGELAESEEDILTYALFPQVALKFFEYRKNRGAEDIPQISSID
FT                   TLGEELLDEEAPVAIPPVVSRVKKVAAHGGDDEMKIDEIRELILLMDQSSISELEVQKD
FT                   AYRLSLRKGNGPAIDKAATAAPMNLPPALSSEAAKLEQDNFTEILAPMVGTFYAAPSPD
FT                   SPPYVQPGDHVSPGQTLCILEAMKLMNEIKTEFAGTIIEIMVDNAEAVEYGQVLFLIEK
FT                   D"
FT   gene            653973..655322
FT                   /locus_tag="Swol_0559"
FT   CDS_pept        653973..655322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0559"
FT                   /product="biotin carboxylase / acetyl-coenzyme A
FT                   carboxylase carboxyl transferase subunit alpha"
FT                   /EC_number="6.3.4.14"
FT                   /note="KEGG: dsy:DSY2366 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67893"
FT                   /db_xref="GOA:Q0AZG1"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG1"
FT                   /protein_id="ABI67893.1"
FT                   /translation="MFSRVLIANRGEIALRIIRACKELGIETVAVYSVADKDSLHVKQA
FT                   DEAICIGGAPARQSYLNISNIIAAAQNSGAEAIHPGYGFLAENSHFASLCSSYNIKFIG
FT                   PPPEVIELMGDKVQARELVKSVGVPVVPGSDGAVQSYKEALAVAREIGYPVMIKASAGG
FT                   GGKGMRLAHNESSLKNALEMARMEAGAAFGNDEIYLEKYIEEPRHIEFQILGDQLGNLI
FT                   HLGERDCSLQRRNQKLLEEAPSSLLDEALRQQMGKVAVDAARAAGYSSAGTVEFLVDKN
FT                   KKFYFIEMNTRIQVEHPVTEMVTGIDIIKEQFRIAAGEELSYQQEDIEIRGWALECRIN
FT                   AEDPACNFQPSPGQVGQYIIPGGPGIRVDSSVYSGYHIPPFYDSMVAKLIAWGRNRDEA
FT                   IQRMKRALGEFEVENINTTIPFHLEVLDNAFFRKGEVYTNFIQRRMSDKA"
FT   gene            complement(655392..655619)
FT                   /pseudo
FT                   /locus_tag="Swol_0560"
FT   gene            655704..656108
FT                   /locus_tag="Swol_0561"
FT   CDS_pept        655704..656108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0561"
FT                   /product="protein of unknown function DUF322"
FT                   /note="KEGG: mta:Moth_1523 protein of unknown function
FT                   DUF322"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67894"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZG0"
FT                   /protein_id="ABI67894.1"
FT                   /translation="MEGQKPEIFNEYGTIRIADEVVSTVAGLAATDVEGVVSLSGGWGT
FT                   DLVEKLGRKNYGKGIKVEVAEDKTRIDIFIVVEFGYPIPEVAEKVQKEVKLAVETMTGL
FT                   SVASINVHIVSVSIKKSPADEEAVSEFIVE"
FT   gene            656178..656717
FT                   /locus_tag="Swol_0562"
FT   CDS_pept        656178..656717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1522 protein of unknown function
FT                   DUF322"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67895"
FT                   /db_xref="GOA:Q0AZF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZF9"
FT                   /protein_id="ABI67895.1"
FT                   /translation="MEKAWRPVLLVYNLLLLSLAGVVVVAAMGRAEPLTFINQALSTPQ
FT                   NRVIVGIVAIVVMAIALVMLVSGLKYENKPDSIIVDSSLAGQVSITVPAIKVIIMKAVK
FT                   KVDGVKEIKPAVSTSNDGLLVYLHTAINPDYNVPEMSKSLQQTVKEHLEDIGGLQVSQV
FT                   KVLVDDFSNPNKAVNR"
FT   sig_peptide     656178..656273
FT                   /locus_tag="Swol_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.618 at
FT                   residue 32"
FT   gene            656729..656953
FT                   /locus_tag="Swol_0563"
FT   CDS_pept        656729..656953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_1995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67896"
FT                   /db_xref="GOA:Q0AZF8"
FT                   /db_xref="InterPro:IPR018730"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZF8"
FT                   /protein_id="ABI67896.1"
FT                   /translation="MGEKLLLLILEEHRGKALGILLGLIASILFISYGFWRSLFVIFCI
FT                   VLGFFIGKRIDENHSFDNWLRQMFRDRQR"
FT   gene            656970..657374
FT                   /locus_tag="Swol_0564"
FT   CDS_pept        656970..657374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0564"
FT                   /product="NusB antitermination factor"
FT                   /note="KEGG: dsy:DSY2364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67897"
FT                   /db_xref="GOA:Q0AZF7"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZF7"
FT                   /protein_id="ABI67897.1"
FT                   /translation="MSRRKARETAFKVVFQVDQVQADAKKAFDYLVLHDKLAEKNQGFS
FT                   WDLIQGTLEKQAEIDQMIASYSREWALDRMSSVDRNIMRVAAYEILYLEDSQAVVAIDE
FT                   AIEIAKKYGDEGSGSFVNAILDKILGEKNG"
FT   gene            657367..658347
FT                   /locus_tag="Swol_0565"
FT   CDS_pept        657367..658347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67898"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZF6"
FT                   /protein_id="ABI67898.1"
FT                   /translation="MDSFLGIDTSAYTSSLALVDEEQNIIADERMILQVGAGKRGLRQS
FT                   EAFFQHIKNLPFLFARLSSYFDAPVKAIGASAWPRRVEGSYMPVFSAGFSQAVVLSSFT
FT                   GIPLYSFSHQEGHIIAGIKGNEALLGRAEFLAVHFSGGTSELLHVRQQQGGLLDISPAL
FT                   AGLDLHAGQLVDRVGVAMGLDFPCGSELEKMARQSSGENLPLMPSSVSDKGFSFSGAET
FT                   RARKLMAEGISYPDIALASLRCIANTLEKSILQESDKKGIKDVLLVGGVMANSIIKERL
FT                   QARLEHPAVGLKLFFASPRLSSDNAVGVALAAQFILRKTEGGRSH"
FT   gene            658361..659194
FT                   /locus_tag="Swol_0566"
FT   CDS_pept        658361..659194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0566"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="KEGG: mhu:Mhun_0022 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67899"
FT                   /db_xref="GOA:Q0AZF5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZF5"
FT                   /protein_id="ABI67899.1"
FT                   /translation="MEIISGSQIAQEIRQKLKEKNEREGISPCLAMILVGGQKEDLHYV
FT                   GLKEKAATATGGKSRLLHLPEDTSQQELMAKIAELNQDEQVDGILLQLPLPAALEEQTD
FT                   EILAAIRPDKDVDGFSLVNRGRMSGDRPGFISCAALACLEVIERFFPSLAGKKAVLVGD
FT                   SFDLIIPLATIMIKRACQLSVLPSYEPGLASGADILVVEKGRAGIVQAEGLAPGVLIID
FT                   AGFYWGAGGVCGNVDRAALERQGFEARLLPVPGGMGPILIAKLMENLAQAARQKR"
FT   gene            659200..660417
FT                   /locus_tag="Swol_0567"
FT   CDS_pept        659200..660417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0567"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: dsy:DSY2353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67900"
FT                   /db_xref="GOA:Q0AZF4"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZF4"
FT                   /protein_id="ABI67900.1"
FT                   /translation="MKEILTVTELNSYIANLLDSDPFLGQLWLRGEISGFRLYQQSGHM
FT                   YFTLKDEDSTISAVMFKSRARGLKFKPKDGMEVLLRASVSVFARQGKYQLYVEEMQPYG
FT                   IGGLFLYLEELKKKLAAKGYFAPERKKAIPAFVQRVGIVTSQDGAALRDICRILKQRHP
FT                   GVEVVLAHSSVQGSEAPGELAEGLRLLNSYAEVELIIIGRGGGSYEDLMAFNSELVVQA
FT                   IYESNIPVISAVGHEVDFTLADLVADLRAATPSQAASLAVADMQALSRQLDNYQQRLLR
FT                   AMQRKLLYYTEIIDRLMMKRIWKQPRSLLHMREELLSQLEKSLSRGMAEIFREKKMKLS
FT                   MNMAALDSLSPLKIMERGYVLLQKEGRIIRDEQQVQIGDRLEVAMRHADLEIEVIKKER
FT                   VKRWKS"
FT   gene            660405..660626
FT                   /locus_tag="Swol_0568"
FT   CDS_pept        660405..660626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0568"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: gme:Gmet_1936 exonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67901"
FT                   /db_xref="GOA:Q0AZF3"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZF3"
FT                   /protein_id="ABI67901.1"
FT                   /translation="MEKLSFELALKKLEESVEQLESGELELEESIKVFEQGIELSLFCR
FT                   KELSQAEGKIQRLVKNLGGEFELLDFEV"
FT   gene            660638..661543
FT                   /locus_tag="Swol_0569"
FT   CDS_pept        660638..661543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0569"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="KEGG: mta:Moth_1513 polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67902"
FT                   /db_xref="GOA:Q0AZF2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZF2"
FT                   /protein_id="ABI67902.1"
FT                   /translation="MNFDLEHFQEEIRQRKEFVDNCLIGCLLSPDSDPPLIHQAMHYAI
FT                   FNGGKRLRPIMVLEGAKIAGGEAEQAIPVACALEMIHSYSLVHDDLPCMDDDDFRRGQP
FT                   TCHRVFGEANAVLTGDALLTAAFELLSEKNSVSGIKPDTTLRVIAEIARASGSRGMIGG
FT                   QILDLEAEGKIIDYESLRKLHCLKTGQLFRAALRTGAIVGGIGEKGLLALSDYADNFGL
FT                   AFQISDDILDVQGDAALTGKSMGSDARKEKNTYPSLLGLEKSRQLLEESIATCLQSLEL
FT                   FGPEAEFLRQLACYTLYRKS"
FT   gene            complement(661678..662238)
FT                   /locus_tag="Swol_0570"
FT   CDS_pept        complement(661678..662238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY1011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZF1"
FT                   /protein_id="ABI67903.1"
FT                   /translation="MDMKKALILSLILLLSFSLFACGVKGNQQQQPGQKEEQQQPAGES
FT                   DEADADSIIYKNTSYGFNFSLPKNWKGYTIVNSQWEGLATGDAQEAAIVETGPMISIRH
FT                   PQWTVDNPRQDIPLMVFTTIQWNSLQENKFHIGAAPIGPKELGSNAKYVFALPARYNFA
FT                   FPTGYEEVEEILENNPLQPVEYP"
FT   sig_peptide     complement(662173..662238)
FT                   /locus_tag="Swol_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 22"
FT   gene            complement(662777..663175)
FT                   /locus_tag="Swol_0571"
FT   CDS_pept        complement(662777..663175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZF0"
FT                   /protein_id="ABI67904.1"
FT                   /translation="MSEIKVAINNVRISKINAVLTEKKNETSDASLRRNTVAELDPVEE
FT                   CSYVLRILEKIDFQPTGPMMLELETLADITTSSNLEDKNLIELKKELADMVMTVNTLTI
FT                   AFISEKMLSGPPIIIPPFLEVDETVVYE"
FT   gene            complement(663168..663731)
FT                   /locus_tag="Swol_0572"
FT   CDS_pept        complement(663168..663731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67905"
FT                   /db_xref="GOA:Q0AZE9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZE9"
FT                   /protein_id="ABI67905.1"
FT                   /translation="MVEKVFNDYYSVEYPALVKRIPDEEGGGWIAEIIDLPGCIADGET
FT                   PDEAILNLNEAKKCWIDVAHKRGQNIPKPSPSFTDDEVYSGKFTLRIPKFLHRQLAQTA
FT                   KNEGVSLNQYLQTLIAFNFGQTIKRNNEKQETTQNSFNYNIKIQQFGYSTSKGAFNDLS
FT                   RLWNGIDRNPIVCGFNPRGVIINE"
FT   gene            complement(663733..663981)
FT                   /locus_tag="Swol_0573"
FT   CDS_pept        complement(663733..663981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67906"
FT                   /db_xref="GOA:Q0AZE8"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZE8"
FT                   /protein_id="ABI67906.1"
FT                   /translation="MSQIRKRLLRLINNPVGVEWSELRTILKYYGCIIEESSGSHKVVY
FT                   HPTSSTNVTVSIHNNKVKVIYVKKCIELLEEVIEEEE"
FT   gene            664413..664718
FT                   /pseudo
FT                   /locus_tag="Swol_0574"
FT   gene            complement(664746..666125)
FT                   /locus_tag="Swol_0575"
FT   CDS_pept        complement(664746..666125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0575"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: chy:CHY_1592 MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67907"
FT                   /db_xref="GOA:Q0AZE7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZE7"
FT                   /protein_id="ABI67907.1"
FT                   /translation="MKKLSLLIIKEPLIRKRIFKTALPAMMEMILYMLIGVVDIAIVGR
FT                   LGAVPLAAVALGAQIFFGLVLLLESLGIGAAILVAQAKGAGNRLEVSRVAGQSFMLAVV
FT                   VGTAAAVLGLWLAEPFVGLFAVEAEVERLALLYIHIVFSILPVALTLYIINSVYRGLGR
FT                   TDIPMTIAFVVNIVNCAANYILVYGMGPIPALGVAGSALASSLAHVVGLVMACWYFFGG
FT                   RGGLKVKFRLSERLNWSIIQNIFRLGLPSMGEQFFLTVSGLISVFLIVFLGTTAYASHE
FT                   VALAVESLSIMPGFGVAIAATALVGQAVGARDRLAVQKMARGSLELAVLLMGLLGVVFF
FT                   CFPQAIARIFTNDPVLITLAGSLVRIAAFEQLTIALSMTLAGILKGAGDTRTPMYVTTL
FT                   ATWAFRIPIMYLLIKVLGLSIAWIWVVFVIDWLLRSLVFIIVYQRKHWMYRALGSELEA
FT                   G"
FT   gene            666505..666777
FT                   /locus_tag="Swol_0576"
FT   CDS_pept        666505..666777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0576"
FT                   /product="prevent-host-death family protein"
FT                   /note="KEGG: chy:CHY_2512 prevent-host-death family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67908"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZE6"
FT                   /protein_id="ABI67908.1"
FT                   /translation="MPNIKSSTDLRNNYNEISTFCRESREPVFITKNGQGDLAVMSIET
FT                   YEMLNGKLELYRLLDEGRAAVKEGRKRPLEDVMQDIRQEITDGKL"
FT   gene            666854..667078
FT                   /locus_tag="Swol_0577"
FT   CDS_pept        666854..667078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67909"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZE5"
FT                   /protein_id="ABI67909.1"
FT                   /translation="MTALKMMDNVEKAIMGLAVMPQKCPLVTDERLAMMGYRKLFVKNY
FT                   IVFFTINEKSKVVDIERILYARRDWRHII"
FT   gene            667494..669568
FT                   /pseudo
FT                   /locus_tag="Swol_0578"
FT                   /note="KEGG: mac:MA3726 hypothetical protein; KEGG:
FT                   chy:CHY_1723 hypothetical protein"
FT   gene            complement(669717..671126)
FT                   /locus_tag="Swol_0580"
FT   CDS_pept        complement(669717..671126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC13021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67910"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZE4"
FT                   /protein_id="ABI67910.1"
FT                   /translation="MKANLERSAIANNIPAELEHSLENIIHFGGISRNSAEQLKQGLDS
FT                   FGRLQQQYANDNQIRKVREQVTPAFFELYTAVLKRVAAEGYSDPLLKMFLCFGYLDERL
FT                   LLPEQIHSLYQLAESIDFGSKDAVYTIDNWLVSIYKQDKEPSINEFGHDYNEVFREKKK
FT                   RGELRETDKSKYDNDASSKLQHEIENLFKLGQRICHGASASYFPVLYSDILPKDLTNYL
FT                   LTPQRIKEGLEKLLQVDYSVFHREIVYHRPEIGINKHIIMKPVWPDYILLPTVGSRGIM
FT                   WQELTGRVRNSAARFVLPLFCNGNLDTMLLEVISHFRWELSRSTSSITRTSNVSDSLVG
FT                   EYSDYIQFYKKNRNLTEEAKEKIRLQMEKHRNNTREVFADDYKTWIDFEARGLLRLNKV
FT                   ARQILFQHCPFSLSIRESLEKHPLYNAQISRMNNLRNREIKILTANYARLTKNGAPLDP
FT                   DLEQNLLYYQG"
FT   gene            671948..672517
FT                   /locus_tag="Swol_0581"
FT   CDS_pept        671948..672517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67911"
FT                   /db_xref="GOA:Q0AZE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZE3"
FT                   /protein_id="ABI67911.1"
FT                   /translation="MGYIKKDNLISGLLVAFFTFFIALLVSLGSEALVRAVNNVIVALI
FT                   LLLMVILLGIFFDIIGTAATAAQMPPFNARAAKKIFGAKQAVKLVGNAHLVANFCNDVI
FT                   GDIAGTLSGAIGAGIVISLVNELVFLDIILAGALMTSFIAALTVGGKAVGKSLAVNQAN
FT                   SIIFRVAIILAWWEKMSGMELFKNRR"
FT   sig_peptide     671948..672037
FT                   /locus_tag="Swol_0581"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.549 at
FT                   residue 30"
FT   gene            672523..674439
FT                   /locus_tag="Swol_0582"
FT   CDS_pept        672523..674439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0582"
FT                   /product="1-Deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="KEGG: mta:Moth_1511 deoxyxylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67912"
FT                   /db_xref="GOA:Q0AZE2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZE2"
FT                   /protein_id="ABI67912.1"
FT                   /translation="MDEILNTINSPRDLKKLSLPEMTQLANEIRQLLVKSVAKCGGHLA
FT                   SNLGVVELSLALHTVFDSPEDKIIWDVGHQAYVHKILTGRREQMSTLRQYGGISGFPKV
FT                   EESEYDAFNTGHSSTSISAALGMALARDLQGQSNSVVAVIGDGALTAGMAFEALNHAGQ
FT                   EDSDLIVVLNDNEMSISKNVGAMSAYLNRLRTDPSYSRTKEEIESVLNRIPGIGPNLAR
FT                   AAGKFKDTVKYLMVPGIIFEELGFTYIGPVNGHDLAELKAVLSNIKKMKGPILLHTITQ
FT                   KGKGYEPAFQKPDIFHGVGPFDVDTGTQLKKSLKTYTEIFGDFMLNQAQRDNKLVAITA
FT                   AMTSGTGLSEFSRNFPERFFDVGICEQHAVTLAAGMASSGLRPVVAVYSTFLQRAYDQI
FT                   VHDVALQKLPVIFAIDRAGLVGEDGPTHHGAFDFSYLRHIPNLIIMAPADENELVDMLH
FT                   SAFSMEGPVAIRYPRGVGEGVRIKSERQLLEPGQSRLIAEGQDLAIIAVGRGVSIARDV
FT                   VDLLAGKGVNPLLVDARFVKPLDRRVIAGAAQKYHRLLTIEDNSLAGGFGSAIGEMLVE
FT                   EGIDAELLHIALPDEFVEHGRVELLFEQLNMNPDSILESIAGKWPELFSAGSRWELLKF
FT                   GQN"
FT   gene            674426..675238
FT                   /locus_tag="Swol_0583"
FT   CDS_pept        674426..675238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67913"
FT                   /db_xref="GOA:Q0AZE1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZE1"
FT                   /protein_id="ABI67913.1"
FT                   /translation="MARIRLDSLLYDKALAPSREKARAMILAGEVRVNGQMVDKPGTTV
FT                   DEEARIELKSHLSRYVSRGGFKLEKAIEDFRLDFSQRVVLDIGASTGGYTDCALQHGAI
FT                   KIFALDVGYGQLDWKLRNDPRVINLERRNIRYFSREELGEAVDIITMDVSFISTTLLFP
FT                   VIKEMLKEDGVIVSLIKPQFEAGRGKVGKHGVVRDPVVHREVLLNCINSAQQENLYCTA
FT                   VSFSPITGPKGNIEYFIQLKKEAKPCERIEEVVEKVVEEAQQKLGGKK"
FT   gene            675235..676041
FT                   /locus_tag="Swol_0584"
FT   CDS_pept        675235..676041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0584"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="KEGG: dsy:DSY2346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67914"
FT                   /db_xref="GOA:Q0AZE0"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZE0"
FT                   /protein_id="ABI67914.1"
FT                   /translation="MKIILVNNRFKENTEKKAQEIAGQLSALNVEVIIDNGLDEPYAGT
FT                   VDFIMVLGGDGTMLRAARRYGQRAIPVLGVNMGTVGFLSNIEINELAEYLPLILREEYS
FT                   LEARMMLEVAVFQQQSLLTRVFCLNELLLRSNSPRMLSFALEISGQKLEPYRGDGLIVS
FT                   TTTGSTAYSLSAGGPIADPQLDAFIVTPVASHIINKRPLVVSPEREISLHLLEEREAII
FT                   GIDGQIKMDFGAENRVLIKRAPHPLLMVNLKAKPFFTSIDRSLQRQ"
FT   gene            676090..676551
FT                   /locus_tag="Swol_0585"
FT   CDS_pept        676090..676551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0585"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /note="KEGG: chy:CHY_1981 arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67915"
FT                   /db_xref="GOA:Q0AZD9"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZD9"
FT                   /protein_id="ABI67915.1"
FT                   /translation="MKLRRQLCIIDIINQKEVATQEELCETLKNQGFDVTQATVSRDIK
FT                   ELKLIKVADKDGYHYALPDTPGVKGSFERMKRVIEDSVLGLDYSENLIIIKTLPGSAHA
FT                   VASLIDSAEWPTIIGTVAGDDTILAVVKPKEAAPGIVEEFEQLMLKSNR"
FT   gene            complement(676579..676946)
FT                   /pseudo
FT                   /locus_tag="Swol_0586"
FT   gene            677001..678683
FT                   /locus_tag="Swol_0587"
FT   CDS_pept        677001..678683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0587"
FT                   /product="DNA repair and genetic recombination protein"
FT                   /note="KEGG: sth:STH1835 DNA repair and genetic
FT                   recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67916"
FT                   /db_xref="GOA:Q0AZD8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD8"
FT                   /protein_id="ABI67916.1"
FT                   /translation="MLQEIYIKNFVLIEELRLSFEQGLNVLTGETGAGKSIIIDALGLV
FT                   LGERVRNDLLRDSQKKAIVEAVFVVENNSAAHSVLLENGLLEEEEDCIVVSREIATSGR
FT                   SLARINGRNVNAGFLKSLARHLIDMHLQDESSGFLNPQNYLQFVDGFIEEGQDIGKEIE
FT                   SLFLQIREEERQLENYKNNEQNRLQKIDFIRYQIEEIEKAGLRSGEEEELLALNQRIKN
FT                   AQALEEGTGRILEQLYHRQHAGESALDLISASLENLGRLKEDEFLSRLQSPLEEIYYSL
FT                   QDIASQLSSFRDSLDFEPGLLEESEERLYQLQRLKGKYGQSIDEILDYLGKARLELEYL
FT                   ENSGEKQEELEESITALKLRYHHLAAQLSQLRQSAAQKLQENVDMELRELNMPQVKFAV
FT                   HMELRETPGIKGMDQVDFLFSPNPGEEMHSLSRIASGGERSRFILALKKALAGIYLIPT
FT                   LIFDEIDVGVGGTALVAMANKLYELSLEHQLILVTHSPQIASLAHQHFLIEKASSEECT
FT                   LTTVRGLAAEARVEEIARMLEGEDFSPLAREHAREMLTRRDLT"
FT   gene            complement(678785..679210)
FT                   /locus_tag="Swol_0588"
FT   CDS_pept        complement(678785..679210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0588"
FT                   /product="heat shock protein, molecular chaperone"
FT                   /note="KEGG: ctc:CTC02469 heat shock protein, molecular
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67917"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD7"
FT                   /protein_id="ABI67917.1"
FT                   /translation="MFELTPFRKRRDMMNSLLGGDMLKEFNDFWYGAALNMKADIKENN
FT                   KEYIVEAELPGVKKENINVELKEHTLTIAATQDEETKDEGINYVRRERRTGSVSRSFYV
FT                   ENVDQEGVKADYKDGILKIVLPKLKETPPDKYQVKID"
FT   gene            679855..681186
FT                   /locus_tag="Swol_0589"
FT   CDS_pept        679855..681186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0589"
FT                   /product="SpoIVB peptidase. Serine peptidase. MEROPS family
FT                   S55"
FT                   /note="KEGG: dsy:DSY2342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67918"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR014219"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD6"
FT                   /protein_id="ABI67918.1"
FT                   /translation="MQRIRPWLGIVLSLLLIALCITPQAQSLLNLPQYQRLVVGESSTI
FT                   SLPLPEKLKDKIEMQVISPSRSVFAAPQEPPVTISSNSSGYEILALKPGKVNVELKLLG
FT                   YIPLKSMAVETLPTKRVVAGGHSIGVILQSKGIMVVGYAPVSDSEGKKAYPARDQGVEI
FT                   GDIIYQVDGQPLHSESELARIIDEKKSVLLGVKRGSKKLSITVRSTYCPETNRCRIGLY
FT                   VRDGVVGVGTLTFWEPDSKIFAALGHVIIDADTKQQIDVLQGKIVSASIQGIKPGKPGQ
FT                   PGEKIGVFNGEGEIEGKIIKNSYSGIFGKTGDEITNPLAHYTMEVAYAHQVNEGQAQIL
FT                   TVVNGDDIEAFDVVVEKVFPERQDGKSMIIRVADHRLLNLTGGIIQGMSGSPIIQNGKI
FT                   IGAITHVFLNDPTRGYGIFMDNMLSEIPSNLNPWSKVSTNSWDA"
FT   sig_peptide     679855..679932
FT                   /locus_tag="Swol_0589"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.819 at
FT                   residue 26"
FT   gene            681353..682159
FT                   /locus_tag="Swol_0590"
FT   CDS_pept        681353..682159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0590"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: mta:Moth_1505 response regulator receiver
FT                   domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67919"
FT                   /db_xref="GOA:Q0AZD5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012052"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD5"
FT                   /protein_id="ABI67919.1"
FT                   /translation="MFSEANRIKILIADDNREFCGILRDYFNNDSDFEIVGICNNGTEV
FT                   LEIIEKTPIEVLILDLIMPYMDGIGVLERINELNIEPRPRIIILTAFGQENITQKAVQL
FT                   GADYYILKPFNLQVLGDRVKQLVRDVPPRVENRSTGSSVVSSRPGAGKDMEIEVTKVIH
FT                   EIGVPAHVKGYQYLRDAIMLVVAEINYLGAVTKELYPTIAQKYDTTPSRVERAIRHAIE
FT                   LAWDRGDLDKINKFFGYTVSGEKGKPTNSEFIAIIADRLRLENKVS"
FT   gene            682398..683495
FT                   /locus_tag="Swol_0591"
FT   CDS_pept        682398..683495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67920"
FT                   /db_xref="GOA:Q0AZD4"
FT                   /db_xref="InterPro:IPR022215"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD4"
FT                   /protein_id="ABI67920.1"
FT                   /translation="MDRRTKNLVKRLKKSDIAIIDHDDIDEVAANSLIDARPQAIINTQ
FT                   ASITGRYPAKGVYKILKAGIPVLDEVGENIFSQLREGVLIEVRGNQVFWGKTVIAEGKE
FT                   LSLEDVRLKLKEAHQNIQLELDHFVDNTMEYAKKEKDLLIGNIDVPVLDTYMLNRHVLI
FT                   VVRGSSYKEDLRTISPYIQEEQPVLIGVDGGADALLEFGLKPDLIVGDMDSVSDTALSS
FT                   GAEIVVHAYADGTAPGLDRIESMGLKAKTFPMPGTSEDVAMILAWEYGASLIVAVGSHS
FT                   NMIDFLEKGRKGMGSTFLVRLKVGSILVDARGVSQLYKQHLPSKYLLQLLVAALIPITV
FT                   ILAVSPATRPFFRLILLQLKIIFNI"
FT   gene            683773..684675
FT                   /locus_tag="Swol_0592"
FT   CDS_pept        683773..684675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67921"
FT                   /db_xref="GOA:Q0AZD3"
FT                   /db_xref="InterPro:IPR021522"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD3"
FT                   /protein_id="ABI67921.1"
FT                   /translation="MIDLRYHIASIVAVFLALGLGILIGSTIVGDNLLVDQQKKMIDRL
FT                   EGQFYSLRERESELSASNQYKDQIISNYENYSQALLPPLVKEHLTGYQVALVVTGGSDI
FT                   PAGMLNALSIAGANVVSKSVILSNISLDEASLRQRVQEFYGLDKEVSPDVLRQYVAASV
FT                   AAVITNKADPGVISFLQENDLLKFSGSNTMPLNGIILLGGTNNLAGFFAASFDHTLIES
FT                   LAQQGLKIFGVENSKVTYSYMEEYQKDKISTIDNVDLSPGQISLVYAMEGEPGDYGIKV
FT                   TAKKFMPSLPVESVNKQQR"
FT   gene            685021..685827
FT                   /locus_tag="Swol_0593"
FT   CDS_pept        685021..685827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0593"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /note="KEGG: chy:CHY_1975 glycosyltransferase, group 2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67922"
FT                   /db_xref="GOA:Q0AZD2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD2"
FT                   /protein_id="ABI67922.1"
FT                   /translation="MKNITVVIPAYNEEERIGETLQAVKSIPGISRVIVVSDGSTDATA
FT                   SRAREEGVEVLELYPNRGKGGAMNAVLPFLNLEQREPSLSAEATELGFVPQLSTREHYT
FT                   ADSSANLLLPQLEGKAADIVIFLDADLGASASQASRLIEPVAKGMADLSIASFPPPQKK
FT                   GGFGLVKGTAAWLIRKVGKMEARAPLSGQRAMTREVLQAVTPFNEGYGVELGMSVNALL
FT                   QGFKLIEVPTTMSHNESGRDLKGFFHRGRQFWDVLRVIGDLRRKGI"
FT   gene            685908..686705
FT                   /locus_tag="Swol_0594"
FT   CDS_pept        685908..686705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67923"
FT                   /db_xref="GOA:Q0AZD1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD1"
FT                   /protein_id="ABI67923.1"
FT                   /translation="MQQSAATRKNYQGLDIPVSAGISFPLALLLVYTIILLFAPLYEQP
FT                   VNREIYFLFLMGIFAISLLGFADDMLGQRDTLGFKGHLGALLHGRMTTGGLKAAGGALI
FT                   AFFLALFLSSGLVSGWPDIIVDTLIMALFANMLNLLDLRPGRAVKGFFFFFFLLAFLAS
FT                   WKINWILIAPLLGATLYYVHFDLKALAMMGDSGSNVLGLALGFMVAGSLPLSFKVGVLF
FT                   FLIFMHLITEKYSLTRIIEKVAVLRKIDQWGRGKSDGKSEKTG"
FT   gene            686680..687807
FT                   /locus_tag="Swol_0595"
FT   CDS_pept        686680..687807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0595"
FT                   /product="tripeptidase"
FT                   /note="KEGG: bld:BLi02571 similar to tripeptidase;
FT                   RBL01653"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67924"
FT                   /db_xref="GOA:Q0AZD0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZD0"
FT                   /protein_id="ABI67924.1"
FT                   /translation="MVRVKRLVDTFIRLVETASVSGRESAIRDLLQQWFQQRGLTLVED
FT                   EAGQILGGDSGNLLLQIPGTMEGPTLLFAAHMDTVEPGIGVKAVVDEDGFIRSKGNTIL
FT                   GSDDKAAIAVLLEVFDILKEKELSHPPLEFLFTVSEEQGLKGAKAFDFRQLKSKIAYVL
FT                   DAGDKPGAIIIQSPCQNEMEYTALGRAAHAGINPEDGLNAIQLVANALAAMPCGRIDDE
FT                   TTCNFGGIEGGTARNIVAEFCRVKGEARSLRREKLDLLSTELKDIFIAEVEKRGGKAEV
FT                   AVRFLYPEISLDENEEVVQLAARAARNIGLKPHLLSTGGGSDASIINGQGILCANLGVG
FT                   MRAVHTCNEHISIEDLVNDARWVLAIIEEAARIGE"
FT   gene            687900..688979
FT                   /locus_tag="Swol_0596"
FT   CDS_pept        687900..688979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67925"
FT                   /db_xref="InterPro:IPR024479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC9"
FT                   /protein_id="ABI67925.1"
FT                   /translation="MIAIKRGRILKELFARPGIKGYLISIDGEEARSIVYPELVGEVLP
FT                   GDEVLVNTTAVELQLGSGGYHYVVASLQSRNRELTPGGHIMKLRYTPMQLKVLSVEEEA
FT                   SPFHQVMQEADSLENTPVLVSSLHSMLLPLCLQLKEKDKELRLAYIMTDGAALPLAFSQ
FT                   VVDYLKREGLLQAALSVGHAFGGDLEAVNIYSGLLAARHILQADIIIVGMGPGIVGTGT
FT                   KWGFTGIEQGEILNAVEALEGRPVAVPRISFADKRKRHQGISHHTLTVLSRVCRVKALV
FT                   PLPLLEEEKMDFLWTQIREAGLLDKYHFIVENEPGILDLLNNSSFKASTMGRGVEEEKE
FT                   FFLALGAAAQAALRLYQQD"
FT   gene            689156..689710
FT                   /locus_tag="Swol_0597"
FT   CDS_pept        689156..689710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0597"
FT                   /product="NUDIX hydrolase"
FT                   /note="KEGG: mta:Moth_1504 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67926"
FT                   /db_xref="GOA:Q0AZC8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC8"
FT                   /protein_id="ABI67926.1"
FT                   /translation="MREEKLMDLEEKTLASRDIFQGRIIKVRVDQVLLPDGSESSREIV
FT                   EHSGAVGIVAIDEENNLWMVRQYRKALERVLLEIPAGTLEENEEPLECARRELEEETGL
FT                   QAAKWQKILSYHSAPGFCDEKLFLFMAQGLSPGESSLDRDEFLEVEKVPLKEAYEMIFS
FT                   GEIIDGKSIIGIQYACRLLGC"
FT   gene            689896..691074
FT                   /locus_tag="Swol_0598"
FT   CDS_pept        689896..691074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67927"
FT                   /db_xref="GOA:Q0AZC7"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC7"
FT                   /protein_id="ABI67927.1"
FT                   /translation="MREIFADLHIHIGRSQGRAVKITASRELTLKNILFREAPRKGLEM
FT                   VGIVDAGSTLVAAEIEEMLLHGELEEQPQGGFLAANGVLMIAGAEVESREGVHWIIFLP
FT                   FLHSIKSLQKYLRSRVRNMTLSTQKADATAIDLLNLSYLLEGIFCPAHAFTPHKGAYGF
FT                   WTDSLADKMGRDLAQVKVLELGLSSDSLMADMIAETSNFTFLSNSDAHSLANIGREYNL
FT                   LRMKQKNFAEFRYCLENYEGRRILANYGMDPLMGKYHRSFCLQCERIAAEAPPVRACAN
FT                   CGSENLVAGVYDRIVSIRDYSEPRQPLGRAPYYYRVPLQKLPGIGPKTLEKLRAGLGSE
FT                   IDICENANQEDISRIAGERVAALIIEMRKGRLDISPGGGGRYGKVKKDNRKQ"
FT   gene            691088..691693
FT                   /locus_tag="Swol_0599"
FT   CDS_pept        691088..691693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_1966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67928"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC6"
FT                   /protein_id="ABI67928.1"
FT                   /translation="MQAAREGLLLIIVDVIDMSTTLESALDAGAAAILGCSPDFTRAPV
FT                   KVAPEEIGQEASRLAREKGRGIILVAEPRVGSEEERRGRCQRVISGIEKGGGVIEAVVP
FT                   NIGAETPRLVDMKDRVVVAVTDTGGVAFDAAFQESRRLTVGTVARTLKQKGMEPALTAV
FT                   SRALKMLQETDQGIAVVAASRNSLEDVLAAQFIANLFL"
FT   gene            complement(691897..692802)
FT                   /locus_tag="Swol_0600"
FT   CDS_pept        complement(691897..692802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0600"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="KEGG: gsu:GSU2313 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67929"
FT                   /db_xref="GOA:Q0AZC5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC5"
FT                   /protein_id="ABI67929.1"
FT                   /translation="MRVLIADDDLISRTVVKALLSKWGYEVLEAGDGIQAWDILKEKDS
FT                   PQLVLLDWMMPGIDGLELCRRLRQLDNNTYHYIILLTGRDSKEDIIGGLNAGADDYITK
FT                   PFMPEELEVRLRVGKRILDLQQSLNEALEIQRYQAQHDLLTGIFNHAKILNILEKELYR
FT                   AKRQNSNLAVIMGDLDHFKKVNDTYGHMAGDAVLVEVALRMKNTIRLYDSICRYGGEEF
FT                   LLVLPGCSTEEAIIIANRILGSISQEPVVFNSTPIAVTISLGVAMKAAGDKTTAAELVQ
FT                   LADAALYKAKQNGRNRVEQA"
FT   gene            complement(692845..697173)
FT                   /locus_tag="Swol_0601"
FT   CDS_pept        complement(692845..697173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0601"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: cyb:CYB_0507 sensory box histidine
FT                   kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67930"
FT                   /db_xref="GOA:Q0AZC4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC4"
FT                   /protein_id="ABI67930.1"
FT                   /translation="MTDGFSLNEVKASFDTLFNTIEDYLFIINENGNAVYANRAAIEKL
FT                   GYSQEEIQGLSLLLLQPPERRDEAAQIFASMMAGQRDHCPIPLYTKDGSYIPVETSVVR
FT                   GQWQGTPVFFAISKDISQISQANARFSKAFSINPALMAISKIDSGKYIDVNEAFLSRLE
FT                   YNRDEVIGKTSGELGIIPFAERDLLIKELYQQGCIRDKELTLITKSGSELYVIFSVDFI
FT                   ETDDQTYLLTVMVDITGRKIAEELLKESEDRWSSALECSGNGVWDWDAVTNRVFFSKEW
FT                   KSMLGYEEHEVGDSLQEWESRVHPEDWERIQVELQKHFDGQTPVYGSEHRLRTRDGSYK
FT                   WLLDRGKVINRDEEGKVLRVIGTHTDITEIKKVQEDLSRTRGQLKAILDNLPFLAWFKD
FT                   KEGHHIEVNRFFEISCGLTRDEIIGKTDLDIWPRELALVYMEDDREVMASKKQINKVER
FT                   VQDKAGGIWFNTFKTPVFDQEGNVIGTAGITRDITESRRLEHELIEQRTFLKSLIDAIP
FT                   DLIFYKDINSLYLGCNHAFAHRFIGLSEEEIVGRTDLDFVKDQETARFFIQKDREILLS
FT                   GETRMNEETITLADGSIMELETVKTPFFKGGTVAGLIGVSRDITKRKIAQNQLLIKQKI
FT                   LSNIASATNELLINSDYYEAINKCLALLGEATGVDRVYMFKNHYADNKAYTSYRMGWNS
FT                   GVFPAQINNPKLQNIPFDQAQNFIEPLMRNEAVKAQVRDFGEGWIKETLLEQSILSILV
FT                   LPIFVGGVFWGYVGFDECKEERNWSEDEFSILKAFSNSIAEAIERSQMEQKLAQAKEIA
FT                   ESANYAKSLFLANMSHEIRTPMNGILGFLELLGETELSTEQQDYVQEAHRASEILLYLI
FT                   NDILDFSKIEAGKLAMEEIPFRVRTVVEDAVSLQAPKAREKGLEMHTLIKSNVPDEVVG
FT                   DPARLRQILNNLLSNAVKFTHTGEILVIVETINESSDKAEIAFEVSDSGIGIAPEDMEK
FT                   LFQPFTQADASTTRKYGGTGLGLAISYELVRLMEGTMQVKSKLGQGSKFYFTACFKPGL
FT                   RKDTLPFEPAELKGARVLIVDDNSSNRKIIRTYLEDAQCLVEESDSAEKAITILLSASA
FT                   VKSFDVVIVDFQMPAMNGHELAAALKAIPSTRAIHLIMLTSAAQKGDARRAKEHGFSGY
FT                   LTKPVKRDELLQCISIVLGLKTEASLGDSIVTRYTIKENPIPARPRFLLVEDNEMNQKI
FT                   IVKMLEKRGMYCDLACSGAEALKALQQKDYDIVFMDCQMPEMDGYETTARIRQMEGEER
FT                   HTIIVAMTANAMEGDREKCLQAGMDDYISKPVDFQLLFNIIEQYTARQQESVSEVAAML
FT                   EENLSSFIAETGLSKGEGRELYDKLWSTLPGVLEELQNALANSDFKKIRSLAHQLKGSS
FT                   GTLRIQKLYELFFDLEQKAIAEAKAACVDTLQLIHRLVKS"
FT   gene            697328..698680
FT                   /locus_tag="Swol_0602"
FT   CDS_pept        697328..698680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0602"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mta:Moth_2414 inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67931"
FT                   /db_xref="GOA:Q0AZC3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC3"
FT                   /protein_id="ABI67931.1"
FT                   /translation="MKAIYVIGHKNPDIDAVAAAIAYREYKEATDQGLYLAAMAGEMSD
FT                   EIDFVLEAFDFAPPLHIKNVKTTVEDLLDEKEPFCVCRDMNLMELSNLLRQQELKTVPV
FT                   VDEKERLLGLITIGDMAMLFMNSLLDVGDLAETPGILGKLLNKKVTDIMKIRDLILFEK
FT                   DEAAEEARKLMLSTRFRNYPVVDEENRFLGIISRYHLLNMRRKKLILVDHNEKKQAVDG
FT                   VEEAEILEIVDHHRVGDLQTISPIYFHNEPVGSTSTLVAEKFINMKLTLSQNLAGLLLS
FT                   GILSDTMLFKSPTTTGKDLSIAAKLQEISGLEPLSWGKAIFENSHQLDKRDDEELIFED
FT                   LKEYSSEELIFAISQIETVDLASFSRRKTSLLKSMQEICERKAYAFICLMVTGILEEGT
FT                   ELLFAGEKSSLVEQAFGLHSEKGEIFLQGVMSRKKQVVPVIYEALRQQNLL"
FT   gene            698793..699107
FT                   /locus_tag="Swol_0603"
FT   CDS_pept        698793..699107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67932"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC2"
FT                   /protein_id="ABI67932.1"
FT                   /translation="MEQAIISINEIKTKLFPIFENAPVYRAILFGSYAKGNPTNISDID
FT                   ILIDSKGELLNIDFYGVLEDITTQLGKCVDLFEITELKNNSAMQSVIEQEGIVLYDRQR
FT                   "
FT   gene            699091..699480
FT                   /locus_tag="Swol_0604"
FT   CDS_pept        699091..699480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0604"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67933"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC1"
FT                   /protein_id="ABI67933.1"
FT                   /translation="MTGKDRIILQKISTYIDDVIQYIDGFSFENFMADKKTISASAFSV
FT                   SQIGELAKEISRDTQEKHDHIPWKSIRGMRNKIVHDYENIDLAVLWGTITKSLPELARQ
FT                   INAVLYQEIEEINILDDEEATKSER"
FT   gene            699692..700303
FT                   /locus_tag="Swol_0605"
FT   CDS_pept        699692..700303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0605"
FT                   /product="uncharacterized membrane protein"
FT                   /note="KEGG: mta:Moth_1503 required for dissolution of the
FT                   septal cell wall; RBL05740"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67934"
FT                   /db_xref="GOA:Q0AZC0"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="InterPro:IPR014196"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZC0"
FT                   /protein_id="ABI67934.1"
FT                   /translation="MYLKQRIKQHIRDNRWQYLLILLIFLSGIIVGSYKVSSLEGGVRS
FT                   HLLQMIDNYLKGGMEGNLDGASIFFSAFLHQSKTILAIWFLGLTVIGFPLILAVIFLRG
FT                   ISLGFTLNFLFQEKAGAGIILSFIAVLPQNIVYIPFLLIWAVVAVNVSLYILKGRNNSY
FT                   LPLGTALIAYSLLMLLFILVFLLGAFIEAYLSPWLLQLLV"
FT   gene            700347..700613
FT                   /locus_tag="Swol_0606"
FT   CDS_pept        700347..700613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB9"
FT                   /protein_id="ABI67935.1"
FT                   /translation="MIVVINNWKKKMLSFLILLVFILAFALAVPTMTGILHKQVPALGN
FT                   WFKEEHPSGNPMRVENNQQSTKFEEVMDHFVFKLQNFYYEEKE"
FT   sig_peptide     700347..700433
FT                   /locus_tag="Swol_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.765 at
FT                   residue 29"
FT   gene            700677..701567
FT                   /locus_tag="Swol_0607"
FT   CDS_pept        700677..701567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0607"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /note="KEGG: sth:STH1821 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67936"
FT                   /db_xref="GOA:Q0AZB8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB8"
FT                   /protein_id="ABI67936.1"
FT                   /translation="MQNSIEDFISYLNFEKGLAANSRIAYKRDLLKFQQFLQENSRALS
FT                   PQNISKHDIMAFLAWQLDQGAAHSSIARSLSSIKSYYKFLILEGELDKNPSSDLETPKI
FT                   KRKLPQVLSIEEVDKLMEQPNPVVPLGIRDRAMLELMYGTGIRVSELLSLQVEDLNPTA
FT                   GFLRCMGKGRKERIIPVNQTSIDWVQRYLARVRNSLVKNPLERTLFLNARGRPLSRQGF
FT                   FKILGNYVEKAELEKEVTPHTLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHLT
FT                   KSRLREVYQQYHPRS"
FT   gene            701827..702999
FT                   /locus_tag="Swol_0608"
FT   CDS_pept        701827..702999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0608"
FT                   /product="Phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="KEGG: chy:CHY_1963 phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67937"
FT                   /db_xref="GOA:Q0AZB7"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB7"
FT                   /protein_id="ABI67937.1"
FT                   /translation="MTKRAILIVLDSAGIGEMEDSSLYGDQGSNTIVNTARAVGGLELP
FT                   CLQSLGLGNLDEIPGVKPVRQALGAYGKMQEKSPGKDSTTGHWEMMGQVLKYPFPTYPY
FT                   AFPPDLIEEFEKRIQRKTLGNVVASGTEIIERLGPEHLKTACPIVYTSADSVFQVAAHE
FT                   EVIPLAELYAICQTAREMLAGENAVGRVIARPFIGHPGAFQRTPNRHDFSLVPERSILD
FT                   AIVEAGQQVIAIGKIYDLFASRGVSESRPSKSNRQGIELIIEAIKEESSGLIFANLLDF
FT                   DQVFGHRNDIEGYARALKEFDAELVNIMSVLKPGDLLFISADHGCDPTTPSTDHSREMV
FT                   PVLVYGSDCRPGVDLGIRESFADLGQSIAEHLGVEACGLAGKSFYPLIRR"
FT   gene            703194..704498
FT                   /locus_tag="Swol_0609"
FT   CDS_pept        703194..704498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0609"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /note="KEGG: sth:STH1039 pyrimidine nucleoside
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67938"
FT                   /db_xref="GOA:Q0AZB6"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB6"
FT                   /protein_id="ABI67938.1"
FT                   /translation="MKMPYIIEKKRDGKDLSREEIEFLVRGIADGTIPDYQISAWAMAV
FT                   YFRGMNPRETRDLALAMAYSGEVIELSAVEGVKVDKHSTGGVGDKTTLVVIPLVAATGV
FT                   PVAKMSGRGLGHTGGTIDKFESITGFKVEMAYPAFLQQVSQIKAAVVSQSGNLVPADKR
FT                   LYAIRDVTATIDSIPLIASSVMSKKIASGAEGIVLDVKVGSGAFMKSYEKASQLAKTMI
FT                   DIGRGAGRKVAALLSNMDQPLGNAVGNALEVKEAIDTLQGQGPPDLEELSLELAAQMIV
FT                   LGEKAASINDARDLARAALKSGLGLVSWKQMVETQGGELNYSLPSYGLPEAAIKERILA
FT                   DKRAYIENLDALKIGQAAMLLGAGRERLGDIIDYAVGIELLKKPGDLVEAGDTLAIIHA
FT                   NDPGRLEMARKILLDAYHFSDEAVEKKPLIIETIS"
FT   gene            complement(704523..704960)
FT                   /locus_tag="Swol_0610"
FT   CDS_pept        complement(704523..704960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67939"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB5"
FT                   /protein_id="ABI67939.1"
FT                   /translation="MLENWQSIAEQIYKNELTFPHLRERLQRGGELRAWYKYYRGGNQW
FT                   AGKHFVEENVFLMEKVLIWVQIAEDGKMGIYSFKLDDISKIDRSYTFADKSQEKLVLSQ
FT                   ATITFKTMKNNSKRDTLVFKRPLQSEEGDVEGFEQLIALLD"
FT   gene            complement(704989..705228)
FT                   /locus_tag="Swol_0611"
FT   CDS_pept        complement(704989..705228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67940"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB4"
FT                   /protein_id="ABI67940.1"
FT                   /translation="MYIGITGLMPGTMSTAAGIIMLIKSQEQASQSVAFIGKMQDHMIK
FT                   IHGEEISKLFNTKDVAALSKTINSKVGQVVNLVA"
FT   gene            705423..706568
FT                   /locus_tag="Swol_0612"
FT   CDS_pept        705423..706568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0612"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: dsy:DSY2305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67941"
FT                   /db_xref="GOA:Q0AZB3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB3"
FT                   /protein_id="ABI67941.1"
FT                   /translation="MCCRRSIAWLVLWVMVFIIAAPTRLEAEVVEVKAESYVLMDADSG
FT                   KVLLAKNEHKQLAPASMTKLMTLILAMEALEEGKVTLKDKVVTSENAWKMGGSQIYLEP
FT                   GEQMSYEDMLIAIAVGSANDACVAVAEHLEGTHQNFVDKMNHKAKMLGLKNTHFINSYG
FT                   LSAPKHYTSAYDMAVIGREALAHPKILEYSSIKEYDLRQGEFKLFNTNKLLWWYQGADG
FT                   FKTGWTDEAKYCLAGTAKRDGLRLISVVMASPEKHGNFRDSMQLLNYGFARYAFKSLIG
FT                   QGKSCGIVKIGKGIEEQVEVLAEEEVGCTVIKGEEKKINSKTSLLPYVDAPVSKGQKLG
FT                   EISLYKDGDLIKEINLVAASDVGRGGLLKEIGKIFAEIYLL"
FT   sig_peptide     705423..705506
FT                   /locus_tag="Swol_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.668) with cleavage site probability 0.269 at
FT                   residue 28"
FT   gene            706645..706977
FT                   /locus_tag="Swol_0613"
FT   CDS_pept        706645..706977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0613"
FT                   /product="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)-like protein"
FT                   /note="KEGG: dsy:DSY2302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67942"
FT                   /db_xref="GOA:Q0AZB2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR014237"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB2"
FT                   /protein_id="ABI67942.1"
FT                   /translation="MEIDLKLIRNTLVVKISGELDLLVSEKLRREIDSKIQSQQVKNLV
FT                   LNLEKVSFIDSSGLGVIIGRYKRMNAGNGRMYIVGASPAVEKILIFSGINKLVPLYRSE
FT                   QDIINI"
FT   gene            707011..707457
FT                   /locus_tag="Swol_0614"
FT   CDS_pept        707011..707457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0614"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: tte:TTE1316 anti-sigma regulatory factor
FT                   (Ser/Thr protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67943"
FT                   /db_xref="GOA:Q0AZB1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010194"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB1"
FT                   /protein_id="ABI67943.1"
FT                   /translation="MNVKNYVRFEFKSLAENVSFARSCVAAFATQLDLTLEDIEEIKVV
FT                   VSEAVSNCIIHAYENRCNEKIVVLVSIMDDRSLEIVVEDQGKGIEDIEKAIEPAFSSDS
FT                   SRTGLGFTFMKSYMDEMEVFSQPGEGTTVRLKRHFRKKEQEAYA"
FT   gene            707472..708203
FT                   /locus_tag="Swol_0615"
FT   CDS_pept        707472..708203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0615"
FT                   /product="sigma 28 (flagella/sporulation)"
FT                   /note="KEGG: mta:Moth_1496 sigma 28 (flagella/sporulation)"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67944"
FT                   /db_xref="GOA:Q0AZB0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZB0"
FT                   /protein_id="ABI67944.1"
FT                   /translation="MSSSSSYQNNEALLRLAQGGDQEAKAQLYEANVGLIYLVLERFKN
FT                   TSYDQEDLFQVGAMGLLKAIERFDFSFDVRFSTYAVPMIIGEIKKFLRDDGMVKVQRGI
FT                   KELYARVRWAQDKLRGDLGREPGVNEIASLLEMEKEDIVVAMEACQAPAYIHDVVPSEE
FT                   KEQLSLLDKLVHEEGNVAILEKLALREALAKLDERERVVIIRRFFQDETQTVIAEDLGV
FT                   SQVQISRIEKSAILKLRSLLQ"
FT   gene            complement(708424..709023)
FT                   /locus_tag="Swol_0616"
FT   CDS_pept        complement(708424..709023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67945"
FT                   /db_xref="InterPro:IPR027972"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA9"
FT                   /protein_id="ABI67945.1"
FT                   /translation="MSNYKLENPGCCPPYPPCPPRLNQTILSCGTGSGVKLPSISEYRS
FT                   QLVNPYVVASLSIDTSNLSNPSVKLDFSSIITYKELYDYWLCDLRLTFQLSRVCGGAKA
FT                   VLGNWNFERNVGFGWYGNNGRAVEGNEAELRANGFGITVETVDAFGFTFCDCHACPGCC
FT                   TYMVEVINAETSGVDFADVSHPMFNALAVGPLAWGD"
FT   gene            709469..710821
FT                   /locus_tag="Swol_0617"
FT   CDS_pept        709469..710821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0617"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: mth:MTH836 UDP-N-acetyl-D-mannosaminuronic
FT                   acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67946"
FT                   /db_xref="GOA:Q0AZA8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA8"
FT                   /protein_id="ABI67946.1"
FT                   /translation="MSKVPLLYPDRNICIMGLGYVGLTLATVMAECGFQVLGVEIRKDI
FT                   VVSLQKGEAHFYEPGLSARLKNVIKTGRLQVTASIADSFAGSVFIITVGTPLDEKGKVR
FT                   LDMVENVCREVALHLKENDLVIMRSTVKLETTRKIVRAILEETRVDFDLAFCPERSLEG
FT                   KALQELRSLPQIVGGLTPGAAIRAAHLFLFITPTVIKVSDMETAEMIKLIDNAQRDVFF
FT                   AYANEVARLCDVIGVSAAEVIQAGNLAYPRSRLPQPGPVGGPCLEKDPHILAEKVLELG
FT                   LWPEITLAARKTNEEQPEEVISYLHRVCSGFASFPECPQISLLGLAFKGQPPTDDLRGT
FT                   MARPVLNSLQKHFPCAHFRGFDPVVRAEGIEAFGLIPCINLEDAMRGANLILILNNHPR
FT                   FAHMQIENLSELLARPALIYDFWNNFVAKELHLPSGIGYMALGSHSRAVLP"
FT   gene            710868..711854
FT                   /locus_tag="Swol_0618"
FT   CDS_pept        710868..711854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0618"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="KEGG: sru:SRU_0600 nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67947"
FT                   /db_xref="GOA:Q0AZA7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA7"
FT                   /protein_id="ABI67947.1"
FT                   /translation="MARKYLLTGGTGFIGTALAKRLLSAGHELKIYDNNSRGRRERLQG
FT                   IAGEVQIVEGDIRDRERLIAAARGMDSLIHLAYINGTELFYHQPELVLDVAIRGMLNVI
FT                   DACRTEGIGELILASSSEVYQNPPQIPASEAVPLSIPDPLNPRFSYGGGKIACELMAIN
FT                   YGRKDFERVLIFRPHNVYGPDMGWEHVLPQFILRAIKAIESKPQGPVPFPIQGDGSQTR
FT                   AFIYIDDFIDALISLIQFGQHLNIYHIGNPEEISIKSVASQLFQYLGREIEIIRGPLPP
FT                   GSPLRRCPDISKLLELGFSPRISFEQGLAATIEWYTRAIQEGKSPKY"
FT   sig_peptide     710868..710927
FT                   /locus_tag="Swol_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.812) with cleavage site probability 0.808 at
FT                   residue 20"
FT   gene            711870..712796
FT                   /locus_tag="Swol_0619"
FT   CDS_pept        711870..712796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0619"
FT                   /product="GDP-fucose synthetase"
FT                   /note="KEGG: dvu:DVU0090 GDP-fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67948"
FT                   /db_xref="GOA:Q0AZA6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA6"
FT                   /protein_id="ABI67948.1"
FT                   /translation="MDKNSKIYLAGHQGLVGSALERHLRTRGYNNLLTRRFDELDLRRQ
FT                   DAVEEFFQQFQPEYVFLAAAKVGGMWANYLRPGEFIYDNILIQSNVLEAARKYAVKKLL
FT                   FLGSSCIYPKFAPQPIKEENLLQGELEPSNQAYAIAKIAGIAMCQAYRAQYGCNFIAIM
FT                   PNNLYGPGDNFHPENGHVLPAMINKFHQAMLTRSPQLYLWGTGTPRREFLYVDDLATAC
FT                   YFLMKHYDEADIINVGSGEEYSISELAAMVAAIVGYQGEIIWDSSKPDGTPRKLLDASR
FT                   INALGWHSRVSLWEGLKVTYDWYLKNL"
FT   gene            713062..713280
FT                   /locus_tag="Swol_0620"
FT   CDS_pept        713062..713280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67949"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA5"
FT                   /protein_id="ABI67949.1"
FT                   /translation="MKKYNFIVLIEKDEDGMLVASVPALKGCHSQGKTMDELLARIKEA
FT                   IELCLEVEQEDVFNNQFVGVQQIEVQV"
FT   gene            713277..713507
FT                   /locus_tag="Swol_0621"
FT   CDS_pept        713277..713507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0621"
FT                   /product="YcfA-like protein"
FT                   /note="KEGG: mta:Moth_0484 YcfA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67950"
FT                   /db_xref="GOA:Q0AZA4"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA4"
FT                   /protein_id="ABI67950.1"
FT                   /translation="MSKLTIISDKEMVKLLIFLGFIEIRQKGSHAFFAHPDGRATVVPC
FT                   HNEDLGRGLIRKILRDIDISVPDYERLKREI"
FT   gene            713598..714560
FT                   /locus_tag="Swol_0622"
FT   CDS_pept        713598..714560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0622"
FT                   /product="putative transferase"
FT                   /note="KEGG: bfs:BF3689 putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67951"
FT                   /db_xref="GOA:Q0AZA3"
FT                   /db_xref="InterPro:IPR001503"
FT                   /db_xref="InterPro:IPR038577"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA3"
FT                   /protein_id="ABI67951.1"
FT                   /translation="MLKVKLSTRVPHEPIIRQTPGSQGIWGNCRFFINEEVEECDYWVV
FT                   YDGLQSDESTLCPPENTILLTVEPPSVFYYEPDFIQQFSTLITCPGHNFSHPRIIYSPA
FT                   FNWHVGRVIIDIKAVQSKVNLDYDDFKRMGAIKKNQQISLVCSNKDFTEGHRKRLAFVD
FT                   RLKEHFGSRIEHFGFNINDIEDKWDAIREYKYHIAIENSFFAHYWTEKIADCYLAGAYP
FT                   IYYGCPNLAEYFPQGAYTSIDIEDVETAISSIENCLAENRYEKNLDKIWAARELVLDYY
FT                   NLFAVIERCILRLEAANQSRQARKIPITIRPCKEAWLIT"
FT   gene            complement(714592..717204)
FT                   /locus_tag="Swol_0623"
FT   CDS_pept        complement(714592..717204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0623"
FT                   /product="cation transporting ATPase-like protein"
FT                   /note="KEGG: lin:lin0814 similar to cation transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67952"
FT                   /db_xref="GOA:Q0AZA2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA2"
FT                   /protein_id="ABI67952.1"
FT                   /translation="MIPYTANNEELLNQLQVNPDKGLSSTEASKRLTEYGENKLQAKKK
FT                   KSMLQRFLEQFYDVMILILILAAAISFVVACYEGEGFYEPVLILLIVVLNAILGVVQES
FT                   RAEKALESLQELSAPHARVIRDGKESIIEASFLVPGDIIKLEAGDSVPADARLIHSSSL
FT                   KSEESALTGESVPSEKDAAAEVAANAPLGDRFNMVYAGCSITYGNARAVIIATGMNTEI
FT                   GRIANLLDAANDRQTPLQHRLAVLGKYLGLMALGICAVIFIIGLINGMKVMEIFMIAVA
FT                   LAVSAIPEGLPAIVTIVLAIGVQRMVKKNAIIRRLPAVETLGSASVICSDKTGTLTQNQ
FT                   MTLVKAFADGASVLEDIGESNSAVIKKLLQYSALCCDGTVEFEDGKERHIGDPTETSIV
FT                   LAAHKNNLPKDELNRLYPRLAELPFDSDRKLMTTVNQIDGKYMVIVKGAFDVLAARCIA
FT                   GDLEAARRFNNEMSRQALRVLAVAYKEIETLPETASSEELEKDLIFMGLLGMIDPPRPE
FT                   AREAVAVCRRAGIKPVMITGDHVETASAIAKDLGIMLEGDKAITGSQLANLSDSELDEQ
FT                   VRQISVYARVSPEDKIRIVQAWQHQGEIVSMTGDGVNDAPALKAADIGCAMGITGTDVA
FT                   KGAADMILTDDNFATIVDAVKEGRGIYDNIKNTVGFLLGTNVGEVLAVFLAMILWKASP
FT                   FLAMQLLLINLVTDGLPAIALGMEPVESDVMERKPKPKEESIFAHGMGTRIILQGAMFA
FT                   LLTLIGFFMVWQITGDIVAGRSMAFLVMALSQVIHSFNMRSNHSLFKTGIFTNRYLNGA
FT                   AFISLALIALVAFLPPVAFAFGLTQLSAAMYLYALALALVPVVVLEFSKAFGLVKHQA"
FT   gene            complement(717649..718398)
FT                   /locus_tag="Swol_0624"
FT   CDS_pept        complement(717649..718398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0624"
FT                   /product="glycosyltransferase"
FT                   /note="KEGG: bcl:ABC0513 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67953"
FT                   /db_xref="GOA:Q0AZA1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA1"
FT                   /protein_id="ABI67953.1"
FT                   /translation="MQLQYSANTVRLNRAKLHMQQQGVSIITCSNRPECRDNILANFFR
FT                   QDFSPKELLIILNSNSMNLREWRMWTAGFPAVRVFQVDESQSQGACLNYALNYINMGYA
FT                   AKFDDDDYYAPGYLREQMEVFPGSGAHVVGKSSWFIYFEDSQTLAIFNPNHENSYEEYL
FT                   TGASLVIKREVFQEVKFRDFSVGEDLWFLKDCMEKGIVIYSSSRFNFVGIRRPNPESHT
FT                   WQESEEQIMPRCEFVAHTADYGPLIIR"
FT   gene            718702..718896
FT                   /locus_tag="Swol_0625"
FT   CDS_pept        718702..718896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0625"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="KEGG: mta:Moth_1493 protein of unknown function
FT                   DUF1458"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67954"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZA0"
FT                   /protein_id="ABI67954.1"
FT                   /translation="MQVKVSEFVGESRRSWQDAVENAVSEASRDINNISGVEVVNWTAN
FT                   CADNKIVEYKANIRIAYLG"
FT   gene            719230..719697
FT                   /locus_tag="Swol_0626"
FT   CDS_pept        719230..719697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0626"
FT                   /product="spore formation protein spoVAC"
FT                   /note="KEGG: tte:TTE1319 spore formation protein spoVAC"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67955"
FT                   /db_xref="GOA:Q0AZ99"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014203"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ99"
FT                   /protein_id="ABI67955.1"
FT                   /translation="MNTPDPKRWKKIEVEEYENLVQQVKPKPPLLKHCVWAFIVGGLIC
FT                   LLAQLIMNYLLKQGIGKVDASSYTAVIMIFLGAFLTGIGIYDELGKRAGAGSIVPITGF
FT                   ANAIVASAMEFKREGYIFGVGARIFTVAGPTLLFGFVVAVLIGLIKVFISS"
FT   gene            719744..720754
FT                   /locus_tag="Swol_0627"
FT   CDS_pept        719744..720754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0627"
FT                   /product="stage V sporulation AD"
FT                   /note="KEGG: mta:Moth_1375 stage V sporulation AD"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67956"
FT                   /db_xref="GOA:Q0AZ98"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR038369"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ98"
FT                   /protein_id="ABI67956.1"
FT                   /translation="MPAKKKRGAQTLVFDQPPVITSWASIAGPKEGQGPWGQDFDWSME
FT                   DYLFGEESWEKAENKMLRETVKKALNKRNFDEADTEILMAGDLLNQLVSSNYAARELGI
FT                   PFLGLYGACSTMAESLLLAAILVDGEFFERVIAAACSHHYTAERQFRFPTEQGIQKTPS
FT                   SQWTATAAGAVLLEPVGTGPRITAVSIGKVIDMDQKDVSDMGSAMAPAAAHTIKTHFSD
FT                   LNRPSDYYDLIVTGDLGKVGMAITQELFIKDGLQPEPNYSDCGVLLYDDFQEVYAGGSG
FT                   CGCSACFLCGPLLKKMSAGEINKLLFVATGALMSPITSFQGESIPAIAHAVAIEN"
FT   gene            720775..721134
FT                   /locus_tag="Swol_0628"
FT   CDS_pept        720775..721134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0628"
FT                   /product="SpoVA protein"
FT                   /note="KEGG: mta:Moth_1374 SpoVA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67957"
FT                   /db_xref="GOA:Q0AZ97"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014204"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ97"
FT                   /protein_id="ABI67957.1"
FT                   /translation="MVPLYMAFLIGGLLCLIGQLIMDLTKASITPGHILVGYISGGALL
FT                   SGLGLYEPLVKIGGAGATIPLSGFGHLLTQGSLKAVEQKGLLGAFSGGVEAAAAGITAA
FT                   VIFGYLAAVLFNPKG"
FT   gene            721140..722642
FT                   /locus_tag="Swol_0629"
FT   CDS_pept        721140..722642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0629"
FT                   /product="GerA spore germination protein"
FT                   /note="KEGG: mta:Moth_1373 GerA spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67958"
FT                   /db_xref="GOA:Q0AZ96"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ96"
FT                   /protein_id="ABI67958.1"
FT                   /translation="MFKKGSHLYLGKDYDKNLDIMKQELAEGENFDLIVREVRVGGRKA
FT                   AFICLDGFVKDDIMTECMKSLLALKKEVFLSSTVKSILEKGVPYVELSTENKIDELLYS
FT                   VLSGSVLFILDGSEEAFIIDPRTYPARNPEEPDIERVVRGSRDGFTETIVFNTALLRRR
FT                   VRDPKLRIELLQAGKRSKTDICVCYLKDVADPALVEDIKSKISGIAIDALPMAEKSVEE
FT                   LIMPGNWWNPFPKVRYTERPDVAAVHLFEGHVLIMVDTSPSVIILPVTFFHHLQHAEEY
FT                   RQSPSVGVYIRWVRFIAVLASIIITPLWLLLALSPEILPASLKFIGPKEVGNVPIFLQF
FT                   VIAEISLDMMRMAAIHTPSPLATALGVIAALLIGDVAVKIGLLVPEVILYTAMVAVGSY
FT                   CTPSYEMAMANRLMRFFILLGTGFFRLPGFIVTSILVILLAAFTKSLKVPYLWPLIPFN
FT                   YRALKGILVRSPVPIQNLRPEILNTQDQSRQPSPAYKRRREE"
FT   gene            722642..723598
FT                   /pseudo
FT                   /locus_tag="Swol_0630"
FT   gene            723609..724718
FT                   /locus_tag="Swol_0631"
FT   CDS_pept        723609..724718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67959"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ95"
FT                   /protein_id="ABI67959.1"
FT                   /translation="MKVSFPHMGYLYIPLKTLFKGLKLEVIAPPPISQKTMELGVKYSP
FT                   EFACLPLKINMGNFIEAMEQGADTIVMAGGWGPCRFGYYAQVEREILQELGYDFKMVIL
FT                   EAPDSRISELLLQLKALGEKVSVREAYKAIRFAWKKLIAIEKLEKMLEYCLPRAVDKNH
FT                   METIFERALQAVDEAESQQEVEKIAQESLREMEKSPFKSAEVLKIGLVGEIYTILEPAS
FT                   NCHVARCLGRLDAHVSRSIYVSDWVNDHLFGGYLRKSNHKQIMQSSRPYLNYEVGGHGR
FT                   ETVGSTVDFARLDYNGIIQIAPLTCMPEIVAQSILGKVSEELEIPCMTMYFDEHSGAAG
FT                   VYTRLEAFVDMLQRKKNLPSSPLLLEARA"
FT   gene            724744..725739
FT                   /locus_tag="Swol_0632"
FT   CDS_pept        724744..725739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0632"
FT                   /product="CoA-substrate-specific enzyme activase domain
FT                   protein"
FT                   /note="KEGG: chy:CHY_1411 CoA-substrate-specific enzyme
FT                   activase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67960"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ94"
FT                   /protein_id="ABI67960.1"
FT                   /translation="MNLYLGVDIGSVSSNFILLDQNGRLYRKLYLRTLGNPVKALKDGY
FT                   ASISDGLDKQHGKIRAVGSTGSGRHLAAVLLGADVVKNEITAHAVAASHLFPGAKTIIE
FT                   IGGQDSKIIILRNGIVHDFAMNTVCAAGTGSFLDQQSARLNIPIQEFGDYAVKSGHPVR
FT                   IAGRCGVFAESDMIHKQQMGFPVEDIIMGLCEALVRNYLNNVGKGKKIEEPVVFQGGVA
FT                   ANRGLAKAFEKILGLKINVPAHYEVMGAIGAAILAREQIELSHSPTRFRGDNFVLEGNF
FT                   TSNSHECSGCPNLCEVVCIKRDNEVLAYWGDRCKKWESSIKQPREKLKVV"
FT   gene            complement(726146..727453)
FT                   /locus_tag="Swol_0633"
FT   CDS_pept        complement(726146..727453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0633"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: bat:BAS5120 UDP-N-acetyl-D-mannosamine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67961"
FT                   /db_xref="GOA:Q0AZ93"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ93"
FT                   /protein_id="ABI67961.1"
FT                   /translation="MNKLYGKMRFCFYRQERRDVKQVIVMGLGYIGLPTAVILAANGYR
FT                   VMGVDRDIKLLQELEQGKIHIEEPNLNLLFQQVRSEKKLRFSPQPENADIFIIAVPTPA
FT                   REDKSCDMTNVLQAVESILPQLQTNNLLIIESTIPPLSCEEIIKPLLEEAGHKVGENLF
FT                   LAFCPERVLPGDIVRELLVNNRVIGGFTRQCAQEAANFYSSFLQGEISLSDLKTAEMTK
FT                   LLENTFRDVNIALVNEMTRICSHLGIDVLEVIRLANKHPRVKLLQPGPGVGGHCLAVDP
FT                   YFIVEKAPSLTPLIKTAREVNASMPAFIVEKAKNLVADMDKPHIAVFGLSYKGNIGDLR
FT                   ESPAWEIVKSLRQEGYSIKVFDPHVTSVFGENSAPAAVKDADLILILTEHDEFRHLDYD
FT                   ELAAGMRTPLVFDTRNIIPARANPFSLIRLYHLGNI"
FT   gene            727608..728525
FT                   /locus_tag="Swol_0634"
FT   CDS_pept        727608..728525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0634"
FT                   /product="dTDP-glucose 4,6-dehydratase related protein"
FT                   /note="KEGG: mth:MTH373 dTDP-glucose 4,6-dehydratase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67962"
FT                   /db_xref="GOA:Q0AZ92"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ92"
FT                   /protein_id="ABI67962.1"
FT                   /translation="MKILVTGGKGVVGSSLVRELRAQGEQVWACDLFHSHENNYYRCDI
FT                   SKFRQLQILFEKEEFDLVYHLAAEFGRWNGEDYYEQMWTTNAVGTKNLLRLQEQFGFRM
FT                   IFSSSSEVYGDYDGIMAEEVMNEVAIKQMNDYAISKWANEMQILNSALMAGTQTVRVRL
FT                   FNTYGPGEFYAPYRSALCVFIYRALHSLPYTVYRQHQRTSLYIDDCIRALASIPDNFKA
FT                   GEVYNIAGIELHDMKSVSDMILDYLGQDDSLVTYKDEENFTTRVKKPDISKAVKDLNYQ
FT                   PKTLLEEGIPATIQWMRETYQLGK"
FT   gene            728535..729311
FT                   /locus_tag="Swol_0635"
FT   CDS_pept        728535..729311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0635"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpv:cgd5_2590 Alg5 like dolichyl-phosphate
FT                   beta-glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67963"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ91"
FT                   /protein_id="ABI67963.1"
FT                   /translation="MGSLKAIVSIIIPSLLRADLLKWNLFSLAQQKIPYPFETIVLNDG
FT                   IPDDTERICREYEQNLNLKYFFSGKRNLDGNIKWRGQGFAMNIGARISTGSILILCDAE
FT                   MYHLNDTVFHLVEPLLQKPNLITIPRLGKNDWSGEFLRHIEERQGKYAPEALEHCDELR
FT                   IKLPFLMAVSRSEFYSIGGFDEDFVGVWYEDDDLVGRLQMNACSYFETGAETVHLFHPR
FT                   DKGEGVEERIAINEKLYFEKMSQIVRNQGREWGKLE"
FT   gene            complement(729363..730289)
FT                   /locus_tag="Swol_0636"
FT   CDS_pept        complement(729363..730289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bld:BLi00859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67964"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ90"
FT                   /protein_id="ABI67964.1"
FT                   /translation="MKLLVISGDFRQYLDSSFHSLMTVLADLLELHLWHKSGSIKDILP
FT                   QLPSTPDFVLVNEPGEINSPVIDELSSLSIPYAVYLHDLHHDSCKEALQDKNLCWVFTR
FT                   YRDKFLDWYPEWQNRMSWLPHHIDNKIFKDYHLPKSIDYLMMGAMHEYVYSLRYKIREK
FT                   MKEKPGFIYHEHPGYKHFSLAEMKNLLVGPNYAREINRAKLFLSCDSVYKYPLLKYFEV
FT                   LACNTLLLAPSSPELLDLGFIPGIHFVDINELNFEEKADFYLKHEKERLDIAQQGYEMV
FT                   QEKHTSTQRAVQLLEMIKEILKSCSTS"
FT   gene            complement(730451..730765)
FT                   /pseudo
FT                   /locus_tag="Swol_0637"
FT   gene            complement(730781..731086)
FT                   /locus_tag="Swol_0638"
FT   CDS_pept        complement(730781..731086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0638"
FT                   /product="nucleotidyltransferase"
FT                   /note="KEGG: mac:MA0102 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67965"
FT                   /db_xref="GOA:Q0AZ89"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ89"
FT                   /protein_id="ABI67965.1"
FT                   /translation="MPNTILTTNTIINTIKEHMSDIKKFSVEEIALFGSVARGEANENS
FT                   DLDVLVLMKRKTLRDYMGLKFYLEELTGRKVDLVMAENLKPTLRQAILSEVISIEN"
FT   gene            731613..732485
FT                   /locus_tag="Swol_0639"
FT   CDS_pept        731613..732485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0639"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="KEGG: cpe:CPE1338 phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67966"
FT                   /db_xref="GOA:Q0AZ88"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ88"
FT                   /protein_id="ABI67966.1"
FT                   /translation="MRKILTIAGSDSCAGAGIQADIKTIQALGAYALSVITAVTAQNTR
FT                   QVTAVREIEALVIEKQLEAIFSDIRLDGIKIGMLGRAGTVQAVSNFLASFFQAGAFWEK
FT                   QLKNSLPLVVDPVMIAKSGDRLLEEEAVESLKKNLLPLASVITPNLMEAGALLGREISS
FT                   LEEMKEAARELLEFGCQWAIVKGGHLKGEPVDVLANKDSLYLLRGQRVDTNCNHGTGCT
FT                   FSAALATLMGQGLAVPAAAKRAKAYVEYCLEHGFAIGEGVGIPHHFAAQRPWKPEALKD
FT                   GSDAAKEEF"
FT   gene            732485..733285
FT                   /locus_tag="Swol_0640"
FT   CDS_pept        732485..733285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0640"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="KEGG: dsy:DSY1402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67967"
FT                   /db_xref="GOA:Q0AZ87"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZ87"
FT                   /protein_id="ABI67967.1"
FT                   /translation="MLKYCAEIWDEVRNRRPLVHCITNYVTVNDVANIILAAGASPAMV
FT                   EYPAEASGFAPLASVLYFNLGTLTGEQEAAMLEGRWAAASRDVPLILDPVACGVIGRKV
FT                   DLIERIKSLGKIQVLKGNIAEIKSLAGLAGKAQGVDSLDTGEGLEEACLQLAVKDKLIA
FT                   VATGEVDIVAEENRYARIFNGTPLFQNITGAGCMAGGVIAACVGAAPEEAWLASITGLL
FT                   AFNLAGERAASQAGNRPGTFRTLLFDELFVLRGEELMKEGRLEW"
FT   gene            733279..733908
FT                   /locus_tag="Swol_0641"
FT   CDS_pept        733279..733908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0641"
FT                   /product="Thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: dsy:DSY1403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67968"
FT                   /db_xref="GOA:Q0AZ86"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZ86"
FT                   /protein_id="ABI67968.1"
FT                   /translation="MVNSDYSLYLVTDRSLLQGRSLLEEVRKAVKGGVSMVQLREKEAG
FT                   SREFYELAQTLQTELRELGVPLLINDRLDIALAVDADGLHLGQDDLPLPVARSLLGKEK
FT                   IIGLSINKREEAREGEKMGADYLGVSPVFSTPTKADAPPATGLEFLASLRQEIKIPLVA
FT                   IGGINKENLKMIKETGADGAAVISALMGASDIEGEARKLRQIWERN"
FT   gene            733893..734540
FT                   /locus_tag="Swol_0642"
FT   CDS_pept        733893..734540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0642"
FT                   /product="phosphoserine phosphatase"
FT                   /note="KEGG: tte:TTE2448 phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67969"
FT                   /db_xref="GOA:Q0AZ85"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ85"
FT                   /protein_id="ABI67969.1"
FT                   /translation="MGEKLIIFMDFDGTISREDVCNKMAARYAGRDWEEINRLWEEGGI
FT                   TTGECASRILSSMEVGAAELEAFFQAQEVDPGFSPFLDWVQKNQHLPIILSDGYDRYIK
FT                   SILRGQGWEIEFYANKLYWDDAWRMESPYLDEECFKCGVCKSKIIQERSLPGYLTVYIG
FT                   DGYSDFCPAASCDIVFAKNELAGYCQKEGLTYYPYRDFHDILQQLPRIVSRM"
FT   gene            734608..735882
FT                   /locus_tag="Swol_0643"
FT   CDS_pept        734608..735882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0643"
FT                   /product="thiamine biosynthesis protein thiC"
FT                   /note="KEGG: ctc:CTC00828 thiamine biosynthesis protein
FT                   thiC"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67970"
FT                   /db_xref="GOA:Q0AZ84"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZ84"
FT                   /protein_id="ABI67970.1"
FT                   /translation="MNYKTQREAARKGIETPEMKKAAEKEGVELKYLQEGLAAGKIALP
FT                   ANRNHLSLQAAAIGAGLKTKINVNLGISRDCSNMEEEMRKVEKALEMQADAIMDLSCHG
FT                   KTQEFRKALLAISPAMIGTVPVYDAMGFLEKELSEITVAEFLQVVETHARDGVDFMTIH
FT                   AGIRRTTLERLRKTPRLTSIVSRGGALLCTWMERNKAENPFYQYFDEVLDICREYDVTL
FT                   SLGDACRPGSINDASDACQLEELITLGDLTLRAWEKDVQVIIEGPGHMPLNEIEANVLL
FT                   QKKLCHSAPFYVLGPLVSDIAPGYDHITSAIGGAIAAAAGADFLCYVTPAEHLRLPSLE
FT                   DMAEGIIAARIAAHAADIAKGLPGASEWDWQMSKARAELDWESMFKLAIDPEKARRYRA
FT                   ESSPELEDSCTMCGQSCALRNMKNL"
FT   gene            735981..737342
FT                   /locus_tag="Swol_0644"
FT   CDS_pept        735981..737342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0644"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: gme:Gmet_2493 tryptophan synthase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67971"
FT                   /db_xref="GOA:Q0AZ83"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ83"
FT                   /protein_id="ABI67971.1"
FT                   /translation="MSRDELTKIILPEDKIPKFWYNVQADMPHPLEPGLHPQTHQPLTP
FT                   SDLEPIFARELILQEVSSERFIEIPREIRELYKQYRPSPLFRARQLEAALQSNCRIYYK
FT                   YEGVSPVGSHKLNSALPQVYFNKVQGIKRISTETGAGQWGTALALACKHFGLEAMIYMV
FT                   KVSFYQKPYRRSIMELYGGRCIPSPSNLTESGRQVLARDPETPGSLAIAISEAVEDAVT
FT                   RDDTNYSLGSVLNHVCLHQSIIGQEVKMQMELVDDYPDIIIGCCGGGSNFAGIAFPFIP
FT                   DKLAGKNIRLVAVEPAACPTLTQGVYAYDYGDVAGFTPLMKMYTLGHDFIPSGIHAGGL
FT                   RYHGESPLVSRLYHDKLIEAVAVKQNPTFEAAMLFAQTESIVPAPESAHAIRVAIDEAL
FT                   KAKEEGVSRTIVFNLSGHGHLDLFSYDKYLSGETEDVEFSDAELKESLRNLPQI"
FT   gene            737800..738489
FT                   /locus_tag="Swol_0645"
FT   CDS_pept        737800..738489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67972"
FT                   /db_xref="GOA:Q0AZ82"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ82"
FT                   /protein_id="ABI67972.1"
FT                   /translation="MLNKRLLTVSDSVIRGEAAADIGADHGLLALFLLEKGIVPWVIAS
FT                   EVKEGPFERLRQAVEKSTFYERIELRLGNGLEVLQPGEVATVIVAGMGGDNIAEILSRK
FT                   WSHSASYRKFIFQPMSKTEVLRRELSQQGWPILEEKLLEEQQRIYLILSSCPGDIPYEL
FT                   TPLELDLGPIILRCDNPLKKRFLVDSLRKYRRVYQGLLQSKGIIQANSLEEYEKKIKTL
FT                   EEIIHAS"
FT   gene            738479..739594
FT                   /locus_tag="Swol_0646"
FT   CDS_pept        738479..739594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0646"
FT                   /product="protein of unknown function DUF34"
FT                   /note="KEGG: mta:Moth_0626 protein of unknown function
FT                   DUF34"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67973"
FT                   /db_xref="GOA:Q0AZ81"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ81"
FT                   /protein_id="ABI67973.1"
FT                   /translation="MQARVKDIIGIMEEHFPPWLAEAWDNSGLQLGSTNKAVKKAAVAL
FT                   DLDESILNQALELKVAMIITHHPLFFKPLKQINYESPVGRLIQRIVKAGISVYAAHSNL
FT                   DAAEKGLNQILAELLGLQDIDILGNHKKEELYKLVVFVPASHYEEVRRAINAAGAGFIG
FT                   NYSDCSFRVRGTGTFRPGAGTQPFLGQEGELEEADEFRLETVVRKRELAQVMQAMQEAH
FT                   PYEEVAFDIFRLEQAGKGYSMGRYGFLPEETKLGDYARQVKETLGLEAVRVVGDLNKVI
FT                   RKVAIVSGSGASLIPGISQQGVDLLVTGDLKYHEARDAEALGLAIIDAGHQGTEEIISP
FT                   HLSRFLEKECQKRGMKVDFIPLYSGPCFKYL"
FT   gene            739954..740976
FT                   /locus_tag="Swol_0647"
FT   CDS_pept        739954..740976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0647"
FT                   /product="HD-GYP domain containing protein"
FT                   /note="KEGG: cac:CAC3650 HD-GYP domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67974"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ80"
FT                   /protein_id="ABI67974.1"
FT                   /translation="MLKIKTSNLRPGIKLGKDIYSYDSQLLLTSGSTITQEHLDSFARR
FT                   NIEEVFILDESPRMKPERDFEDVYQDALEVVNSFMVGAMLGSPLDFQEIDKTVDLLREQ
FT                   AFDAIDLFRQMRLMKNKGEYLFTHSINVSLLCILIGRWLKCDRNTIRELGIAGLLHDLG
FT                   KVFIENDILNKPGKLTDQEYEKIKKHTVLGYNFICQNPDMNLEVANAALMHHERVDGSG
FT                   YPSGLKGQLNFYAAVVAVADVYDAITSAHSYADKRSPYSAAEILWQESFGKLDARITKV
FT                   FYDKITNFYVGNKVLLSNKKEGIVIYVDPFQPTRPIVMVEDEFYNLALDRSITIRDIID
FT                   "
FT   gene            741169..741501
FT                   /locus_tag="Swol_0648"
FT   CDS_pept        741169..741501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0648"
FT                   /product="bacterial nucleoid protein Hbs"
FT                   /note="KEGG: bsu:BG10276 non-specific DNA-binding protein
FT                   HBsu"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67975"
FT                   /db_xref="GOA:Q0AZ79"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ79"
FT                   /protein_id="ABI67975.1"
FT                   /translation="MNKSELVKSLAEKAEITQKDAAKVLDALVESIQQALAGGDKVQII
FT                   GFGSFEVRDRKERKVISPATGKEITVPATKVPAFKPGKSLKEAVAVKKKAAPAKGGSKK
FT                   KPAKKK"
FT   gene            complement(741640..742011)
FT                   /gene="rnpB"
FT                   /locus_tag="Swol_R0068"
FT   misc_RNA        complement(741640..742011)
FT                   /gene="rnpB"
FT                   /locus_tag="Swol_R0068"
FT                   /product="RNA component of RNaseP"
FT   gene            742974..744812
FT                   /locus_tag="Swol_0649"
FT   CDS_pept        742974..744812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67976"
FT                   /db_xref="GOA:Q0AZ78"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ78"
FT                   /protein_id="ABI67976.1"
FT                   /translation="MAERTKITLKSPDRPPMEFWTLAGKNLWDSIMTSGMVSPGACGGK
FT                   GNCGQCKVKLEGEIDEISDSERQYLLPEELRTGTRLACFCRVKGPLTVYLDPLALAIQD
FT                   QAWLKSDSPPVAFSAPVKNRQVLIPGMEKDSPVPLLTRLARALPGLKLELTVDNLNQLA
FT                   QIDRIGRPALELQALVFKEQAVKYIGRKREKACGLALDIGSTSLFAVMLNLEDGQHLAI
FT                   STKPNMQRVYGADILSRVLHCLENPDGLERLQQILLNNLSSMIEEMLEETGTSPEHIYY
FT                   LVLVGNPVMLHFFLGLNPAGFAQAPYAGIFCDEFTYPAAGLGLPVNPEAEILLLPQVGG
FT                   FVGADTVAAVLSLPDWRSSRFLLVDIGTNGEVVVGNRGKLWAASAAAGPAFEGGGISSG
FT                   MIAGDGAIDKICLNPEGGLEYNLIGDSPARGLCGSAIIDIIASLRQGAYIDSNGIITEL
FT                   AGEKLRVRQGERGAEIILVEENESFRGAPVVFNQEDIRQVQLAKAALRTAIDVLMKEAG
FT                   LEYKKLEKVYLAGAFGNYLNPHNAIDIGMIPPIKTETIRNIGNAAAAGAIAALLSPDKQ
FT                   REAREIKEQVHYVELALYPDFQSLYLNNLNFDPAAK"
FT   gene            745034..745792
FT                   /locus_tag="Swol_0650"
FT   CDS_pept        745034..745792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0650"
FT                   /product="putative crotonase"
FT                   /note="KEGG: ctc:CTC02427 putative crotonase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67977"
FT                   /db_xref="GOA:Q0AZ77"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ77"
FT                   /protein_id="ABI67977.1"
FT                   /translation="MEYQDIIFSKENKIGIVQINRPEFMNALTMELLKELAHVFEEMEK
FT                   DEEINAVVLTGVEKAFSAGFDMPSVMSLGENKSAGLKIIEESFLNILKFPLPVIAAVSG
FT                   PALAAGFDLMVMADIRVMSETAKVGQPEIRWALTPLSDPLWKIIGMGRAKEVTMTGRIY
FT                   GAEEAREMGLANYVYPRESYLEEAKKLAQRIAAFEREALKANKEQTNRVPGMEVQSAIR
FT                   TQLWTFRNFVGSEAMCSRMQAFLESNKNKG"
FT   gene            745814..746572
FT                   /locus_tag="Swol_0651"
FT   CDS_pept        745814..746572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0651"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="KEGG: chy:CHY_1186 oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67978"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ76"
FT                   /protein_id="ABI67978.1"
FT                   /translation="MKLKGKVAVITGGGTGIGRAAAIALAAEGARVVVMGRRPEPLNET
FT                   VDIVKERGGEGLAIPSDVTKIEDIEKARDEVRETYGRLDILVNNAGSALFKPFMKTSLE
FT                   DFDRIYQVDLRSVFAVSQLMLPLMLEGGGGSIINIASILGVLGGKSSSAYCAMKGGVVQ
FT                   LTRALAAELGPEIRVNCLCPSHIITPMMEDELSRIESKGKMDKLTKMFPMKRLAYPEDM
FT                   TGSILFYASDDSKWLTGNILMIDGGLSCYI"
FT   sig_peptide     745814..745894
FT                   /locus_tag="Swol_0651"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.926 at
FT                   residue 27"
FT   gene            complement(746628..747929)
FT                   /locus_tag="Swol_0652"
FT   CDS_pept        complement(746628..747929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0652"
FT                   /product="conserved putative phosphatase"
FT                   /note="KEGG: pca:Pcar_2153 conserved hypothetical
FT                   protein-putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67979"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ75"
FT                   /protein_id="ABI67979.1"
FT                   /translation="MADIIPFKGLRYNPEKISNLASVVTPPYDIIDESAQARYYAENPA
FT                   NVIRLELGLMFPQDSSSNNRYTRAAQYLEKWQEDQTLLAEDKAALYLYQQEFNFRGEKV
FT                   VRTGFVCGLKLEPYENGNILPHEETLSKPKADRLQLMRATNSNFSSIFGLYSDEQKEAE
FT                   KLLFAEVKEQAPDINIIDEAGETHKIWVIKNEELIERIVALLADRPVYIADGHHRYETA
FT                   LEYYHEMKEQGFQGYDYVMATLVNVFDEGLVVLPTHRLVGNIPSFKLDAFINRLADLFA
FT                   IELYKDKNIGAFMQELESKAKEHKVFGLYSGKDLYFLELNNPEQASDLLPDNKSAAWEN
FT                   LDVALLDNIILDQLLGINEQKRRSQENLAYTRSEEWLMEQVDNRNYQLGFLLNPTRVEE
FT                   IIAVAQARDKMPQKSTYFYPKLITGLIINNLSIN"
FT   gene            748156..748926
FT                   /locus_tag="Swol_0653"
FT   CDS_pept        748156..748926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0653"
FT                   /product="Histidinol-phosphatase"
FT                   /EC_number="3.1.3.15"
FT                   /note="KEGG: mta:Moth_0817 histidinol phosphate
FT                   phosphatase, HisJ"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67980"
FT                   /db_xref="GOA:Q0AZ74"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ74"
FT                   /protein_id="ABI67980.1"
FT                   /translation="MLLDYHIHALAHGEYDYSESWLRLFAENARRERLAEIGFSEHDEY
FT                   LPRIKPDKLKRLQEDFPELKIRMGLEVDYHPGREKEIQQMLVNSNIDYDYIIGSVHFID
FT                   GWGFDHPDFKAQFATQDIDDIYADYFSLVNQAVNSRLFDVVGHLDLIKIWGHRPVKKSI
FT                   LAYVEPVLNSIKAAGMVVEINSSGLRKAVGEIYPSRQILEPMLALNIPITLGSDAHHPS
FT                   QLGEGLEEATGLAQGVGYRQLVTFSGRRRQLVKI"
FT   gene            749021..750031
FT                   /locus_tag="Swol_0654"
FT   CDS_pept        749021..750031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0654"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="KEGG: mta:Moth_0818 sodium/calcium exchanger
FT                   membrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67981"
FT                   /db_xref="GOA:Q0AZ73"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ73"
FT                   /protein_id="ABI67981.1"
FT                   /translation="MSSIGILILSLGIILLGAEVFVNGVEWLGEKLNLSEGAVGSVLAA
FT                   VGTALPETLIPVIAIVFSHGKEGHDIGIGAILGAPLMLSTLAMFVTGLAVVFFSRRRIK
FT                   GNKVQADYSSMTRDLSFFIIVFAAAIITGTMPPYLRHWQLIIAGFMVLSYFLYVYVMIS
FT                   EERDLDSSYELPPCYFARKEKSPRLSLVIGQVLFALLLIIIGADMFVGAVKEVAVMYQV
FT                   PAFVLALIITPIATELPEKFNSVIWISREKDSLALGNITGAMVFQSSLIPALGIFLTDW
FT                   QLSGGAFLSALLALAAAAILYIELLRKKHITAGTLLLMGVFYGIFLIGVFEGVIR"
FT   gene            750081..750428
FT                   /locus_tag="Swol_0655"
FT   CDS_pept        750081..750428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ser:SERP1381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67982"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0AZ72"
FT                   /protein_id="ABI67982.1"
FT                   /translation="MSNVNSYDKAHELARAITKSEPYLNYCQAKKEVEKNPEWTSKLLE
FT                   LRQRQAEFNRAQILGNDIPKETVQELSLEFAHINQINEIAEFFRAETAFVQMFNDIQEI
FT                   INKAIESGLEA"
FT   gene            750828..751376
FT                   /locus_tag="Swol_0656"
FT   CDS_pept        750828..751376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0656"
FT                   /product="NADH:ubiquinone oxidoreductase 24 kD subunit-like
FT                   protein"
FT                   /note="KEGG: tko:TK1614 NADH:ubiquinone oxidoreductase,
FT                   subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67983"
FT                   /db_xref="GOA:Q0AZ71"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ71"
FT                   /protein_id="ABI67983.1"
FT                   /translation="MHFYSKNKRAEEKSFLDAQLDLSPVLKIIEEKRHEKGSLIAILQQ
FT                   AQDIYGYLPLSVLKCIARELGIKPAKVYGIATFYTQFRLQPAGKYQIMFCQGTACHVNG
FT                   SERIESTLCQELKIKRGETTPDGLFSLESAACLGCCSLAPVMMINGQAYGPLSAEKAIA
FT                   IIRKIKAAESSSLVGGETK"
FT   gene            751373..753145
FT                   /locus_tag="Swol_0657"
FT   CDS_pept        751373..753145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0657"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: tko:TK1613 NADH:ubiquinone oxidoreductase,
FT                   NADH-binding subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67984"
FT                   /db_xref="GOA:Q0AZ70"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ70"
FT                   /protein_id="ABI67984.1"
FT                   /translation="MKVRLGLGSCGIAAGGLQVLEALQKEMESRGIKLEIQKSGCIGLC
FT                   HHEPLLDWIEDDGRVFTYGAVDAGRSVEILEAHLAGCGPLEAYLVSSSDEPAEFLQQQL
FT                   RIVLRNCGRIDPESIDDYRRQDGYSALQKVLAKMSPEEVIEEIEVSALRGRGGAGFLTG
FT                   LKWKATREAGGLYRYIICNADEGDPGAFMDRSILEGDPHAVLEGMIIAAYAIGAEQGII
FT                   YCRAEYPLAVKRLEIAIAQARQKGLLGQRILGSDFSFDISIQQGAGAFVCGEETALIAS
FT                   LEGERGMPRLKPPYPSESGLWGYPSSINNVETLANVPWIIRNGGEAFAALGSRESKGTK
FT                   VFALAGKIERGGLVEVPMGTTLREIIYGIGGGVKTGRRIKAVQMGGPSGGCIPAELLDI
FT                   PVDYQSLSNTGAIMGSGGMVVLDESSCMVDLARFFLDFTQKESCGKCVQCRIGTKRMLE
FT                   ILERICQGEGQEGDIELLEELSAHISENSLCGLGQSAPNPVLTTIRYFRDEYEAHIREK
FT                   KCPAKQCQELLQYIIDPDRCMGCGLCVYACPADCIKGGENNQPYYIEQENCSKCGACLD
FT                   ICPERFAAVRVPGT"
FT   sig_peptide     751373..751438
FT                   /locus_tag="Swol_0657"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.876) with cleavage site probability 0.545 at
FT                   residue 22"
FT   gene            753417..755483
FT                   /locus_tag="Swol_0658"
FT   CDS_pept        753417..755483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0658"
FT                   /product="glutamate synthase beta chain-related
FT                   oxidoreductase, containing 2Fe-2S and 4Fe-4S clusters"
FT                   /note="KEGG: tko:TK1612 glutamate synthase beta
FT                   chain-related oxidoreductase, containing 2Fe-2S and 4Fe-4S
FT                   clusters"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67985"
FT                   /db_xref="GOA:Q0AZ69"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ69"
FT                   /protein_id="ABI67985.1"
FT                   /translation="MITLTINDREIKVAAGQTILQAAWENGIEIPTLCYDERVKPFASC
FT                   GICVVEVAGSKKLLRSCATEVQEGMQVQTESPRVRQSRKLTLEMLLSDHRGDCCAPCRE
FT                   ACPADTDCQAYIGLIANGQFKEAMAVLKEYYPLPASIGLICPHPCESACRRSLVEEPVS
FT                   IAALKAFVGRYYLEEPKQENDDESGPGSGIAEVKTPSGKRVAVVGAGPAGLTVAYFLAR
FT                   EGHQIEVFEAMPAAGGMLRYGIPDYRLPKKLLEQETELVARLGVKFSFNTRLGQDIFLE
FT                   QLRENYDAVFLGIGAWVSSKIGCAGEETRGVLGGIEFLRAVALREPVFMGERIAIIGGG
FT                   NTAMDAARTAIRLGAAEVMVLYRRSRAEMPADESEIVEAEEEGIIFKFLLAPEEIIEED
FT                   GRVAAIRMQKMQLGQADASGRRRPEPTGEEEIIAVDTVIAAIGQQVDLGGLEKLELSRW
FT                   NTIASDPLSFMSSMEGVFAGGDGVTGPGIAIEAIAQGRKAAQAMNAYLQGEKLPDNHSP
FT                   YRMSREVRAEDLAGIEKEARIEPPAISPERRLRSFAEVKAAFTPEEALQEAGRCLECGC
FT                   NAFSKCKLLNYAGKYEVKPQRLAGEIHHHSSEYHHPFLDWDTDKCILCGLCVRICDEVM
FT                   GITALGLVNRGFETVVMPEWEWGIDLENSACNCCGECAVVCPTGALMTRGRGY"
FT   gene            755651..756625
FT                   /locus_tag="Swol_0659"
FT   CDS_pept        755651..756625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0659"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="KEGG: gme:Gmet_0815 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67986"
FT                   /db_xref="GOA:Q0AZ68"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q0AZ68"
FT                   /protein_id="ABI67986.1"
FT                   /translation="MKKTKLALLVILGLLLLLPGCNDKKASPSIAEVNSEIITQEQYDK
FT                   ACQNLKQAYEVQNPAQSGDKADSSGKIDSEMEKRLQDQAFDSLVMQALLRQDAEKRGIK
FT                   IKEKEIDVAIDSFKANLAAEGKDAYQKFLQENNLNEKELREEARMQLLVNQLQKKINAS
FT                   ITIEEEELQQYYQENIASFQEAAGMQISHILVATDKEARELLTQLQQGADFAQLAQEHS
FT                   SCASKAQGGYLGVVNENSNYVPEFKNAALQLKAGEITQEPVKSDFGYHIIKAGQLQPTT
FT                   TKSFDEVKNQIRMQLEKEKENTLFSQYMEDLRQQAQIKDHRKS"
FT   sig_peptide     755651..755725
FT                   /locus_tag="Swol_0659"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.770) with cleavage site probability 0.350 at
FT                   residue 25"
FT   gene            756976..757416
FT                   /locus_tag="Swol_0660"
FT   CDS_pept        756976..757416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swol_0660"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /note="KEGG: tte:TTE1252 Fe2+/Zn2+ uptake regulation
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Swol_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABI67987"
FT                   /db_xref="GOA:Q0AZ67"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL: