(data stored in ACNUC7421 zone)

EMBL: CP000454

ID   CP000454; SV 1; circular; genomic DNA; STD; PRO; 4698945 BP.
XX
AC   CP000454; AAHG01000000-AAHG01000047;
XX
PR   Project:PRJNA12640;
XX
DT   03-NOV-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Arthrobacter sp. FB24, complete genome.
XX
KW   .
XX
OS   Arthrobacter sp. FB24
OC   Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
XX
RN   [1]
RP   1-4698945
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chertkov O., Thompson S., Brettin T., Bruce D., Han C., Tapia R., Gilna P.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Beasley F., Chen W., Jerke K., Nakatsu C.H., Richardson P.;
RT   "Complete sequence of chromosome 1 of Arthrobacter sp. FB24";
RL   Unpublished.
XX
RN   [2]
RP   1-4698945
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chertkov O., Thompson S., Brettin T., Bruce D., Han C., Tapia R., Gilna P.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Beasley F., Chen W., Jerke K., Nakatsu C.H., Richardson P.;
RT   ;
RL   Submitted (28-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 556af6b20e2d54df988d3902a66c9409.
DR   BioSample; SAMN02598278.
DR   EnsemblGenomes-Gn; Arth_R0001.
DR   EnsemblGenomes-Gn; Arth_R0002.
DR   EnsemblGenomes-Gn; Arth_R0003.
DR   EnsemblGenomes-Gn; Arth_R0004.
DR   EnsemblGenomes-Gn; Arth_R0005.
DR   EnsemblGenomes-Gn; Arth_R0006.
DR   EnsemblGenomes-Gn; Arth_R0007.
DR   EnsemblGenomes-Gn; Arth_R0008.
DR   EnsemblGenomes-Gn; Arth_R0010.
DR   EnsemblGenomes-Gn; Arth_R0011.
DR   EnsemblGenomes-Gn; Arth_R0012.
DR   EnsemblGenomes-Gn; Arth_R0013.
DR   EnsemblGenomes-Gn; Arth_R0014.
DR   EnsemblGenomes-Gn; Arth_R0015.
DR   EnsemblGenomes-Gn; Arth_R0016.
DR   EnsemblGenomes-Gn; Arth_R0017.
DR   EnsemblGenomes-Gn; Arth_R0018.
DR   EnsemblGenomes-Gn; Arth_R0019.
DR   EnsemblGenomes-Gn; Arth_R0020.
DR   EnsemblGenomes-Gn; Arth_R0021.
DR   EnsemblGenomes-Gn; Arth_R0022.
DR   EnsemblGenomes-Gn; Arth_R0023.
DR   EnsemblGenomes-Gn; Arth_R0024.
DR   EnsemblGenomes-Gn; Arth_R0025.
DR   EnsemblGenomes-Gn; Arth_R0026.
DR   EnsemblGenomes-Gn; Arth_R0027.
DR   EnsemblGenomes-Gn; Arth_R0028.
DR   EnsemblGenomes-Gn; Arth_R0029.
DR   EnsemblGenomes-Gn; Arth_R0030.
DR   EnsemblGenomes-Gn; Arth_R0031.
DR   EnsemblGenomes-Gn; Arth_R0032.
DR   EnsemblGenomes-Gn; Arth_R0033.
DR   EnsemblGenomes-Gn; Arth_R0034.
DR   EnsemblGenomes-Gn; Arth_R0035.
DR   EnsemblGenomes-Gn; Arth_R0036.
DR   EnsemblGenomes-Gn; Arth_R0037.
DR   EnsemblGenomes-Gn; Arth_R0038.
DR   EnsemblGenomes-Gn; Arth_R0039.
DR   EnsemblGenomes-Gn; Arth_R0040.
DR   EnsemblGenomes-Gn; Arth_R0041.
DR   EnsemblGenomes-Gn; Arth_R0042.
DR   EnsemblGenomes-Gn; Arth_R0043.
DR   EnsemblGenomes-Gn; Arth_R0044.
DR   EnsemblGenomes-Gn; Arth_R0045.
DR   EnsemblGenomes-Gn; Arth_R0046.
DR   EnsemblGenomes-Gn; Arth_R0047.
DR   EnsemblGenomes-Gn; Arth_R0048.
DR   EnsemblGenomes-Gn; Arth_R0049.
DR   EnsemblGenomes-Gn; Arth_R0050.
DR   EnsemblGenomes-Gn; Arth_R0051.
DR   EnsemblGenomes-Gn; Arth_R0052.
DR   EnsemblGenomes-Gn; Arth_R0053.
DR   EnsemblGenomes-Gn; Arth_R0054.
DR   EnsemblGenomes-Gn; Arth_R0055.
DR   EnsemblGenomes-Gn; Arth_R0056.
DR   EnsemblGenomes-Gn; Arth_R0057.
DR   EnsemblGenomes-Gn; Arth_R0058.
DR   EnsemblGenomes-Gn; Arth_R0059.
DR   EnsemblGenomes-Gn; Arth_R0060.
DR   EnsemblGenomes-Gn; Arth_R0061.
DR   EnsemblGenomes-Gn; Arth_R0062.
DR   EnsemblGenomes-Gn; Arth_R0063.
DR   EnsemblGenomes-Gn; Arth_R0064.
DR   EnsemblGenomes-Gn; Arth_R0065.
DR   EnsemblGenomes-Gn; Arth_R0066.
DR   EnsemblGenomes-Gn; Arth_R0067.
DR   EnsemblGenomes-Gn; Arth_R0069.
DR   EnsemblGenomes-Gn; EBG00001130565.
DR   EnsemblGenomes-Gn; EBG00001130566.
DR   EnsemblGenomes-Gn; EBG00001130567.
DR   EnsemblGenomes-Gn; EBG00001130568.
DR   EnsemblGenomes-Gn; EBG00001130569.
DR   EnsemblGenomes-Gn; EBG00001130570.
DR   EnsemblGenomes-Gn; EBG00001130571.
DR   EnsemblGenomes-Gn; EBG00001130572.
DR   EnsemblGenomes-Gn; EBG00001130573.
DR   EnsemblGenomes-Gn; EBG00001130574.
DR   EnsemblGenomes-Gn; EBG00001130575.
DR   EnsemblGenomes-Gn; EBG00001130576.
DR   EnsemblGenomes-Gn; EBG00001130577.
DR   EnsemblGenomes-Gn; EBG00001130578.
DR   EnsemblGenomes-Gn; EBG00001130579.
DR   EnsemblGenomes-Gn; EBG00001130580.
DR   EnsemblGenomes-Gn; EBG00001130581.
DR   EnsemblGenomes-Gn; EBG00001130582.
DR   EnsemblGenomes-Gn; EBG00001130583.
DR   EnsemblGenomes-Gn; EBG00001130584.
DR   EnsemblGenomes-Gn; EBG00001130585.
DR   EnsemblGenomes-Gn; EBG00001130586.
DR   EnsemblGenomes-Gn; EBG00001130587.
DR   EnsemblGenomes-Gn; EBG00001130588.
DR   EnsemblGenomes-Gn; EBG00001130589.
DR   EnsemblGenomes-Gn; EBG00001130590.
DR   EnsemblGenomes-Gn; EBG00001130591.
DR   EnsemblGenomes-Gn; EBG00001130592.
DR   EnsemblGenomes-Gn; EBG00001130593.
DR   EnsemblGenomes-Gn; EBG00001130594.
DR   EnsemblGenomes-Gn; EBG00001130595.
DR   EnsemblGenomes-Gn; EBG00001130596.
DR   EnsemblGenomes-Gn; EBG00001130597.
DR   EnsemblGenomes-Gn; EBG00001130598.
DR   EnsemblGenomes-Gn; EBG00001130599.
DR   EnsemblGenomes-Gn; EBG00001130600.
DR   EnsemblGenomes-Gn; EBG00001130601.
DR   EnsemblGenomes-Gn; EBG00001130602.
DR   EnsemblGenomes-Gn; EBG00001130603.
DR   EnsemblGenomes-Gn; EBG00001130604.
DR   EnsemblGenomes-Gn; EBG00001130605.
DR   EnsemblGenomes-Gn; EBG00001130606.
DR   EnsemblGenomes-Gn; EBG00001130607.
DR   EnsemblGenomes-Gn; EBG00001130608.
DR   EnsemblGenomes-Gn; EBG00001130609.
DR   EnsemblGenomes-Gn; EBG00001130610.
DR   EnsemblGenomes-Gn; EBG00001130611.
DR   EnsemblGenomes-Gn; EBG00001130612.
DR   EnsemblGenomes-Gn; EBG00001130613.
DR   EnsemblGenomes-Gn; EBG00001130614.
DR   EnsemblGenomes-Gn; EBG00001130615.
DR   EnsemblGenomes-Gn; EBG00001130616.
DR   EnsemblGenomes-Gn; EBG00001130617.
DR   EnsemblGenomes-Gn; EBG00001130618.
DR   EnsemblGenomes-Gn; EBG00001130619.
DR   EnsemblGenomes-Gn; EBG00001130620.
DR   EnsemblGenomes-Gn; EBG00001130621.
DR   EnsemblGenomes-Gn; EBG00001130622.
DR   EnsemblGenomes-Gn; EBG00001130623.
DR   EnsemblGenomes-Gn; EBG00001130624.
DR   EnsemblGenomes-Gn; EBG00001130625.
DR   EnsemblGenomes-Gn; EBG00001130626.
DR   EnsemblGenomes-Gn; EBG00001130627.
DR   EnsemblGenomes-Gn; EBG00001130628.
DR   EnsemblGenomes-Gn; EBG00001130629.
DR   EnsemblGenomes-Gn; EBG00001130630.
DR   EnsemblGenomes-Gn; EBG00001130631.
DR   EnsemblGenomes-Gn; EBG00001130632.
DR   EnsemblGenomes-Gn; EBG00001130633.
DR   EnsemblGenomes-Gn; EBG00001130634.
DR   EnsemblGenomes-Gn; EBG00001130635.
DR   EnsemblGenomes-Gn; EBG00001130636.
DR   EnsemblGenomes-Gn; EBG00001130637.
DR   EnsemblGenomes-Gn; EBG00001130638.
DR   EnsemblGenomes-Gn; EBG00001130639.
DR   EnsemblGenomes-Tr; Arth_R0001-1.
DR   EnsemblGenomes-Tr; Arth_R0002-1.
DR   EnsemblGenomes-Tr; Arth_R0003-1.
DR   EnsemblGenomes-Tr; Arth_R0004-1.
DR   EnsemblGenomes-Tr; Arth_R0005-1.
DR   EnsemblGenomes-Tr; Arth_R0006-1.
DR   EnsemblGenomes-Tr; Arth_R0007-1.
DR   EnsemblGenomes-Tr; Arth_R0008-1.
DR   EnsemblGenomes-Tr; Arth_R0010-1.
DR   EnsemblGenomes-Tr; Arth_R0011-1.
DR   EnsemblGenomes-Tr; Arth_R0012-1.
DR   EnsemblGenomes-Tr; Arth_R0013-1.
DR   EnsemblGenomes-Tr; Arth_R0014-1.
DR   EnsemblGenomes-Tr; Arth_R0015-1.
DR   EnsemblGenomes-Tr; Arth_R0016-1.
DR   EnsemblGenomes-Tr; Arth_R0017-1.
DR   EnsemblGenomes-Tr; Arth_R0018-1.
DR   EnsemblGenomes-Tr; Arth_R0019-1.
DR   EnsemblGenomes-Tr; Arth_R0020-1.
DR   EnsemblGenomes-Tr; Arth_R0021-1.
DR   EnsemblGenomes-Tr; Arth_R0022-1.
DR   EnsemblGenomes-Tr; Arth_R0023-1.
DR   EnsemblGenomes-Tr; Arth_R0024-1.
DR   EnsemblGenomes-Tr; Arth_R0025-1.
DR   EnsemblGenomes-Tr; Arth_R0026-1.
DR   EnsemblGenomes-Tr; Arth_R0027-1.
DR   EnsemblGenomes-Tr; Arth_R0028-1.
DR   EnsemblGenomes-Tr; Arth_R0029-1.
DR   EnsemblGenomes-Tr; Arth_R0030-1.
DR   EnsemblGenomes-Tr; Arth_R0031-1.
DR   EnsemblGenomes-Tr; Arth_R0032-1.
DR   EnsemblGenomes-Tr; Arth_R0033-1.
DR   EnsemblGenomes-Tr; Arth_R0034-1.
DR   EnsemblGenomes-Tr; Arth_R0035-1.
DR   EnsemblGenomes-Tr; Arth_R0036-1.
DR   EnsemblGenomes-Tr; Arth_R0037-1.
DR   EnsemblGenomes-Tr; Arth_R0038-1.
DR   EnsemblGenomes-Tr; Arth_R0039-1.
DR   EnsemblGenomes-Tr; Arth_R0040-1.
DR   EnsemblGenomes-Tr; Arth_R0041-1.
DR   EnsemblGenomes-Tr; Arth_R0042-1.
DR   EnsemblGenomes-Tr; Arth_R0043-1.
DR   EnsemblGenomes-Tr; Arth_R0044-1.
DR   EnsemblGenomes-Tr; Arth_R0045-1.
DR   EnsemblGenomes-Tr; Arth_R0046-1.
DR   EnsemblGenomes-Tr; Arth_R0047-1.
DR   EnsemblGenomes-Tr; Arth_R0048-1.
DR   EnsemblGenomes-Tr; Arth_R0049-1.
DR   EnsemblGenomes-Tr; Arth_R0050-1.
DR   EnsemblGenomes-Tr; Arth_R0051-1.
DR   EnsemblGenomes-Tr; Arth_R0052-1.
DR   EnsemblGenomes-Tr; Arth_R0053-1.
DR   EnsemblGenomes-Tr; Arth_R0054-1.
DR   EnsemblGenomes-Tr; Arth_R0055-1.
DR   EnsemblGenomes-Tr; Arth_R0056-1.
DR   EnsemblGenomes-Tr; Arth_R0057-1.
DR   EnsemblGenomes-Tr; Arth_R0058-1.
DR   EnsemblGenomes-Tr; Arth_R0059-1.
DR   EnsemblGenomes-Tr; Arth_R0060-1.
DR   EnsemblGenomes-Tr; Arth_R0061-1.
DR   EnsemblGenomes-Tr; Arth_R0062-1.
DR   EnsemblGenomes-Tr; Arth_R0063-1.
DR   EnsemblGenomes-Tr; Arth_R0064-1.
DR   EnsemblGenomes-Tr; Arth_R0065-1.
DR   EnsemblGenomes-Tr; Arth_R0066-1.
DR   EnsemblGenomes-Tr; Arth_R0067-1.
DR   EnsemblGenomes-Tr; Arth_R0069-1.
DR   EnsemblGenomes-Tr; EBT00001721692.
DR   EnsemblGenomes-Tr; EBT00001721693.
DR   EnsemblGenomes-Tr; EBT00001721694.
DR   EnsemblGenomes-Tr; EBT00001721695.
DR   EnsemblGenomes-Tr; EBT00001721696.
DR   EnsemblGenomes-Tr; EBT00001721697.
DR   EnsemblGenomes-Tr; EBT00001721698.
DR   EnsemblGenomes-Tr; EBT00001721699.
DR   EnsemblGenomes-Tr; EBT00001721700.
DR   EnsemblGenomes-Tr; EBT00001721701.
DR   EnsemblGenomes-Tr; EBT00001721702.
DR   EnsemblGenomes-Tr; EBT00001721703.
DR   EnsemblGenomes-Tr; EBT00001721704.
DR   EnsemblGenomes-Tr; EBT00001721705.
DR   EnsemblGenomes-Tr; EBT00001721706.
DR   EnsemblGenomes-Tr; EBT00001721707.
DR   EnsemblGenomes-Tr; EBT00001721708.
DR   EnsemblGenomes-Tr; EBT00001721709.
DR   EnsemblGenomes-Tr; EBT00001721710.
DR   EnsemblGenomes-Tr; EBT00001721711.
DR   EnsemblGenomes-Tr; EBT00001721712.
DR   EnsemblGenomes-Tr; EBT00001721713.
DR   EnsemblGenomes-Tr; EBT00001721714.
DR   EnsemblGenomes-Tr; EBT00001721715.
DR   EnsemblGenomes-Tr; EBT00001721716.
DR   EnsemblGenomes-Tr; EBT00001721717.
DR   EnsemblGenomes-Tr; EBT00001721718.
DR   EnsemblGenomes-Tr; EBT00001721719.
DR   EnsemblGenomes-Tr; EBT00001721720.
DR   EnsemblGenomes-Tr; EBT00001721721.
DR   EnsemblGenomes-Tr; EBT00001721722.
DR   EnsemblGenomes-Tr; EBT00001721723.
DR   EnsemblGenomes-Tr; EBT00001721724.
DR   EnsemblGenomes-Tr; EBT00001721725.
DR   EnsemblGenomes-Tr; EBT00001721726.
DR   EnsemblGenomes-Tr; EBT00001721727.
DR   EnsemblGenomes-Tr; EBT00001721728.
DR   EnsemblGenomes-Tr; EBT00001721729.
DR   EnsemblGenomes-Tr; EBT00001721730.
DR   EnsemblGenomes-Tr; EBT00001721731.
DR   EnsemblGenomes-Tr; EBT00001721732.
DR   EnsemblGenomes-Tr; EBT00001721733.
DR   EnsemblGenomes-Tr; EBT00001721734.
DR   EnsemblGenomes-Tr; EBT00001721735.
DR   EnsemblGenomes-Tr; EBT00001721736.
DR   EnsemblGenomes-Tr; EBT00001721737.
DR   EnsemblGenomes-Tr; EBT00001721738.
DR   EnsemblGenomes-Tr; EBT00001721739.
DR   EnsemblGenomes-Tr; EBT00001721740.
DR   EnsemblGenomes-Tr; EBT00001721741.
DR   EnsemblGenomes-Tr; EBT00001721742.
DR   EnsemblGenomes-Tr; EBT00001721743.
DR   EnsemblGenomes-Tr; EBT00001721744.
DR   EnsemblGenomes-Tr; EBT00001721745.
DR   EnsemblGenomes-Tr; EBT00001721746.
DR   EnsemblGenomes-Tr; EBT00001721747.
DR   EnsemblGenomes-Tr; EBT00001721748.
DR   EnsemblGenomes-Tr; EBT00001721749.
DR   EnsemblGenomes-Tr; EBT00001721750.
DR   EnsemblGenomes-Tr; EBT00001721751.
DR   EnsemblGenomes-Tr; EBT00001721752.
DR   EnsemblGenomes-Tr; EBT00001721753.
DR   EnsemblGenomes-Tr; EBT00001721754.
DR   EnsemblGenomes-Tr; EBT00001721755.
DR   EnsemblGenomes-Tr; EBT00001721756.
DR   EnsemblGenomes-Tr; EBT00001721757.
DR   EnsemblGenomes-Tr; EBT00001721758.
DR   EnsemblGenomes-Tr; EBT00001721759.
DR   EnsemblGenomes-Tr; EBT00001721760.
DR   EnsemblGenomes-Tr; EBT00001721761.
DR   EnsemblGenomes-Tr; EBT00001721762.
DR   EnsemblGenomes-Tr; EBT00001721763.
DR   EnsemblGenomes-Tr; EBT00001721764.
DR   EnsemblGenomes-Tr; EBT00001721765.
DR   EnsemblGenomes-Tr; EBT00001721766.
DR   EuropePMC; PMC2655437; 19168653.
DR   EuropePMC; PMC2991359; 21124797.
DR   EuropePMC; PMC4691658; 26701084.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000454.
DR   SILVA-SSU; CP000454.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634492
CC   Source DNA and bacteria available from Cindy H. Nakatsu
CC   (cnakatsu@purdue.edu)
CC   Contacts: Cindy H. Nakatsu (cnakatsu@purdue.edu)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   Additional notes: There is an uncertain number of G/C in
CC   homopolimer repeats in the regions 3501583-3501612,
CC   3732178-3732195.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4698945
FT                   /organism="Arthrobacter sp. FB24"
FT                   /strain="FB24"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:290399"
FT   gene            5..1429
FT                   /locus_tag="Arth_0001"
FT   CDS_pept        5..1429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: lxx:Lxx00010 chromosomal replication initiator
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01402"
FT                   /db_xref="GOA:A0JQT2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQT2"
FT                   /protein_id="ABK01402.1"
FT                   /translation="MMTVDEANHANTVGSSWRRVVSLLEQDHRVSPRQRGFVILAQAQG
FT                   LIGSTLLVAVPNELTREVLQTQVKEALDDALHNVFSDDIRCAIDVDTDLVPVHTEPEPA
FT                   VELSLATDPTVELKPQPMLPSTSHEFGRLNPKYVFDTFVIGSSNRFAHAAAVAVAEAPA
FT                   KAYNPLFIYGDSGLGKTHLLHAIGHYARRLYSGIRVRYVNSEEFTNDFINSIRDDEGTS
FT                   FKTTYRNVDVLLIDDIQFLAGKDRTLEEFFHTFNALHNNNKQVVITSDQPPKLLAGFED
FT                   RMKSRFEWGLLTDIQPPELETRIAILRKKALSEGLSAPDDALEYIASKISSNIRELEGA
FT                   LIRVTAFASLNRQPVDVALAEMVLKDLITDDGAQEITSAQILTQTADYFKLSMEELCSK
FT                   SRTRTLVTARQIAMYLCRELTDMSLPKIGQELGGRDHTTVIHADRKIRELMAERRVIYN
FT                   QVTELTNRIKQQQRDS"
FT   gene            1965..3089
FT                   /locus_tag="Arth_0002"
FT   CDS_pept        1965..3089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sma:SAV4317 putative DNA polymerase III beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01403"
FT                   /db_xref="GOA:A0JQT3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQT3"
FT                   /protein_id="ABK01403.1"
FT                   /translation="MKFRVERDVLAEAVTWTARSLSPRPPVPVLSGLLLKAEAGTVSLS
FT                   SFDYETSARLEIPADISVEGTILVSGRLLADICRSLPSAPVDVETDGNKVTLTCRRSSF
FT                   HLATMPEAEYPPLPALPTISGTVPGDSFAQAVSQVIIAASKDDTLPILTGVRMEIEDDL
FT                   ITLLATDRYRLAMREVPWKPVTPGISTSALVKAKTLNEVAKTLGNSGDINLALADDDSR
FT                   LIGFESGGRTTTSLLVDGDYPKIRSLFPDATPIHATVQTQELVEAVRRVSLVAERNTPV
FT                   RLAFTDGQLHLDAGTGEDAQASEELEAQLTGDEITVAFNPHYLIEGLSVIETKFVRFSF
FT                   TTAPKPAMITAQVDADGEDQDDYRYLVMPVRLPN"
FT   gene            3140..4024
FT                   /locus_tag="Arth_0003"
FT   CDS_pept        3140..4024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; KEGG: lxx:Lxx00030 6-phosphogluconate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01404"
FT                   /db_xref="GOA:A0JQT4"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQT4"
FT                   /protein_id="ABK01404.1"
FT                   /translation="MHIGLIGLGKMGFNMRERLRKGGLEVTGFDRNPDVTDVATVDELI
FT                   AAVPAPRVIWVMVPAGEITDAVITELGSKLDAGDLVIDGGNSRFTEDQKHGAALAEKGI
FT                   RFADCGVSGGVWGLQNGYGLMAGGDAADIERAMPAFDALRPEGDRADSFVHVGGIGAGH
FT                   YAKMVHNGIEYGLMQAYAEGYELLAAKDIVTDLPGTFRAWQKGTVVRSWLLDLMVKALD
FT                   EDPGLASIDDYVEDSGEGRWTVEEAIANAVPAPAITAALFARFSSREDNSPAMKMVSAL
FT                   RHQFGGHATRPAK"
FT   gene            4061..5266
FT                   /locus_tag="Arth_0004"
FT   CDS_pept        4061..5266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: sco:SCO3876 DNA replication protein; TIGRFAM:
FT                   DNA replication and repair protein RecF; PFAM: SMC domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01405"
FT                   /db_xref="GOA:A0JQT5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JQT5"
FT                   /protein_id="ABK01405.1"
FT                   /translation="MYLEKLSLTDFRSYAQVDLTLEPGVTVLVGYNGIGKTNLMEAIGY
FT                   LATLSSHRVSSDAPLLRFGTERALIRAKLVRGGQSTVLELEINGSRANRGRINRSNPVR
FT                   ARDILGICQTVLFAPEDLALVKGDPSNRRRFLDELLVSLMPRHSATRTDYDRVLKQRNA
FT                   LLKSGRSGKFTAGHEATLDVWDQHMARAGAELLYARLELVERIRPHLKAAYAQLTDGSK
FT                   EADAIYRSTLQGILDDDGAGAGYAAEPAAVERVEDLRALSVEELTQRYVQAFAASRRKE
FT                   LERGISLVGPHRDDVELILGEAPAKGYASHGETWSMCLSLRLASYYVMLDDARTGGSAP
FT                   ILILDDVFAELDVQRRRKLAAIVSGAEQVLVTAAVDADIPDELAGRRVKVVPGGIDESE
FT                   SR"
FT   gene            5263..5820
FT                   /locus_tag="Arth_0005"
FT   CDS_pept        5263..5820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   nfa:nfa40 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01406"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQT6"
FT                   /protein_id="ABK01406.1"
FT                   /translation="MNKDAGGLQPGRDPDDIDAAQAALNRMREAAAARGEIRRKAPLPG
FT                   GAAKKPGRSSAGTRGFTQFHGTGRDPLGLGKVVGRLVAERGWTSPVAVGSVMAEWGTLV
FT                   GPEISAHCTPESFTDTTLHVRCDSTAWATQLRLLSFSLLEKFRTELGEGVVTKIQVLGP
FT                   AAPSWRKGGRTVNGRGPRDTYG"
FT   gene            6234..8324
FT                   /locus_tag="Arth_0006"
FT   CDS_pept        6234..8324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: lxx:Lxx00060 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01407"
FT                   /db_xref="GOA:A0JQT7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQT7"
FT                   /protein_id="ABK01407.1"
FT                   /translation="MANDNADIPAVEPAAEDARTPDAPAEAAERKGYGASDITVLEGLE
FT                   AVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCTHIEIVLQADGGVKVVDDGRG
FT                   IPVDMHPTEHKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSSRVDTEVRR
FT                   QGHVWRMSFADGGKPQGSLVKGEETDQTGTTQTFYPDASIFESTEFDFETLRARFQQMA
FT                   FLNKGLRITLTDERREALESSEDGDLDLDNVPTEGEVAAEYRTVVYQYDDGLLDYVKHL
FT                   NSGKKVDVVHEDVIAFETEDKDRKIALEMAMQWTNAYSESVHTYANTINTHEGGTHEEG
FT                   FRAAMTSLINRYAREKNIIKEKDDNLTGDDIREGLTAVISVKLAEPQFEGQTKTKLGNS
FT                   EVKGFVQRVVTDGLGDWLERNPGPARDVIRKAISAAQARMAARKARDNARRKSPLESFG
FT                   MPGKLSDCSSKDPEKCEVYIVEGDSAGGSAKRGRNPETQAILPLRGKILNVERARLDKA
FT                   LGNNEVQSMITAFGTGIGEDFDLAKLRYHKIVLMADADVDGQHITTLLMTLLFRYMRPL
FT                   IENGYVYLAQPPLYRIKWSNAPHDYVYSDRERDARLLAGQAAGRRIPKDNGIQRYKGLG
FT                   EMDYTELWDTTMDPDHRTLLQVTMDDALAADQIFTVLMGEDVESRRNFIQQNAKDVRFL
FT                   DI"
FT   gene            8391..11099
FT                   /locus_tag="Arth_0007"
FT   CDS_pept        8391..11099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: lxx:Lxx00070 DNA gyrase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01408"
FT                   /db_xref="GOA:A0JQT8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQT8"
FT                   /protein_id="ABK01408.1"
FT                   /translation="MSDETPEVPADSAGPVEPVLEGDVLVDRVEQVDLQTEMQRSYLDY
FT                   AMAVIVGRALPDVRDGLKPVHRRVLYAMFDGGYRPDRSFNKCARVVGEVMGQYHPHGDT
FT                   AIYDALVRLIQDWTMRYPLALGQGNFGSPGNDGAAAPRYTETKMAPLAMEMVRDIDEET
FT                   VDFQDNYDGKNQEPTILPARFPNLLVNGSSGIAVGMATNIPPHNLREVADGVQWYLANP
FT                   TASREELLEELLLRIKGPDFPTGATILGHKGIEDAYRTGRGSITMRAVVNVEELEGRTC
FT                   LVVTELPYQANPDNLAIKIAELVKDGKISGIADLRDETSGRTGQRLVIVLKRDAVAKVV
FT                   LNNLYKHTQLQDNFAANMLAIVDGVPRTLSLDAFIRHWVAHQMDVIARRTRYRLRKAEE
FT                   EAHILRALLKALDMLDEVIALIRASNTTEAARDGLMQLLDIDELQARAILDMQLRRLAA
FT                   LERQKIQDRHAELEALIAEYNSILASEERQREIISTELSEIVAKHGDDRRTKILMGFDG
FT                   DMSMEDLIPEEEMVVTITRGGYVKRTRSDNYRSQQRGGKGIKGAQLRGDDVVEHFFVTT
FT                   THHWLLFFTNLGRVYRAKAYELVEAGRDAKGQHVANLLAFQPDEHIAQVLDLRDYQHAP
FT                   YLVLATKRGLVKKTRLEDYDTNRSAGVIAINLRDGDELVSAQLVSETDDLMLVSRMGQS
FT                   IRFTATDDALRPMGRATSGVTGMKFREDDELLAADVVKDGSFVFIVTEGGYAKRTAVEE
FT                   YRLQGRGGLGIKVGKYQEERGHLVGALIVQEEDEVLVVMEGGKVVRSSVAGVPAKGRDT
FT                   MGVIFAKPDKNDRIIEVARNSERGLEGEEAEAIDPENPAGSPAVAGDDVTLAEGAGSHG
FT                   GSAEADSAPAVESDESSDNAELDEENTGGNE"
FT   gene            11096..11743
FT                   /locus_tag="Arth_0008"
FT   CDS_pept        11096..11743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01409"
FT                   /db_xref="GOA:A0JQT9"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQT9"
FT                   /protein_id="ABK01409.1"
FT                   /translation="MSNSDSYPKPNSNTPGGIRQPASAPRVNAPVRPQQRPSTPGAPAQ
FT                   RPVVPGQRPAQGPRPGQAPQGQRPGAPAQRPAQGGAQGAPGLVKPAPKAKVRRARLLIS
FT                   KVDPWSVLKMAFLLSVALGIVTVVAAIVLWTVLDLTGIFDQVDSLLGTLAGSEGGGFEL
FT                   KKVASLGQVASFAVIIAVVNVVLLTALSMLSAVLYNISATLVGGIGVTLTDD"
FT   gene            11842..11915
FT                   /locus_tag="Arth_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            11842..11915
FT                   /locus_tag="Arth_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12163..12238
FT                   /locus_tag="Arth_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            12163..12238
FT                   /locus_tag="Arth_R0002"
FT                   /product="tRNA-Ala"
FT   gene            12369..13283
FT                   /locus_tag="Arth_0009"
FT   CDS_pept        12369..13283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0009"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: sru:SRU_1674 integral membrane protein
FT                   DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01410"
FT                   /db_xref="GOA:A0JQU0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU0"
FT                   /protein_id="ABK01410.1"
FT                   /translation="MTFFLATLGVLGVASSGPLIAATLGATTVSALAIAFWRNAIGAVV
FT                   MATPVLVGNPRQFGKVTRREFRWSALAAVALALHFACFITSLQLTSVAAATALVCLQSG
FT                   WIAVFQLFRGVRHRWQVLVGLGMAFGGVVAITGFDMGTSPDALLGDVLAVAGGALAGLY
FT                   TLAGGKARETMTTGTYTTLCYGMCASLVAVLALASGQPLVGFEAAGWLGIVAITVCAQL
FT                   VGHTAFNHLLATMSPLLVSMIILLEIPGAAVLAAVFLAETLPGGTYAGLALILVGLAVV
FT                   VAGQRRRRPPPAGEARLAELGTD"
FT   sig_peptide     12369..12434
FT                   /locus_tag="Arth_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 22"
FT   gene            complement(13332..14159)
FT                   /locus_tag="Arth_0010"
FT   CDS_pept        complement(13332..14159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0010"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   blo:BL1674 probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01411"
FT                   /db_xref="GOA:A0JQU1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU1"
FT                   /protein_id="ABK01411.1"
FT                   /translation="MPGVSIVIPAYNEASVIRQCLIAAIYQSVPAAEIIVVDNMSKDRT
FT                   ADIVRQMQQEYPESPIILLSQDRDQGLIPTRNFGLNHATGDVLGRIDADSVVEPDWVEQ
FT                   VQKAFLDPAVQAATGPVVYYDMPMRRFGLKADDKMRQLMLKLAKHQYHFLFGSNMALRR
FT                   SAWETIRDETCRDEKDEMHEDIDLSLHLADHDLRVQYWPQMVSGMSARRLEDSPRDYRY
FT                   YVTRFDRTYKAHNVKKMALKAPMVVFFSVYFPAKLLRAIHTVNSAQPVRRGGQ"
FT   gene            complement(14339..15286)
FT                   /locus_tag="Arth_0011"
FT   CDS_pept        complement(14339..15286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcr:507957.200 mucin-associated surface
FT                   protein (MASP) Pfam: Prosystemin PROSITE: ALA_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01412"
FT                   /db_xref="GOA:A0JQU2"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU2"
FT                   /protein_id="ABK01412.1"
FT                   /translation="MKKSDRIARDLEQSVSSAVENAKDWAAPRVEAAVDWAVPRLQHGI
FT                   DTASPKIQEGLKSAAHNLADGVATVTPRIQDGLAHLAPKIHDVVDSATPRLHEALDKAT
FT                   PVISQARDRVVVEYLPRLSDQIGHASEAVHRTLESAPAHVDAVAQKLADSGVVHSIQDQ
FT                   AQAAGHQLKAAAAEATRVVTGEVAKPQKPKHRGLLIFGVIAAAVAAGVAAWKASKPVED
FT                   PWKTPAPVTPAPVAATTVNDVTAAAKDATATAGEKAVDAADAAADASDDAAAKAADAAE
FT                   DAKDEAAKVATDAKTAVKNIASSMNNGSAKANEN"
FT   gene            15442..15987
FT                   /locus_tag="Arth_0012"
FT   CDS_pept        15442..15987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0012"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: lxx:Lxx00160 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01413"
FT                   /db_xref="GOA:A0JQU3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU3"
FT                   /protein_id="ABK01413.1"
FT                   /translation="MTAIATAKATIHTSLGDIVVNLFGNHAPKTVKNFVGLATGEQAWT
FT                   HPETGEDKTGTPLYNGTIFHRIIKDFMIQAGDPLGRGVGGPGYKFDDEIHPELTFNEPY
FT                   KLAMANAGIQMGKGTNGSQFFITTIPTDWLQGKHSIFGEVADEESKKVVDAIEGVRTGM
FT                   GDRPVEDVVINSIDVEQL"
FT   gene            15994..16875
FT                   /locus_tag="Arth_0013"
FT   CDS_pept        15994..16875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0013"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: lxx:Lxx00170
FT                   rhomboid family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01414"
FT                   /db_xref="GOA:A0JQU4"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU4"
FT                   /protein_id="ABK01414.1"
FT                   /translation="MSYGIPAAEPSAQIPVCPRHPDRPSYVRCQRCGRPACPECQRAAA
FT                   VGFQCIDCVNETKRTTQAARTVYGGTAVAGRPLVTFGIIAVCALVYVLQWIVPNDGIYQ
FT                   NFAFATVYATPEYGVFEPWRMLTSAFLHSQGFILHIVLNMYMLWMFGQALEPLLGRIRF
FT                   LALYLLAAVGGSVGYLLLTPSYTPGQQLAGVVGASGAIFGLFGAMLVVQRHRGGDTKQL
FT                   WVLIAINGVIGFIVPQIAWQAHLGGLVTGAACAAAIAYAPRGPRRWLWQSAGLVLVLGL
FT                   LVGATALRMAGA"
FT   gene            complement(17898..18509)
FT                   /locus_tag="Arth_0014"
FT   CDS_pept        complement(17898..18509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0014"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: cef:CE2657 putative 3-methyladenine-DNA
FT                   glycosylase; TIGRFAM: DNA-3-methyladenine glycosylase I;
FT                   PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01415"
FT                   /db_xref="GOA:A0JQU5"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU5"
FT                   /protein_id="ABK01415.1"
FT                   /translation="MTPDERGTIIGSDGLARPPWAAADPLLQAYYDTEWGMPVRDEQGL
FT                   FERISLEAFQAGLSWATILRKRPAFRSAFHDFQPDTVAAFTEEDVERLMLDAGIVRNRL
FT                   KIRAAITNARATIALRDDGGLVDFVWSFQPSVTPRPQNHAEIPTTSPESVALSKALRGK
FT                   GFAFVGPTTMHALMEAIGMIDTHLVDSHRRGSSGVWTERP"
FT   gene            18661..20943
FT                   /locus_tag="Arth_0015"
FT   CDS_pept        18661..20943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0015"
FT                   /product="peptidase M6, immune inhibitor A"
FT                   /note="PFAM: peptidase M6, immune inhibitor A; KEGG:
FT                   sma:SAV5155 secreted protease"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01416"
FT                   /db_xref="GOA:A0JQU6"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU6"
FT                   /protein_id="ABK01416.1"
FT                   /translation="MRKTKIAVAGVAGVVLGMLSIQAPAVAAPPVDDGSGGAAAAIRQD
FT                   NRPGPRTKELVERRKAALEKVAKGQAKANEDGVVQLAPDKFAEVETARQDKIFTILAEF
FT                   GDQGSGRFGTTPGPLHNTIAEPDRSVDNTTLWTKDFSPAYYEELFNGSGESMKGYYEAV
FT                   SNNQYSVTNTVTNWVKVPNNGSFYGDNATEDTGGAWAFVRDSGNAWWDSQLAAGKTPAE
FT                   IDAYLAQFDVWDRYDFNGNGNFDEPDGYIDHFQAVHAGEGEEGGGGTLGEDAIWSHRWY
FT                   AFGNQFGSAGPEGNLSGGTRIGSSKYWLGDYTTEPENGGVGVFAHEFGHDLGLPDFYDT
FT                   TGAATNSTAFWTLMSSGSWLGHGSAANEGIGTTPGLMGPEEKLFLGWLDHSTVNAGSSG
FT                   DFVLNPSQLQVDGKDQAVRVNLPDKTTTTNYTAPSSGIKAWWTGSADNLNESLTHAVPA
FT                   QSRVTVTANAWYDIEANYDYLYGEYSTDGGKTWKSAGRALSGAAGWGQLRYSYDAAGLE
FT                   SLFRFRYQTDGGVHNPGAFIDDIRISAGKTVILSDDVESGAGQWVAEGSWQLSSGSVTR
FT                   TTEQYYLVENREYVGFDATLAEGPYAFTKGITAPNWVDFFKYQNGMLVWYVDDSYADNN
FT                   VSAHPGAGSALPVDARPAPLKWSDGTMPGNSRQPFDATFGLEATDPLCIAKEVQTGTKR
FT                   SPSISSLDACAPSSAPIGVFEDSDPLAYYSSDNPYGSVKVAGHGVEISVTSDAGTDLAI
FT                   HVLNPGQ"
FT   sig_peptide     18661..18744
FT                   /locus_tag="Arth_0015"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(21064..21318)
FT                   /locus_tag="Arth_0016"
FT   CDS_pept        complement(21064..21318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0016"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   lxx:Lxx00180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01417"
FT                   /db_xref="GOA:A0JQU7"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU7"
FT                   /protein_id="ABK01417.1"
FT                   /translation="MPESKPRKKTVPAGKPASASQAYKPNAVWFKPVMFGLMILGLLWI
FT                   ITFYISEGALPVRDWGSWNIVAGFGIAIAGFLMTTRWRS"
FT   gene            21495..22295
FT                   /locus_tag="Arth_0017"
FT   CDS_pept        21495..22295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0017"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase
FT                   C60, sortase A and B; KEGG: lxx:Lxx00190 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01418"
FT                   /db_xref="GOA:A0JQU8"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU8"
FT                   /protein_id="ABK01418.1"
FT                   /translation="MVLLEKETTAAVPARGVGVLRIVVQIVGELLITVGVILLLFVAWQ
FT                   LWWTNVESDAKQSETIKNFAQELGGSAAPAASDAPDASTPAPTPTDYGPPRVAEAPGHG
FT                   QTIGIMYIPRFGADYTRPIVQGTSTDVLDTLGLGHYSDTAMPGATGNFAVAGHRQTHGA
FT                   VLDNIHTLVPGDKIYVQTRDGFYVYVFRNNQIVLPSATDVLLPVPTQPAARPTEAYLTM
FT                   TSCNPRFGSQERIIAYSLLDHWQPASAGPPAEIAAQVAKALGKG"
FT   gene            22300..22470
FT                   /locus_tag="Arth_0018"
FT   CDS_pept        22300..22470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01419"
FT                   /db_xref="GOA:A0JQU9"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQU9"
FT                   /protein_id="ABK01419.1"
FT                   /translation="MYGWIFRHLPGPLWFRIATSLVLLAGVLVLMVQFLFPWMSQFTQF
FT                   TDSTIGLVTRQ"
FT   gene            22467..23108
FT                   /locus_tag="Arth_0019"
FT   CDS_pept        22467..23108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0019"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   lxx:Lxx00200 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01420"
FT                   /db_xref="GOA:A0JQV0"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV0"
FT                   /protein_id="ABK01420.1"
FT                   /translation="MSTTKILVVDNYDSFVYTLVGYLQELGAETTVVRNDDVTLAEAIE
FT                   MADARDGVLISPGPGTPAEAGVCIDLIKWCGSHDKPMFGVCLGHQALAEAYGATVTHAP
FT                   ELMHGKTSLVEHEGASVFAGLPSPVTATRYHSLAAVRETIPDILEITAQTANGVIMGLQ
FT                   HRKAPLCGVQFHPESVLTEGGYQMLGNWLESLGMAGAAERAAKLSPLIQH"
FT   gene            complement(23164..25062)
FT                   /locus_tag="Arth_0020"
FT   CDS_pept        complement(23164..25062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0020"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: pac:PPA0184 putative serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01421"
FT                   /db_xref="GOA:A0JQV1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV1"
FT                   /protein_id="ABK01421.1"
FT                   /translation="MNTQRVLNGRYELGELIGRGGMADVHRGLDTRLGRTVAIKLLRPD
FT                   LARDPQFQARFKREAQAVAALNHPSIVAIYDTGDHAVPGGPEDTVRVPYIVMEFVSGKT
FT                   LRDLIRAKEVSIDHAIDFTLGVLSALEYSHRAGIVHRDIKPANVMFCEDSDTIKVMDFG
FT                   IARAMADSSATMTQTQAVVGTAQYLSPEQARGETVDARSDLYSAACLLYEMLTGRPPFI
FT                   GDSPVSVAYQHVREIPEPASSLNPEVSEALDSVLSKALQKNRADRFQDAAAFQRALRAA
FT                   RNGIPVPDVAAGEAPTDPNNTVPAGERTALAAPYSLTGASFLDDSPSGRLRPVHDTLGD
FT                   DQAIPAQVYEPSESSDLPLGFPPERERTPRQKSRRRTWIATLVIFTLLVLAGGGLWLYN
FT                   MMNQAPPPVAKVEVPAVSSLTESEALQRLYNARLSPQITRLPHDTITKGTAIGTVPAAG
FT                   TAMEPDSKVTLNISDGPSAVKIPDDLPGRTEAAARDVLRQIGLAGAPGTTMANSATVPT
FT                   GIVITTKPAPGQTVAVGSTVEIVVSTGKVAMPELRGLPRAEAETALKNLGLGIDVKEVE
FT                   NSEVEPGKVTEQSDAVNSLVEQGKTISIIVAKAPAPSPKPTPTPTPTPTETSRDRG"
FT   gene            complement(25119..26951)
FT                   /locus_tag="Arth_0021"
FT   CDS_pept        complement(25119..26951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0021"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: lxx:Lxx00220 serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01422"
FT                   /db_xref="GOA:A0JQV2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV2"
FT                   /protein_id="ABK01422.1"
FT                   /translation="MRPTSGITLGGRFQLTTRIAIGGMGEVWKAKDLILGRIVAIKVLK
FT                   EEYTGDPGFLQRFRAEARHTALLNHVGIANVFDYGEEEGSAYLVMELVPGQPLSSIIEH
FT                   EQVLSPDRTLSMIAQTARALSVAHSQGLVHRDIKPGNLLITPDGRVKVTDFGIARLADQ
FT                   VPLTQTGQVMGTAQYLAPEQATGQTATGASDIYSLGVIGYECLTGHRPFSGESQIAIAL
FT                   AQVNDAPPPLPETLPTPVRALLMSMLAKDPKNRPANAIKLSEAAEAIRNGDIAAAHAAV
FT                   PGMLLFEAATGPITAPVDIPTAATGVIESPEKDKSTTATSALPVVGAAGAGAAAGLAAG
FT                   AAAGASGPGSTLSRADALAAQRSWDQEEEQDRYDEPVDEPQRRGRSPWTWPLIALIVLV
FT                   LFALAGILLTQAGIFSPSGPVESSATSSSAKPSSSSASPTSTSASPTPSSASPTPTPTQ
FT                   STPETINLIPDAYLGQPYNTVRSQLVGLGLTVKGDPVFSDAAQGTVTNIEPSGPVAPGE
FT                   TITVTYSKGPDPSQESSVPAIGVGSSEAQAQKAIEDAGLRWVKGADVPGSAGQKAGTFV
FT                   SSEPGAGQKVPAGSVVTYHLAAEPVPTPSTSTTN"
FT   gene            complement(26948..28408)
FT                   /locus_tag="Arth_0022"
FT   CDS_pept        complement(26948..28408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0022"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: lxx:Lxx00230 penicillin binding protein,
FT                   transpeptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01423"
FT                   /db_xref="GOA:A0JQV3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV3"
FT                   /protein_id="ABK01423.1"
FT                   /translation="MNHAIRNSWIAAVAMFALIFGALSYVQVVGADELQANPWNKRAIL
FT                   QNYCNDRGAIIVGGKPIAQSVPASESCKFQRTYTEPELYAGITGYFSKNYGVTGLESAL
FT                   NEQLAGSSDQLFLDRVGQLFLGNQPKGASVELTLDPAIQKLAYDLIPDGQRGSIVVTNP
FT                   KTGDILAMVSKPSYDPNLIATQDAAAEAANFNELNKIPGINLNPNVSGPTGALLAPGSV
FT                   FKLVDTAAALSSGKYNKDSELPNPAEMSFPGIQYKLPNYAGGNCYTQTTASFAFALQQS
FT                   CNTPFASIARDLGQKAIADQAAKFGFGEDLGDQLKLDYAKRAFPEEELDPAGLAQSAIG
FT                   QRDVRATPLLIALMTSAIANGGVQMRPNLIKTVRSPDLRVISEPKPEVLRTSTSPEISR
FT                   QITEWMTGVVSEGIGRGAAVPGVQVAGKTGTAELGTDGLNNSWFTGFAPANDPQVSVTI
FT                   VMQGVDITTGAQLTSPNAKKIFEAVLNK"
FT   sig_peptide     complement(28313..28408)
FT                   /locus_tag="Arth_0022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.513 at
FT                   residue 32"
FT   gene            complement(28405..29865)
FT                   /locus_tag="Arth_0023"
FT   CDS_pept        complement(28405..29865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0023"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: cell cycle protein; KEGG: lxx:Lxx00240 cell
FT                   division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01424"
FT                   /db_xref="GOA:A0JQV4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV4"
FT                   /protein_id="ABK01424.1"
FT                   /translation="MTQIEPTPKPRRNTELALLILALAVGIGANALVGVDQEKAFDQDF
FT                   WFQSSLLAAAALIFHIVLRIRAKYADPVILPLVVALNGLGLAMIHRLDAPGDDTGNNQL
FT                   RWTLIAMAVAIAVIWFLKDHRILRRFTFISLAASALLLILPLIPGISAGEILGARVWIK
FT                   LGPMTFQPGEIAKITLAIFFAGYLSSNRDLILLAGRKLGPLQFPRVKDMGPMITAWLVS
FT                   IGVLIFQRDLGSSVLFFGLFIVMIYVATSRISWVVIGVALILGGGYVASKVFSHVGLRI
FT                   DGWLNAFTDEVYGRQFGGSFQIVEGLFGMANGGLVGTGLGQGRPNLVPFANSDMIIASF
FT                   GEELGLIGLFAIVLMYLLLFTRGFRAALGTRDAFGKLLACGLSFAIALQCFVVIGGVTR
FT                   LIPLTGLTTPFLAAGGSSLLANWIIVGLLLMISHTARGPVDTTPMPQGAAPGEQKPVPP
FT                   SPPRPAKQPGRQPPSAQPDAPTEAVKQL"
FT   sig_peptide     complement(29770..29865)
FT                   /locus_tag="Arth_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.408 at
FT                   residue 32"
FT   gene            complement(29862..31538)
FT                   /locus_tag="Arth_0024"
FT   CDS_pept        complement(29862..31538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0024"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: protein phosphatase 2C domain protein; KEGG:
FT                   sco:SCO3845 putative protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01425"
FT                   /db_xref="GOA:A0JQV5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV5"
FT                   /protein_id="ABK01425.1"
FT                   /translation="MAVPEIPADKGSTPTRPLIMRYAARSDVGRIRAKNDDSAYVGRHL
FT                   AIVADGMGGHAGGDVASAATVLDMLHLDHGHYDGDAGTVLADEIQTANSLLSELVHINP
FT                   KLAGMGTTVTALLLAEGKLHFAHIGDSRAYRLRNGEFKQISVDHTFVQRLIDEGRLRPE
FT                   EAETHPHKNVLMRVLGDVDASPELDLATLDVEPGERWLLCSDGLNYVAGHVVERTVRET
FT                   KDLRECVETLVDLTLEAGAPDNVTVVMLEIAEQTPDDVRTAAVEIVPPLAGAEEAAKAS
FT                   TPVAPAKSPSALPQDAKPKAAEDKGSSDSGGEDAGTGPASKPGEPTTTTDPHLGEHLSA
FT                   AVLREELSTRPHELVGAAAAAAESGSIPTIAGRTVARRAATVLTHKSDQDREETDEYKP
FT                   AAKPRRWVTIATAAALLVILSVGLWLGYAWTQTRYYIGEYDSRVAIYNGVSQRLGPIQL
FT                   STLETVTDIRMSDLPEFSQQRVRQTVPARDLYDAQRIVKNLDLTGTTSPAEDCPSASAT
FT                   PTASPTASGAAPAPGGTAAPPGSPTKSATPSPSTNACEEAK"
FT   gene            complement(31541..32023)
FT                   /locus_tag="Arth_0025"
FT   CDS_pept        complement(31541..32023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0025"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   fra:Francci3_4431 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01426"
FT                   /db_xref="GOA:A0JQV6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV6"
FT                   /protein_id="ABK01426.1"
FT                   /translation="MSELTITALRFGFLLLLWVLIFSIVSAMRRDLMIGRKAAMGAPTA
FT                   RQVRKHPELAETAPPPAKQQARQLVVTEGPLKGHTIPLADSPILLGRAQEATLVLEDDY
FT                   ASGRHARLFPQGSRWFIEDLGSTNGTYLANQQLTRALPVELGVPVRIGKTVIELRP"
FT   gene            complement(32020..32766)
FT                   /locus_tag="Arth_0026"
FT   CDS_pept        complement(32020..32766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0026"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG: blo:BL0583
FT                   hypothetical protein with FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01427"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV7"
FT                   /protein_id="ABK01427.1"
FT                   /translation="MGMLDKVERGIEKAVRGVFSTGSRAQVEPVEIASRLRREVDHKAI
FT                   TIAAGRTLAPNVFDVRLSEDDFKRAQEWGTPLAEELCDVVINHVRSQGYTLQGSVRISF
FT                   RRDSEIRAGDFEIDSRTEKASGSAAAPPLPRNNVPAAPSRQPVRLQPVLDIDGQRYSLN
FT                   AASIVLGRSSEADILVDDTGVSRRHLEIRTTNGTTEAVDLGSTNGSYVNGRKVVGSVDL
FT                   TDGSTITMGRTKIIFRLLPANSGGRP"
FT   gene            33132..33214
FT                   /locus_tag="Arth_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            33132..33214
FT                   /locus_tag="Arth_R0003"
FT                   /product="tRNA-Leu"
FT   gene            33439..34536
FT                   /locus_tag="Arth_0027"
FT   CDS_pept        33439..34536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0027"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: jan:Jann_0306 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01428"
FT                   /db_xref="GOA:A0JQV8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV8"
FT                   /protein_id="ABK01428.1"
FT                   /translation="MTAFSSEKGALRPSRRMVLAGFSSAALVALTGCRGGSGSAAPAAS
FT                   GTGSGAAADFGTLEVQLSWLKNAEFAGEYFADSKGYYKDAGFSAVNLIAGGPGGASAET
FT                   MVLSGKALVGTSSPVGVAPVVLNEGAPLKIIGSTYQKNPFTIVSLAANSITAPQDLVGK
FT                   KIGVQAGVNETLFDALLEVNKIDPTKVTKVPVQYDPQPLLNGDVEGFFAYLTNEVLTLE
FT                   LGGHKTAVLPFADNGLPFVAESFVVTDESIKDKRPELKAFLAATIKGWKDALADPDESA
FT                   RLAVEVYGKELGLTMAKEKGQAEAQNTKLIATPETEGNGLFTVSKELMDKNIEILKLAG
FT                   YDTTADAIFDLSLLDEVYAENPDLK"
FT   sig_peptide     33439..33561
FT                   /locus_tag="Arth_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.521 at
FT                   residue 41"
FT   gene            34551..35372
FT                   /locus_tag="Arth_0028"
FT   CDS_pept        34551..35372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0028"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: jan:Jann_0307 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01429"
FT                   /db_xref="GOA:A0JQV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQV9"
FT                   /protein_id="ABK01429.1"
FT                   /translation="MSTEAVAGGLLSGTGISLRHLGKSFRMGRKSVVALEDANLMTSKG
FT                   TFLSLLGPSGCGKSTILRILAGLETPTTGDVRVDGHTPAELRTRHELGIAFQDPALLPW
FT                   RSVVSNIRLPFEVAGLPVDHAVVDDLVELIGLKGFEKAKPAQLSGGMRQRVSIARALAL
FT                   KPSVLLLDEPFGALDDMTRQRLNLELLRIWTEKPATTLMVTHGIAEAMFLSDVVAVMSA
FT                   RPGRIKEIITVDLPRPRTPEMMRTPEFHALCDRASELLFGARAPLEEVESP"
FT   gene            35369..36211
FT                   /locus_tag="Arth_0029"
FT   CDS_pept        35369..36211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0029"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: jan:Jann_0308
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01430"
FT                   /db_xref="GOA:A0JQW0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW0"
FT                   /protein_id="ABK01430.1"
FT                   /translation="MTGSFLLSTTAARPLPPWAAAGIGVAATVVLWWLAAATVLSGVGA
FT                   SADGSGGAVPTPPEVLGQLASDGVGFYWPNLAVTMAEASAGYLWGNAGALLLSASVLVL
FT                   PSLERLITQLAVISYCLPIVAIGPLAFIVIGSPARGESSGTAVLLAGISVFFTTVVGAL
FT                   AALKSADRASLDLVAVYGGGRLKQLVKVQLISALPGILNALKIAVPAAVLGAVLGEYVG
FT                   GVDRGIGPALVNAQQNLEIARAWGVALVAGLLAGAGYGVFALLARFITPWSSGRRAAA"
FT   sig_peptide     35369..35428
FT                   /locus_tag="Arth_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.772 at
FT                   residue 20"
FT   gene            36208..37029
FT                   /locus_tag="Arth_0030"
FT   CDS_pept        36208..37029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0030"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: jan:Jann_0308
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01431"
FT                   /db_xref="GOA:A0JQW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW1"
FT                   /protein_id="ABK01431.1"
FT                   /translation="MMPGSAAVLAALKDAGRAVVGLLVSLAVVLLLWVALLKVFNISPF
FT                   VGKGPLDVFNFLFSVPAAEANRQAILQNLGQTMVDSFLGFAAGMVGAVVIAGVFVLFRG
FT                   VENALMPVAMLLRSVPLVALAPIIILIFGRQEPAVAAIGGIVVLFPALVTIVFGLRSAS
FT                   PAMIEVIDVYGGSRWTALLKVALPSSLPAFFTAVKVSIPGAITGALLAEWLATGKGIGY
FT                   AIISAVSRARNNEVWASVVVITLVSIILYTVVALLEEAMLRRSGRAPSSSG"
FT   gene            complement(37262..37954)
FT                   /locus_tag="Arth_0031"
FT   CDS_pept        complement(37262..37954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0031"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: rme:Rmet_0833 GntR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01432"
FT                   /db_xref="GOA:A0JQW2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW2"
FT                   /protein_id="ABK01432.1"
FT                   /translation="MSRNLTADLAADLRTRIVDGVIQPGDKLPSENTLIGEFGVSRTVV
FT                   RAALTRLQAEGLVETERGRGSFALTPPPHGDPHAPGGRPVTSLEDRLHLLEFRVGVEAE
FT                   AAALAARNRTDRQLRAVQKALEDFTSSSGHPAHAMKSDFEFHKAIAAASGNPFYSDCLA
FT                   SLGQTMIAMPRTRLMTGDEHYAREHFDQVVHEHESIYAAIAEGDVPSSSAAMRSHLANS
FT                   RRRLRAGR"
FT   gene            complement(37965..39092)
FT                   /locus_tag="Arth_0032"
FT   CDS_pept        complement(37965..39092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0032"
FT                   /product="galactarate dehydratase / L-talarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /EC_number="4.2.1.-"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: reu:Reut_B4643 mandelate racemase/muconate
FT                   lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01433"
FT                   /db_xref="GOA:A0JQW3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR033978"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW3"
FT                   /protein_id="ABK01433.1"
FT                   /translation="MSTVDLIRHVKLSTARLPLAVPISDAKVFTGRQKPMTEVVFLFAE
FT                   ITTEQGHSGIGFSYSKRAGGPAQYAHAKEVAEGIIGEDPNDIGKIYTKLLWAGASVGRS
FT                   GVATQALAAIDIALYDLKAKRAGLPLAKLLGSYRDSVQTYNTSGGFLNASLDEVKARAT
FT                   QSIDDGIGGIKIKVGLPDSKEDLRRVAGIREHIGWDVPLMVDANQQWDRATALRMGRQL
FT                   EEFNLIWIEEPLDAYDFEGHAHLASVLDTPIATGEMLASVAEHKGLIDASGCDIIQPDA
FT                   PRVGGITQFLRLAALADERGLGLAPHFAMEIHLHLAAAYPREPWVEHFDWLDPLFNERL
FT                   ETKNGRMLVPDRPGLGVSLSDQSRAWTTESVEFGA"
FT   gene            39379..40515
FT                   /locus_tag="Arth_0033"
FT   CDS_pept        39379..40515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01434"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW4"
FT                   /protein_id="ABK01434.1"
FT                   /translation="MPGAEVEIVWTALSKAWRKAQYEELWLQFRPRGSKDAFEAVEAAV
FT                   QMANQAVDDAGWGHDVFTAGVSDSDAGPVALMSRAGTEEGVRAWFAAFAQHLETLGKSG
FT                   RVTAAPEAFFPEWLSSGQVPQQLTAYVSYQTKDLALLDEDEQRRAWHVPKALTAQIADA
FT                   ATSWGRFEGADVYRNIHQIRSKNPDVGAAMAAGVEKFGMAGVTYLRSEPRRFTWASMSP
FT                   LGRTCYGVMDDTMSWQERLAQVTRAMTAFPSDTDLAFVRHSKALTISWGDLAGARPALP
FT                   HVKEYHVRYNRHLNRQYIPDAHGIQLLTDAHLEQANDLSDWNITGLGGGKHLVEAKDLQ
FT                   LWYANIDPEPETLAQARADFSGMILTPEIIAKNPPPWR"
FT   gene            complement(40672..41511)
FT                   /locus_tag="Arth_0034"
FT   CDS_pept        complement(40672..41511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0034"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: blo:BL1279
FT                   hypothetical protein with unknown or transport function"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01435"
FT                   /db_xref="GOA:A0JQW5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW5"
FT                   /protein_id="ABK01435.1"
FT                   /translation="MGGVVSGILIVSAVIAVGYFAARFRILGPEVQGALTRTAYYVTNP
FT                   ALLFTVVAGSDIRAALGTDAPLALLSAAIVGLLYCLASFLFFRRPAAETAVGAMASSYA
FT                   NANNIGIPVSLYAVGTAQHVAPVLLVQILVMAPFYLTVLGLVSGSKISWKKLLLQPFAN
FT                   PMIIASALGVVVALTGWSAPDLLQKPIDMLAGGAVPMVLLAFGLSLAGRAPLRKDDGRV
FT                   ETLVATFLKIAGMPVVVWVLGRWSSDWKGSICWPASSWPPSPPPRMFSSSRRRTAAA"
FT   gene            complement(41618..42178)
FT                   /locus_tag="Arth_0035"
FT   CDS_pept        complement(41618..42178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0035"
FT                   /product="Glucarate dehydratase"
FT                   /EC_number="4.2.1.40"
FT                   /note="KEGG: bja:blr5872 glucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01436"
FT                   /db_xref="GOA:A0JQW6"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW6"
FT                   /protein_id="ABK01436.1"
FT                   /translation="MSTQPTIAKVEVVPVAGYDSMLMNLSGAHGPFFTDWREMAHAIRS
FT                   NAVDIPLADPHFWTMHGSVRVAQLCHEFGLTWGSHSNNHFDISLAMFTHTGAAAPGEIT
FT                   ALDTHWIWQDGQGLTKDPLQIKGGAIEVPDAPGLGIELDRDALDKAHQLYLEHGLDARD
FT                   DSIGMQYYVDGWSFDPKRPCLVR"
FT   gene            complement(42175..43791)
FT                   /locus_tag="Arth_0036"
FT   CDS_pept        complement(42175..43791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0036"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: cgb:cg0535
FT                   probable ketoglutarate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01437"
FT                   /db_xref="GOA:A0JQW7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW7"
FT                   /protein_id="ABK01437.1"
FT                   /translation="MTLTGHSLIAGQAVAGEGKTAFGFNPASNEQLEPAYTLLTEDQLK
FT                   AATAAAGEAYPSFSTLDPETHASFLEAIADNIEAIGDDLIVRAGQETGLPAARLQGERA
FT                   RTTGQLRLFANVVRQGDFRGVRIDPALPERTPLPRADIRQRQIPLGPVAVFGASNFPLA
FT                   FSTAGGDTASALAAGCPVVFKAHNAHPGTGELVGQAIVKAVRDSGLHPGVFSLIYGPGS
FT                   SIGQALVADPAIKAVGFTGSQSAGIALMRTAAARPEPIPVYAEMSSLNPVFVFPGALTG
FT                   SAEQIDALAQQYVTAVTGSSGQLCTSPGLLFAPAGELGDKLAAAVGRAVSACAGQTMLT
FT                   AGIAGSWNSGAETLGSADNVTVVGQGTAGPTENAPAPTIFGTDIADFVSNHVLHAEIFG
FT                   AASLVIRYSTAGELIEATNRLEGQLTASLQLTEEDYPTAAQLLPALEQKVGRIIVNGWP
FT                   TGVEVGHAMVHGGPFPATSDTRTTSVGTLAINRFLRPVAYQNLPQELLPAPLQDANPWH
FT                   LNRRIDGTVEAAADAEDKVNA"
FT   gene            complement(43818..44732)
FT                   /locus_tag="Arth_0037"
FT   CDS_pept        complement(43818..44732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0037"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   cgb:cg0536 putative 5-dehydro-4-deoxyglucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01438"
FT                   /db_xref="GOA:A0JQW8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JQW8"
FT                   /protein_id="ABK01438.1"
FT                   /translation="MAKHSPQELASVLKDGLLSFPVTSFDSQLQFDEENYRKHLAWQAS
FT                   YPVAGLFAAGGTGEGFSLTPAESARVVRAAVEEVGSTVPVLASAGGSTAQAIENAQAAE
FT                   AAGAEGILLLPPYLTEADQGGLIEHVSAVCSATSLGVIIYNRANAIYKDTTVAALADRH
FT                   ESLIGFKDGVGDLEHDARVYAKLGDRLFYLGGLPTAETFALPLLQLGMSTYSSAMYNFV
FT                   PQFALDFYQDVRNHDRVAVNKKLNDFVIPYLDIRDRVKGYSVSIVKGGLDAIGRSAGGV
FT                   RPPLQNLAPQDLADLKALIATVS"
FT   gene            complement(44887..45771)
FT                   /locus_tag="Arth_0038"
FT   CDS_pept        complement(44887..45771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0038"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: cgb:cg0537 putative
FT                   transcriptional regulator LysR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01439"
FT                   /db_xref="GOA:A0JQW9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQW9"
FT                   /protein_id="ABK01439.1"
FT                   /translation="MFTFDQLAGFIAVAEELHFGRAAERLNMTQPPLSRQIQKLEKTVG
FT                   AELLERDNRKVRLTAAGTAFLEEARRLMALANRAPLTAQRIASGSSGLIRIGFTAASGL
FT                   SILGPLLEKISAGLPGVDIDLHELVTGEQIAGLQSGELDIGLARPPINGDFFDSYLLQR
FT                   ETMVLAAPSGHPLTELNRHVREDDLKDVPLIMHSPGEASYFYDLAVRMLQIQHANVVHT
FT                   VSQILTMVSLVAARRGVALVPRSTSLLGIQGVDFLPLEGSAHYPVELHAVWNRNITNPA
FT                   LSQTLKVLGYRDD"
FT   gene            complement(45774..46475)
FT                   /locus_tag="Arth_0039"
FT   CDS_pept        complement(45774..46475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0039"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein, TetR; Tetracyclin
FT                   repressor domain protein; KEGG: sco:SCO1702 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01440"
FT                   /db_xref="GOA:A0JQX0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX0"
FT                   /protein_id="ABK01440.1"
FT                   /translation="MPAAARQNTQPSADSREAAAQPKRRAGRPASAVLDQAVITAAALR
FT                   LIEKSGYAGLTMAALARSLHVAPSALYNHVTSKRDVLVLVEDHLAALVDVSAFGREDWD
FT                   EALRRWAWSYRDVFSKHTPLIPVIAVLPVTDAPQTLAMYETVSEGLREAGFPEERIISS
FT                   IVALESFIFGSAFDVTAPADIFDPGSMAESTPNFTAAVQSLAEQGHEKPADIAFSLGLE
FT                   ALISGLGALRN"
FT   gene            46617..48005
FT                   /locus_tag="Arth_0040"
FT   CDS_pept        46617..48005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0040"
FT                   /product="Putrescine oxidase"
FT                   /EC_number="1.4.3.10"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: syf:Synpcc7942_0369 putative flavin-containing
FT                   monoamine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01441"
FT                   /db_xref="GOA:A0JQX1"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX1"
FT                   /protein_id="ABK01441.1"
FT                   /translation="MLELDRDVVVVGAGPSGLTAARQLKKAGLSVAVLEARDRVGGRTW
FT                   TDTVDGAMLEIGGQWVSPDQTVLLELLDELGLETYSRYRDGESIYIGADGRKTRYTGDS
FT                   FPVSDTTAAEMDKLIGLLDGLAAEIGPTEPWAHPKARELDTVSFHHWLRQNSPDEEACN
FT                   NIGLFIAGGMLTKPAHAFSALQAVLMAASAGSFSHLTDEDFILDKRVVGGMQQVSLLHA
FT                   RELGDDVVLNSPVRTINWMEERDGGPRVTVVSERATVNARYVIMAVPPNLYSRVSFNPP
FT                   LPRRQHQMHQHQSLGLVIKVHAVYKTPFWREEGLSGTCFSAGSLVQEVYDNTNHGDSRG
FT                   TLVGFVSDEKADAVFELSAEERKRTILESIAAFLGDKALEPEVYYESDWGAEEWTRGAY
FT                   ASSYDLGGLHRYGKDQHQPVGPIYWSSSDLAAEGYQHVDGAIRMGQMTAARVAAVAHRA
FT                   SVTQ"
FT   gene            48039..48974
FT                   /locus_tag="Arth_0041"
FT   CDS_pept        48039..48974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0041"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mbo:Mb2346c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01442"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX2"
FT                   /protein_id="ABK01442.1"
FT                   /translation="MRYVVGYSANARGHDAVNLAVSLARGRGATLDLVVAIPEVSPFSA
FT                   AHAPKAGFENLLHEQARTWLDEALALVPADVPAEGHVRSGESDAQTLMDACEEFQADML
FT                   IIGATSNGLFKRFTIGSVAGALLHAATVPVALAPHGYHRREALTRISCGLGARPGAGEL
FT                   LDYAVSMASNRDVPLRVVSLLALDDGGLSLDDGASPDVAEAARNHAGNRVSAALPGGEA
FT                   GSRFAAKTDVVVAQGRSIEEAVDRLDWEDGEVLVIGSSRLARSRSIFLGATAHRILRAL
FT                   PVPMIVVPSDYALKHQTHSTSNETSGEAPS"
FT   gene            48971..50494
FT                   /locus_tag="Arth_0042"
FT   CDS_pept        48971..50494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0042"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   ppu:PP5297 amino acid transporter, putative; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01443"
FT                   /db_xref="GOA:A0JQX3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX3"
FT                   /protein_id="ABK01443.1"
FT                   /translation="MTTEHATSATSQSDHKGISAKGLKAGSVGLIGAVVIGVSCIAPAY
FT                   TLTAALGPTVSEVGVHLPAIFLVGFIPMLLVAFGYRELNNAMPDAGTSFTWASRAFGPW
FT                   IGWMGGWGLIAATIIVLSNLAAVAVDFFYLMLAQLFSNPELGELSKNLPLNIATTLVFI
FT                   ALACWISYRGMETTKGVQYVLVAFQLLVLGWFAVAAFSHVANGSAFDATAISPDWFNPF
FT                   AVDSFSSFAAGVSLSIFIYWGWDVTLTMNEETRNPEKTPGRAATVTVLVIVIIYMTVAL
FT                   STLAFAGIGDTGLGAGNPDNQGSIFAVLAGPVMGPFAILMSLAILSSSAASLQSTFVSP
FT                   ARTLLSMGHYKALPAKFGRISPTYKSPSYATIAAAIAAAAFYVITRTTSENALWDTITA
FT                   LGMMICFYYGITALACVWFFRAQAFSGVHAFFFKFLAPLLGGVILLVMFFKTAYDSMDP
FT                   AYGSGSSVGGVGLVFILGMGVILLGVVLMLVMSRLRPEFFKGQVLARGI"
FT   gene            50607..51089
FT                   /locus_tag="Arth_0043"
FT   CDS_pept        50607..51089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0043"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: xcb:XC_2544 general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01444"
FT                   /db_xref="GOA:A0JQX4"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX4"
FT                   /protein_id="ABK01444.1"
FT                   /translation="MSDTENIGQVTKIINDSHIGMLTTINEEGALVSRPLAVQEVKDDG
FT                   DMWFFTSSETSQVAHVRADPRVNVSFGKNTEWVSVAGTAEIVTDRQKIHDMWNQVVEAW
FT                   FPDGPDTPEVVLLRVDSDSAEYWTSPGGRAATVLQWVKSKVTNSRMSVGESGTVDL"
FT   gene            complement(51093..51698)
FT                   /locus_tag="Arth_0044"
FT   CDS_pept        complement(51093..51698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01445"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX5"
FT                   /protein_id="ABK01445.1"
FT                   /translation="MEPLATDTRDQHGRLRSDRGVWRQATTLEAAGELTARWLESHSEY
FT                   QPGTFAPSIDDETRPIAAELAEINRNGLFTKESQPGMRGDAGHAQRQYVTGFCSAEAAA
FT                   ELVALSTRSELITIGHAPGEVSAAAVPVTFDGGAVVTVLGSSENPVDEDALRDWSEETN
FT                   DALSLLLADSWYVEVLDPVWGRNDVLLPEVLAALRQLQ"
FT   gene            complement(51815..52399)
FT                   /locus_tag="Arth_0045"
FT   CDS_pept        complement(51815..52399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01446"
FT                   /db_xref="GOA:A0JQX6"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX6"
FT                   /protein_id="ABK01446.1"
FT                   /translation="MSVITESVPMGPLQLAVCAAVVVCGVAGAVYSARYHARRDAGQMT
FT                   DAVFWDGFAGLVVVFPAVLIPFLASPWLGLGAGFLAAATAVAAYVWSPRVMARQEARLH
FT                   DAAAQAEIAAAAARHRTVLSRWQRYELDPACCIDYPDMTDVRRPETAALIKAMREAERL
FT                   RAVEPASYLPAVTRLEHALGRAEAAAGVPSR"
FT   gene            52560..52949
FT                   /locus_tag="Arth_0046"
FT   CDS_pept        52560..52949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0046"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: afu:AF1476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01447"
FT                   /db_xref="GOA:A0JQX7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX7"
FT                   /protein_id="ABK01447.1"
FT                   /translation="MRLKMCSIHVKDPAAAHQFYTDTLGFETLMAMPEYNLYIVKDPGS
FT                   AGGSSGSVGLLLEPSDNPIAATYMNGLHDAGLPAIVFGVPDVRAEHKRLAALGVIFQGE
FT                   PTEGPTGISVVLDDGCGNYVQLHQD"
FT   gene            53021..53200
FT                   /locus_tag="Arth_0047"
FT   CDS_pept        53021..53200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0047"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: ade:Adeh_3661 phage
FT                   shock protein C, PspC"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01448"
FT                   /db_xref="GOA:A0JQX8"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX8"
FT                   /protein_id="ABK01448.1"
FT                   /translation="MSAALVRPRNGKMIAGVCAGLAARFGISKALVRIGFVLFGLFGVG
FT                   ELVYIALWIVMPKE"
FT   gene            53340..54881
FT                   /locus_tag="Arth_0048"
FT   CDS_pept        53340..54881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0048"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: ret:RHE_PE00359 probable sugar ABC transporter,
FT                   substrate-binding protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01449"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQX9"
FT                   /protein_id="ABK01449.1"
FT                   /translation="MLRFRCHGWTRRMPKPAKSAKICQTVSSAFDVDSRAAPAHASRPQ
FT                   IICIVTLDTPERTPLGCCQVVLAKRFFTPQTFLPFRSERKSTAMSTRKTISRLAAIGGL
FT                   CTAVALTATACGAGGPASSGSAASSVNVLVEAGGHAELAGVAEACKKDTGLDVNFVELP
FT                   YDGLFNRLSSEFSSGTVSFDVAALDSVWLPSFKDAVQPIDELFTDEAKKDIFPALVKEA
FT                   NVDGHFIGMPAWTNAEIILYRKDLFEDAKNKADFKAKYGYELAAPTTWKQYQDISEFFT
FT                   KDGMYGTDVKGAVETEWLAHVLQAGSPMVLDDQNNVVVDNAAHKEALDFYTSLVKSAPS
FT                   GAAQVDWAAAQNLFNQGKTAMTRFWAHAYRQIPADAAVYGKVGAAPMIGGSAGVAGVPG
FT                   PWYLSVPKATKNADAAKKFIKCAYDHNDLGIESKLGLAARISAFEKYQDKPGYESFKPL
FT                   IETLNGEATATRPATAKWQQIVDTVLVPTLQKAVAGGDSASLLAEAKTKIQALVK"
FT   gene            54965..55852
FT                   /locus_tag="Arth_0049"
FT   CDS_pept        54965..55852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0049"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00358 probable
FT                   sugar ABC transporter, permease protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01450"
FT                   /db_xref="GOA:A0JQY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY0"
FT                   /protein_id="ABK01450.1"
FT                   /translation="MRINDRRFALYLMTPAALFLAVFVAYPLFRLIADSFFKISPIVGG
FT                   PRDFVGLDNYVRAFASEDFIGAGWRTLAYTVVVVTLEFALGLGMALLFTTLGRKSQIWR
FT                   TVFLYPLMIAPIVAGLLWKFLMIDNFGLIGTLLHQAGILQDPNQIGWLSNPDIVLFSVA
FT                   VPDIWLTTSFMCLVLFAGLQNIPGDLIEAARLDGAKAPALLFRIILPLLRPVIAVALVV
FT                   RGIDAARAFDTILIQTNGGPQSASETMSLLIYRTMIRFGDPGLASAMGTIYLLAMLAVA
FT                   FFAVTTIWRPGKDN"
FT   sig_peptide     54965..55039
FT                   /locus_tag="Arth_0049"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.566 at
FT                   residue 25"
FT   gene            55945..56862
FT                   /locus_tag="Arth_0050"
FT   CDS_pept        55945..56862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0050"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00357 probable
FT                   sugar ABC transporter, permease protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01451"
FT                   /db_xref="GOA:A0JQY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY1"
FT                   /protein_id="ABK01451.1"
FT                   /translation="MPPAQNNSQKAPTTAAGNGRRPRRHHAEGLEAGKRSTRIILWILL
FT                   AGALVLYGFPFLYLLFTSFKTPIDTIAVPPTILPREWTLENYANALGRSGVLASFINSA
FT                   QTAIISTLLSLILAVPAAYGITRYKTPSGRVFIMAALVTRMVPPVAIGIPLASMMSSVG
FT                   LSDTPIALSIAHTTISLPLSIWLMSSFFEAVPKDLEEAATVDGCSRLGALWRVVIPVVS
FT                   GGIAVTAIFAFLASWNEFLFALLMTAIRSQTTPVVIANFQTQFGLDWGSMTALAAVYSI
FT                   PVILLTLLLQRKIVAGMTLGAVKG"
FT   gene            56890..58290
FT                   /locus_tag="Arth_0051"
FT   CDS_pept        56890..58290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0051"
FT                   /product="Inulin fructotransferase (DFA-I-forming)"
FT                   /EC_number="4.2.2.17"
FT                   /note="KEGG: ret:RHE_PE00355 putative inulin
FT                   fructotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01452"
FT                   /db_xref="GOA:A0JQY2"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY2"
FT                   /protein_id="ABK01452.1"
FT                   /translation="MSSNNYYDVTTWPVGNPSEDVGEVINSIIADIKDRQTVTDANNGG
FT                   KPGAVIYIPPGDYHLRTQVLIDISFLRIHGSGHGFTSSSIRFNVPEDEWPGLHELWPGG
FT                   SRIIVDIPPGGDEGGDGEESKGAAFYVERSGSPRISSVEFSNFCIDGLHFDPDGSGSHP
FT                   ENTYVNGKTGIYVANANDSFRITGMGFVYLENALTIYNADALSIHDNFIAECGSCIELR
FT                   GWGQASKITDNLVGAGFKGHSIYAENHGGLLVTANNVFPRGASSIHFVGVTRSSVTNNR
FT                   LHSFYPGMLILAENSSENLVATNHFLRDHEPWTPFLGVDNGLNDLYGLLSVSGSNNSVI
FT                   GNHFSEIIDSPSIQPEGATPVIIRLMAGVGNFVSNNHVVAMDVRSKASDSCFSAQVDAL
FT                   LTTEASDGLAVTAVMVDSESARNTILDSGSDAQVIADRAVNALRATPTVGFQAAHALVE
FT                   PHVESATT"
FT   gene            58307..59401
FT                   /locus_tag="Arth_0052"
FT   CDS_pept        58307..59401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0052"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: blo:BL0107
FT                   probable LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01453"
FT                   /db_xref="GOA:A0JQY3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY3"
FT                   /protein_id="ABK01453.1"
FT                   /translation="MTNRSVGIKDVAAAAGVSVTTVSHVLNDVAYARVGAGTRERVHEA
FT                   AQRLGYGPNRLAQALRTQRSGMIGFISEEIATTPHAGRIILGAEETARARGYRIMIINS
FT                   TSTSSQDSKESQVADLLDRQVDGILYATMYHRELAVPKNLAGLPAVLVDSEDISHTVSA
FT                   VIPDEVGGARSAVQTLIDAGHTRIGMLNNTDDVPATHSRLTAFKDTLADAGLTFHEELV
FT                   QSEHSEVRGGYEAALRLLKQEDRPTAVFCYNDRMAMGAYRAAGELGLSIPDDISFVGFD
FT                   NQQLIAENLYPALTTVALPHYEMGAWATDNLIDAIEGKTDLRLFAAHPTVLPCPMVLRD
FT                   SVASPEHKGASTRAAPDSPPRANT"
FT   gene            59448..60401
FT                   /locus_tag="Arth_0053"
FT   CDS_pept        59448..60401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0053"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mpa:MAP0876c
FT                   putative fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01454"
FT                   /db_xref="GOA:A0JQY4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY4"
FT                   /protein_id="ABK01454.1"
FT                   /translation="MHSSPVPPCPETDVVVVGEAIIDIIDTAGGPVEFPGGSGMNVAYG
FT                   LGRLGVSTAFLTALGSDERSRSIQRHLDTAGVRLLPGAEHLNRTSTARALLDSNGSAEY
FT                   EFDFEWNLPQISPTFLPKVLHTGSLAAFMEPGATRVRSLLELFSRRCLITYDPNIRPTL
FT                   LHSHAEALRTFEHTVALATVVKLSAEDAQWLYPRTPPHGVARRLLDLGTELAIITDGAS
FT                   GSYLRSNAAEIEVPAPPVVVKDTVGAGDSYMSSLIAGLIEDPEDDFGYGKLTRVGTAAS
FT                   LAAAITVGRHGANPPTRAELIRSQELARTSRRNSDD"
FT   gene            60394..61929
FT                   /locus_tag="Arth_0054"
FT   CDS_pept        60394..61929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0054"
FT                   /product="Levanase"
FT                   /EC_number="3.2.1.65"
FT                   /note="KEGG: bte:BTH_II1873 levanase; PFAM: Glycosyl
FT                   hydrolase family 32, N terminal domain protein; Glycosyl
FT                   hydrolase family 32, C-terminal domain protein; SMART:
FT                   glycoside hydrolase, family 32"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01455"
FT                   /db_xref="GOA:A0JQY5"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY5"
FT                   /protein_id="ABK01455.1"
FT                   /translation="MTETTMHPAAPAEDTAADFRPVLHYTAKNTWLNDPNGLVWHQGVY
FT                   HLFYQNNPFDNVWGNMSWGHATSTDLLHWTEHPVAIACDEEEDVFSGSIVVDHGNTSGF
FT                   GTVEDPALVAIYTSAFKEGSVHQGTQAQSLAFSTDAGMTWNKYAGNPVLGRDSAHFRDP
FT                   KVFRYEGAAGSCWVMVAVEARRQQVVLYRSADLKDWEHLSTFGPANATGGEWECPDLFP
FT                   LPVDRDPDNVKWVLVVNVNPGAVAGGSGGQYFVGDFDGVKFTADPDSLVPADADGTTDL
FT                   SRCLWLDWGRDYYAAVSFSNAPENRRIMIGWMNNWDYANFLPTSPWRSGMSLAREIELA
FT                   TVDGLPRLVQRPVLPLDSGEPACAIQDVELHDSLLQLPDAMPGSAQLIDAEILPGTART
FT                   VVFRLLGASGGSAATVLSFDAVTGLLTLDRRNSGNTAFHGKFASAESAPVKLEAGVLRL
FT                   RVIVDQCSVEVFAQGGRVVLSDLVFPMSGSLGTEVCVEGGAAFVRKLAVTGLS"
FT   gene            62031..62912
FT                   /locus_tag="Arth_0055"
FT   CDS_pept        62031..62912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01456"
FT                   /db_xref="GOA:A0JQY6"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY6"
FT                   /protein_id="ABK01456.1"
FT                   /translation="MALAIVVVCTLFLLVAVIMVIVWGGHLVRRPADPGAPVSPLRLYL
FT                   WWANVATAAALASGILVAWAGGRLAMRILAATSPASAQGRLTEAQANVGFPTIEGSIAL
FT                   LFFGGLPAGFAAAFIYLFIRRWLPAGRWAGPTLGVLLLLVFGASVDPLRAENIDFAIVG
FT                   PGWLSVILFSALAVLHGAVVAAVAGAFSQRLPLPTGRDWKYYLPLVGAILFPPAGILLG
FT                   IGALVVMLCLWLAHFGRAGREPLQTGPDKVRSARALRRATAPSWGGRAALGLAAVVALP
FT                   PFVSAVTSIISR"
FT   gene            complement(62899..63519)
FT                   /locus_tag="Arth_0056"
FT   CDS_pept        complement(62899..63519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0056"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: xac:XAC4014
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01457"
FT                   /db_xref="GOA:A0JQY7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY7"
FT                   /protein_id="ABK01457.1"
FT                   /translation="MSHPLLIVLTGIDGAGKTTAARAAVEAARLAGGKALLLRNHAGRR
FT                   NMTQWSERSGIHLNRRVADALETGIRTINVLVSHARARNFSGLVVMDRHLYCQLALRSV
FT                   RGLPPGRLLRWLLRHLPAPDLVIHFDVSPEQALKRILLRGTDTETLEELRALGEAYRAL
FT                   PEFAGFVRIDAGGAQDEVLAALTDTINGAAGRPATGAGRISAK"
FT   gene            63699..64178
FT                   /locus_tag="Arth_0057"
FT   CDS_pept        63699..64178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01458"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY8"
FT                   /protein_id="ABK01458.1"
FT                   /translation="MADIAAVLGRLSPEELDELREIGPQGHLTRRLVDALDRAAGGSGA
FT                   GRGYYVPTGSVSATGGPHLVLRSDVSAWLFGAGPQIPHGHQAADPAGEPLRQETDWSEL
FT                   RPGDKVAIVRGNRVTASGIVDAMTEDASTVWVLFEGVAPRRMFHRGDPDDLRPVH"
FT   gene            complement(64191..64595)
FT                   /locus_tag="Arth_0058"
FT   CDS_pept        complement(64191..64595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV1186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01459"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQY9"
FT                   /protein_id="ABK01459.1"
FT                   /translation="MTSANSQSMKPATVAKKLGIYLPATPQEFQDSVITRADFAELQAN
FT                   PPEWLAELRRNGPHPRPVVAQKLNVSISGLARGGVEEALTSAEITALLQAPPAWLVAER
FT                   STHAAVRAEAQRVKDEAAKKDAKKARAKAE"
FT   gene            64750..65478
FT                   /locus_tag="Arth_0059"
FT   CDS_pept        64750..65478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0059"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR, substrate-binding; KEGG: nfa:nfa41220
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01460"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ0"
FT                   /protein_id="ABK01460.1"
FT                   /translation="MLRFAYVAGVTPGKWIRRWEERMPDVPLQSFMSDDGAQLLVLRDG
FT                   SADLSFVRLPVEREGLNVIPLYEEQPVVVAPKGHEISVFEEVALADLAAETFLDVAELG
FT                   GPEVALQVVASGAGLVILPMSVARHFNVKDTVARKLTGAPTTQIALAWPNEATREATRE
FT                   AGDEAADQAMDEVIEEFIGIVRGRTAQSSRQPSAKVEPPKKEPKPDRRGTGVKKPKVAQ
FT                   RYAPNPDKGRGKGSRKKGKR"
FT   gene            complement(65482..65817)
FT                   /locus_tag="Arth_0060"
FT   CDS_pept        complement(65482..65817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01461"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ1"
FT                   /protein_id="ABK01461.1"
FT                   /translation="MKSRLAALSAAALIVVLTGCGQVQDAAEKAVSDGASQVATAAADQ
FT                   VKGQVCALVEDGLVSVKDKELLGGLVAGADTAGVPAEITTPLRQIAEAGDQVPAESVTA
FT                   LKDACTA"
FT   sig_peptide     complement(65746..65817)
FT                   /locus_tag="Arth_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.507 at
FT                   residue 24"
FT   gene            66335..67762
FT                   /locus_tag="Arth_0061"
FT   CDS_pept        66335..67762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0061"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: mle:ML1755 L-serine dehydratase; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01462"
FT                   /db_xref="GOA:A0JQZ2"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ2"
FT                   /protein_id="ABK01462.1"
FT                   /translation="MAVGVFDLFSIGIGPSSSHTVGPMRAAAVFAEELKASGALERVAG
FT                   LRVDLYGSLAATGHGHGTMTAILLGLEGFHPEKILPAEVEERLAAIAESGMLRLAGAVD
FT                   GAGVVLPYGVKDMVLRPLTILPRHTNGMTFTVTDAGGEVLHAATFFSVGGGFIVREGEE
FT                   DAAQQELEESKKELPLPFRTAAELLGRCQSKGLSIGEIMFVNERASRSEAEIREGLLHI
FT                   YSVMEECVAVSLKREGLLPGGLKVRRRAPDWHERLLKENRGQDPEYRDPKYWQEWVNLI
FT                   ALAVNEENASGGRVVTAPTNGAAGIIPAVLYYALHFAPGMDRASRQDRDDVVVKFLLAA
FT                   GAVGVLYKEQASISGAEVGCQGEVGSASSMAAAGLAEVMGGTPQQVENAAEIAMEHNLG
FT                   LTCDPIGGLVQIPCIERNAIAAAKAINAAKMALWGDGTHRVSLDEVIVTMRETGRDMSS
FT                   KYKETAMGGLAVNVVEC"
FT   gene            67852..68859
FT                   /locus_tag="Arth_0062"
FT   CDS_pept        67852..68859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0062"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: lxx:Lxx10130 lipoate synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01463"
FT                   /db_xref="GOA:A0JQZ3"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ3"
FT                   /protein_id="ABK01463.1"
FT                   /translation="MTLAPEGRKMLRIEQRNAATPVERKPEWIKAKVQMGPEFVQLKNL
FT                   VKKEGLHTVCEEAGCPNIFECWEDKEATFLIGGSECTRRCDFCQIDTGKPSPVDMFEPT
FT                   KVARSVQAMQLRYATVTGVARDDLADEGVWLYAETVRKIHELNPGTGVELLIPDFSGKP
FT                   EHIAAICDSKPEVFAHNVETVPRIFKRIRPAFRYDRSLDVITQGRNLGMVTKSNLILGM
FT                   GETREEISEALRDLHEAGCDLITITQYLRPSERHLPVDRWVKPQEFVDLATEAEEIGFL
FT                   GVMSGPLVRSSYRAGRLWATAMRKKGWDIPAELAHIESSGSTRQEASSLIAAHS"
FT   gene            68887..69795
FT                   /locus_tag="Arth_0063"
FT   CDS_pept        68887..69795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0063"
FT                   /product="methylenetetrahydrofolate reductase"
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   hma:pNG7363 5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01464"
FT                   /db_xref="GOA:A0JQZ4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ4"
FT                   /protein_id="ABK01464.1"
FT                   /translation="MMFPTRIEIIPSEGIVEQVKAHVPLTTTLTVTCLPHHGIERTMRA
FT                   AVQLGVLGYSVIPHLAARSVPGRSELTGILRDCDVSGINEVFVIGGDRKQPAGPYASSL
FT                   PLLEDIAQYTGGRMRAGVAGYPEGHPSVGPVDLLDALLAKQHLASNVVTQMCFSAPKIL
FT                   DFAALLRREGVQLPVWAGVAGTVPRTKLVSLATQIGVGSSLKFLSRKGPLARKLLSGDR
FT                   YSPESLVAGLESPAGIFAGIHLYSFNNLDPAPGGPDQATASAALQSALIRGAARKPDGH
FT                   SAVRPLSPPAVTSDSSAVSGE"
FT   gene            69807..70139
FT                   /locus_tag="Arth_0064"
FT   CDS_pept        69807..70139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01465"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ5"
FT                   /protein_id="ABK01465.1"
FT                   /translation="MRLVVFGAPITGCLLRGPLLPTAFIPFTVRATVREDHKRSFRTDI
FT                   ERLTSSHRGWAPLDVVKSTDTQALLRGAVANSVHTATDSSLARYLQDRLVADSGIHLDL
FT                   AVSIER"
FT   gene            70217..71020
FT                   /locus_tag="Arth_0065"
FT   CDS_pept        70217..71020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0065"
FT                   /product="Membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /note="KEGG: cgb:cg1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01466"
FT                   /db_xref="GOA:A0JQZ6"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ6"
FT                   /protein_id="ABK01466.1"
FT                   /translation="MLPADQNTPEGRTPESMLRLKRLAVFCLVATCVITGLMFWVLGPS
FT                   GAAGSWSQSAPPQSGAKLATLQGFSARAVDITDSTMDAEWLGQTATQTGIPARALQAYA
FT                   AAAELANAATPVCRIGWNTVAAIGFVESAHGSHGGGSLSSTGQVSGPIIGPSLDGDSFA
FT                   AIPDTDDGVLDGDALWDRAVGPMQFIPSTWEQAGRDGNGDGVADPLNIDDAALSAATYL
FT                   CEGGRDLTTARGWTAAVLSYNQSESYVRQVRGQANAYAEQSRPAG"
FT   gene            71060..71989
FT                   /locus_tag="Arth_0066"
FT   CDS_pept        71060..71989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0066"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   fra:Francci3_4105 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01467"
FT                   /db_xref="GOA:A0JQZ7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ7"
FT                   /protein_id="ABK01467.1"
FT                   /translation="MKAITYSEYGSPDVLEPTEQPLPKVGPGMVLVKVKAAAVNPVDWK
FT                   IMAGYLDPAMDLQFPAIPGWDVAGVVESAGIDAPHFRPGDEVISYGRKDYVHGGSFAEY
FT                   IALPERLLARKPASLTWNEAAGLPLAGLTAYQVLNRLDLKAGETVLIHGGAGGVGSLGI
FT                   QIAAALGAKVIATASEKNHDFIRSLGAEPVSYGEGLAERVRALRPEGVDVVADFVGGNL
FT                   ESTLAVLADGARHASIADSEVEQHGGTWMWVNPVGAELQELADLVDERKLRVEVAQTFP
FT                   LAQSADAFRLNMEGHTRGKIVISVDDAS"
FT   gene            72076..72747
FT                   /locus_tag="Arth_0067"
FT   CDS_pept        72076..72747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO1915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01468"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ8"
FT                   /protein_id="ABK01468.1"
FT                   /translation="MSETTVAELKAELAELEDPRMRLVNEKHGDDHGVNLSRLRAIAKR
FT                   LKTQQALARELWATEDTAARLLGLLICRPKEFERGELDAMLRQSRAPKVQDWLVNYVVK
FT                   RSPHAEELRVAWTADSDPVVAGAGWALTSERVAKNPEGLDLPGLLDTVEAQMKEAPDRL
FT                   QWAMNTCLAQIGIHHAAYRARAIEIGERLEVLKDYPTPPNCTSPFAPAWINEIVRRQSA
FT                   G"
FT   gene            complement(72805..73527)
FT                   /locus_tag="Arth_0068"
FT   CDS_pept        complement(72805..73527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0068"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: xfa:XF1741 daunorubicin C-13
FT                   ketoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01469"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JQZ9"
FT                   /protein_id="ABK01469.1"
FT                   /translation="MARIFITGSTDGLGRSAAQSLLDKGHHVIVHARNVQRLAVIRDLL
FT                   ALGAVGDLSDIEQTRDLARQVNRSGPVDAVIHNAGVLHGPHIFQVNVVAPYLLTALIHR
FT                   PRRLIYLSSGMHRGGRASLAAIGEGVHPQSVSYSDSKLYITTLAAAIARLWPDVLTNSV
FT                   DPGWVPTRMGGAGAPDDLRLGHLTQEWLATSDDPEAVTSGGYWHHQHREKAHPSANDQR
FT                   FQAELLNLLARLTGESLT"
FT   gene            73586..74179
FT                   /locus_tag="Arth_0069"
FT   CDS_pept        73586..74179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0069"
FT                   /product="broad-specificity phosphatase PhoE"
FT                   /EC_number="3.1.3.-"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: btk:BT9727_3677
FT                   phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01470"
FT                   /db_xref="GOA:A0JR00"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR00"
FT                   /protein_id="ABK01470.1"
FT                   /translation="MEGMTLTTFALVRHGQTDWNAQRRLQGSTDIPLNDVGRGQARDAA
FT                   AALSGHEWDAIVSSPLSRAAETASLIADGLGLSVARHVPELTERSFGQAEGLQAGPELE
FT                   ALRIPGGFRGAESEDQAASRGLAALEALAEEFRGRRVLVVAHGTLIRVSLSRAIGRTLQ
FT                   SVDNAVLNLAHHHAVDGWQLEYFNGERFAASVQA"
FT   gene            complement(74187..74918)
FT                   /locus_tag="Arth_0070"
FT   CDS_pept        complement(74187..74918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01471"
FT                   /db_xref="GOA:A0JR01"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR01"
FT                   /protein_id="ABK01471.1"
FT                   /translation="MGGARDPDGGYGRDDQPDEVVPDGEDAGYFDDTAAPEEAPLPEVP
FT                   AAIIRETVVARQEERFGGIKIGAAFFGWLTATAMTVLLAALAMAATRTGLLTAADTAAG
FT                   YGQAWSWPGGVTGAALLLLIPLLAYFSGGYVAGRMARFNGVGQGLMVWLWAVIVAAAAA
FT                   VVAMVSGIVGGGQLNVRNTLNELLRLPVNEGPPGTGSIVAAIAVAALALLGSVLGGMVG
FT                   VHYHRKVDRVGFTPTENYYQP"
FT   gene            complement(75055..75498)
FT                   /locus_tag="Arth_0071"
FT   CDS_pept        complement(75055..75498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0071"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: mag:amb2488 UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01472"
FT                   /db_xref="GOA:A0JR02"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR02"
FT                   /protein_id="ABK01472.1"
FT                   /translation="MSRKIETVEDDAGKVISYHRHPNGGGLIGRGAEVDESSFISPTAY
FT                   VEAGAQVGPGCRVGGGSWIDRRARVGHRVVIGDAVYVGQGAVIGHRARIGSHSKIGAGA
FT                   VIGHGVRLHGDSKVAQGSRLPARTRASASPPPPSLTDGDRQAA"
FT   gene            75671..76555
FT                   /locus_tag="Arth_0072"
FT   CDS_pept        75671..76555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0072"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family; KEGG:
FT                   lxx:Lxx11940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01473"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR03"
FT                   /protein_id="ABK01473.1"
FT                   /translation="MTTNDKDLSGRQPQGGVRSTGYPAAADGHPWRRYVALGDSFTEGV
FT                   GDPDPRCPGGVRGWADRVAEELSAGHTDFAYANLAVRGLLLEQILARQAGPALVLQPDL
FT                   ITLSAGGNDMVFHGSDPDKLADKLDDGVALLSSSGATLVLFTGPDWGSTPVLGRNRSKV
FT                   AVFNENIREIASRHHAVIADLWGLRELRDPRMWDRDRLHLSPLGHYAVARRVLDALGVR
FT                   HPLQPLQAGDLPQGDWRRARAEDLVWARRYLLPWAWRRVHRPAVATEPTAKRPAAAPVN
FT                   SSGQPAVAMEGRA"
FT   gene            76568..76640
FT                   /locus_tag="Arth_R0004"
FT                   /note="tRNA-Lys1"
FT   tRNA            76568..76640
FT                   /locus_tag="Arth_R0004"
FT                   /product="tRNA-Lys"
FT   gene            complement(76881..77228)
FT                   /locus_tag="Arth_0073"
FT   CDS_pept        complement(76881..77228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cjk:jk0673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01474"
FT                   /db_xref="GOA:A0JR04"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR020264"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR04"
FT                   /protein_id="ABK01474.1"
FT                   /translation="MATRSGAAWHGDSGLQPERTDLAWSRTTLSMVIAAAVFLRWLPHH
FT                   GWFVGTLVGGAVVTALAINLTQKRRFHRAVRGIRQETMPPHIGSTAAVAASVVVLALLG
FT                   IYTVLFLPLQP"
FT   gene            complement(77231..77632)
FT                   /locus_tag="Arth_0074"
FT   CDS_pept        complement(77231..77632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0074"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   cgb:cg0135 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01475"
FT                   /db_xref="GOA:A0JR05"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR05"
FT                   /protein_id="ABK01475.1"
FT                   /translation="MPEDSNTGAPDPRGRLTSRILRGGTEPDPRFTLANERTFLAWIRT
FT                   SLALLAGGVAVEAFMAELLGPELRKTISVLLLVLALLIGGGSFFRWVNVERAMRRKAPM
FT                   PLPLMAPVLAIGGALVAAIMVVFVIVRPA"
FT   gene            complement(77700..78107)
FT                   /locus_tag="Arth_0075"
FT   CDS_pept        complement(77700..78107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01476"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR06"
FT                   /protein_id="ABK01476.1"
FT                   /translation="MRSARFAAKLPAGRLRRPEGLVMAGKFEVFVDAELQYRFRLTTPE
FT                   GAELAVSGAYRDKPSAVAAIEAVRECAGMGLISDLCPAGSSVQAPTEAPAAATPAPAPA
FT                   ACDTRRFPVDGFRKHAAARRAPAVPHWSGAA"
FT   gene            78291..78845
FT                   /locus_tag="Arth_0076"
FT   CDS_pept        78291..78845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0076"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cvi:CV4239
FT                   probable amidase from nicotinamidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01477"
FT                   /db_xref="GOA:A0JR07"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR07"
FT                   /protein_id="ABK01477.1"
FT                   /translation="MTTLSDRPNTALLVIDVQNGVVADAYQRDAVVANIATLVAKARGE
FT                   RVPIVWIQHSDEQLEKGSAPWEYVPELTRQEPEPLVHKSFADSFEDTDLEDVLAAAAVG
FT                   RLVVAGAQTDECIRSTIHGAFVRGYDVTLVGDAHTTEDQSEWGAPPPDKVIAHTNLYWK
FT                   YHTAPGRTAAVEDTQDVTFAG"
FT   gene            78923..80023
FT                   /locus_tag="Arth_0077"
FT   CDS_pept        78923..80023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0077"
FT                   /product="Sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ath:At2g24580 sarcosine oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01478"
FT                   /db_xref="GOA:A0JR08"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR08"
FT                   /protein_id="ABK01478.1"
FT                   /translation="MEVDVVVVGGGAMGSAAAWQLARRGRSVVLLEQFEQGHHIGASHG
FT                   ATRNFNMAYAEGDYLDLVTEAKDLWDELEGATGMQLLDLVGLVNHGNVRRLRDVRSSHA
FT                   ERGIESHFLPATEAAERWRGMNFRGDVLVVPGSGRVRAADALLALRHAAEAHGARFEYS
FT                   TPARDIRVEGDRAVVVIDSGEITARRVVVTAGAWTSKLLGSTVPLPRLVVTQEQPAHFT
FT                   PLDDSLTWPSFNHNPDPDDPRDAYWYGPVYGMLTPGEGIKAGWHGVGPVTDPDGRSFTP
FT                   EPVQLEALVRYVREWLPGVDAESAAPMSCTYTSTANEDFVLDRFGPVVVGAGFSGHGFK
FT                   FTPAVGRVLADLADGGGAPARFTARR"
FT   gene            80080..80631
FT                   /locus_tag="Arth_0078"
FT   CDS_pept        80080..80631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0500 proteophosphoglycan ppg3,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01479"
FT                   /db_xref="GOA:A0JR09"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR09"
FT                   /protein_id="ABK01479.1"
FT                   /translation="MRNGRLVLCILAVLSVVAAFFLGIAAPASAAPCPDKQVPAAAGGF
FT                   CVSGGPPSPAPTASATAPAGPASPGPAQGGSGPADTQPAVPGSAAENLPSQESVATLGS
FT                   ASAPSASAGTPSAAGFATPARVSSPVPSRSARTLTAAPPDSGRAAAGTVPLAGYLMAIG
FT                   GGMLLLSAAFGFMRIRPAAR"
FT   sig_peptide     80080..80172
FT                   /locus_tag="Arth_0078"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            80789..81442
FT                   /locus_tag="Arth_0079"
FT   CDS_pept        80789..81442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0079"
FT                   /product="membrane protein"
FT                   /note="KEGG: cgb:cg0971 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01480"
FT                   /db_xref="GOA:A0JR10"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR10"
FT                   /protein_id="ABK01480.1"
FT                   /translation="MMPANAVDELTGIAGFAARGIDTLGEWGVGLFTFAETIIPPIPSE
FT                   VILPLAGFLTKQGSMSLALVFVTSTLGAYAGALLLYWIGAKLGLERAIRGLSRLPLMDR
FT                   EDFEKAADWFQRHGKSAVFFGRFLPGVRSLISLPAGAEKMNLATFSIFTIAGSGLWNAL
FT                   LIGLGVLLGAQYRLIEEYSKYLNYAVYAALAAVIAWVSIRAYRRQRERVDQNQR"
FT   gene            complement(81454..82431)
FT                   /locus_tag="Arth_0080"
FT   CDS_pept        complement(81454..82431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0080"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein, LacI;
FT                   KEGG: sco:SCO1642 LacI family regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01481"
FT                   /db_xref="GOA:A0JR11"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR11"
FT                   /protein_id="ABK01481.1"
FT                   /translation="MVAARAGVSTATVSLVANGKTRGRVSEDNISRVRDAISELGYVVD
FT                   GIGSSLAKGVSSIVILVAPDISNPFFAKVIAGVRESLGADYQLLLSVTEAGEFPQADDV
FT                   RKLMALRPAGLLVDAPDAEFLEELSAAGPLVLLDAPGLEAYAPSVNLDVAHGARELAAH
FT                   LAAAGHKCAAYVDSVTGTATFDVRRTAFLEEAAVRGISVPPECIISTTIDVGTAAAAFA
FT                   RAWPQWRRNGVTAVVCGTDTHAYGVLQEARVAGVRIPEELAVAGFDDLPYSATSNPGLT
FT                   SVHLPATPLGLKAGEQLRSLMEGRPLEQPQVTLESSLVVRGSTA"
FT   gene            82645..83715
FT                   /locus_tag="Arth_0081"
FT   CDS_pept        82645..83715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0081"
FT                   /product="Purine nucleosidase"
FT                   /EC_number="3.2.2.1"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: pmu:PM1767 inosine-uridine preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01482"
FT                   /db_xref="GOA:A0JR12"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR12"
FT                   /protein_id="ABK01482.1"
FT                   /translation="MLLHPASGRAPNDVEIDVDPNPVTPARKKIILDCDPGHDDAVALL
FT                   LAHGNPDIELLAVTTVVGNQTLEKVTRNALSVGTIAGITGVPFAAGCDRPLVRTIETAP
FT                   DIHGETGMDGPAQPESAIELDPRHAVDLIIDTVMAHEPGTVTLVPTAGLTNIAMAARKE
FT                   PRIVERVKEVVLMGGGYHVGNWSAVAEFNIIIDPEAAHIVFNEAWPVVMVGLDLTHQAL
FT                   ATPEVVEKIAAVGTAPARFVMELMEFFTKTYKDAQGFDYPPVHDPCAVAYVIDPSIVTT
FT                   LKVPVDIELHGRLTLGMTVADFRAPAPADCNTSVAVDLDHERFWNLVTDALIRIGEPAL
FT                   AAPAVVAAGAATGGVK"
FT   gene            83716..85140
FT                   /locus_tag="Arth_0082"
FT   CDS_pept        83716..85140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0082"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cef:CE1483 putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01483"
FT                   /db_xref="GOA:A0JR13"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR13"
FT                   /protein_id="ABK01483.1"
FT                   /translation="MTTLTETKTTRGNVTALMVALLAACVAFQLNASMLSPALVTMGKE
FT                   LNTDQAVIGLSQTWFFTAAALFSLFLPRLSDIIGRKKILIGMMLLMAVGSVIAALAPDV
FT                   TWLFVGRIIQGVSGPTVPLCLIMLRSAVSNPRKYGTLMGLITAVNGGVAGVDSFVGGYF
FT                   AEHFGFRSIFWLMVVLALVATALIALLAGESKPAAGTTMDWLGVFFIVVAVGALLTALN
FT                   EGSKLVGGFSAGTLVLATGLVAVAAVAFYAFWTVEKRSKQPMVETVHLRQRSTWAPLLT
FT                   TTLTMTGIFAVINGIVPAYVQAAAPGFGVGPTEMSLIILTPYALLGWVVGPLSGRLAPV
FT                   LGYTRVLRIGLLGSIAALALIAFFGLGSLPMMIAGTVLLGIMYAGTVNIMLNGLGVVLS
FT                   PAGNPGFLPGMNAGAFNLGAGLSFLVLPAVLVATSALGDAKASYLTVVVVGLVITIAAF
FT                   GASLLIPKPVEAEVAE"
FT   sig_peptide     83716..83814
FT                   /locus_tag="Arth_0082"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 33"
FT   gene            85137..86111
FT                   /locus_tag="Arth_0083"
FT   CDS_pept        85137..86111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0083"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: blo:BL1772 sugar
FT                   kinase in PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01484"
FT                   /db_xref="GOA:A0JR14"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR14"
FT                   /protein_id="ABK01484.1"
FT                   /translation="MSAGAEAHGRIVVVGSLNADLTIYCERLPLPGETVHGTGFAVNPG
FT                   GKSANQAVAASLLGGAVSLVGAVGDDSNGEMLLSSTAGAGVDISHVRTSESAATGVAVI
FT                   AVDAHGENNIIISAGANGTLAPADVAASADVFAGASVVCLCLEVSLDTVEAAARTGHDA
FT                   GATVLLNLSPYGEIPPGLAELTDVLLVNAHEASLFLGSGEMPGAEAHDAAWDGVRERFA
FT                   ERGLQRVLVTLGASGSVVLDSLVSGTDRVTRTAPVTVHAVDTTGAGDAFTGAVAARLAA
FT                   GEPLAEAAAFASVAAALAATRKGTQAAYAGVADVERMRARLLS"
FT   gene            complement(86108..87220)
FT                   /locus_tag="Arth_0084"
FT   CDS_pept        complement(86108..87220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0084"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: bja:blr3392 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01485"
FT                   /db_xref="GOA:A0JR15"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR15"
FT                   /protein_id="ABK01485.1"
FT                   /translation="MGKPLNVGIIGCGKIVAQYLTNFRRLEQVRLVAVADLDTARAQEI
FT                   ADSYEGVRAVSVDELIAADDIDLVLNLTIPAAHADVALKAIAAGKSVYGEKPLAATTDE
FT                   AREVITAAREAGVVVGCAPDTVLGTGIQTARKAIDDGLIGSPIAATATMVTPGHERWHP
FT                   NPDFYYQPGGGPLLDMGPYYVSALVTLLGPVVSVMGAASHTRTERTIGSGERAGQVIPV
FT                   NIDTHVTGVLVHASGALSTLVMSFDAVQSKSPNIEIHGEKGSLSVPDPNHFDGDVQLFR
FT                   LGGESWETLPVSAGYIDSGRGYGIADIAATPAGAEPRAGGALAFHVLEVMESVLASAHT
FT                   GASVRIASTVERPSAVELADLAALPQEINS"
FT   gene            complement(87205..87903)
FT                   /locus_tag="Arth_0085"
FT   CDS_pept        complement(87205..87903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01486"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR16"
FT                   /protein_id="ABK01486.1"
FT                   /translation="MTERKNALVVRGGWDGHQPYEATELFIPYLKDNGYDVRVEESPKV
FT                   YADAEYMAGVDLIMQCMTMTTIEKDEFAGLRTAVENGTGLAGWHGGIADSYRNNSDYLH
FT                   LIGGQFACHPGKHPDECVGEQSDNYVPYTVNMLPAAAEHPITQGIADFDLVTEQYWVLS
FT                   DDYIDVLATTTQKVREWDPWNREVTSPAIWTRQWGNGKIFVCTPGHRTEVLQDKNVRTI
FT                   IERGLLWASR"
FT   gene            complement(87953..88957)
FT                   /locus_tag="Arth_0086"
FT   CDS_pept        complement(87953..88957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0086"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: AP endonuclease 2 domain protein; Xylose
FT                   isomerase domain protein TIM barrel; KEGG: sco:SCO6571
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01487"
FT                   /db_xref="GOA:A0JR17"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR17"
FT                   /protein_id="ABK01487.1"
FT                   /translation="MTRPITLFTGQWADLPFEEVARLAGEWGFDGLEIACWGDHLDPRR
FT                   AAEDDNYLQGRLDILEKHNLKVFAIANHLTGQAVCDDPIDERHQGILSAEVWGDGEAEG
FT                   VRRRAAESMKDTARAAARLGVKTVTGFTGSSIWKAVAMFPPASEAMIDAGYQDFADRWN
FT                   PILDVFDEVGVRFALEVHPSEIAYDYWTAKRTLEAIGHRKSFGLNFDPSHFIWQDLDPV
FT                   MFLQDFADHILHVHVKESVRQLDGRNGRLGSHLAWADPRRGWDFVTAGHGDVQWNRIFR
FT                   TLNAIGYTGPTSIEWEDAGMDRLVGAPQALAMVKELARIAPPAAAFDAAFSSR"
FT   gene            complement(88985..90178)
FT                   /locus_tag="Arth_0087"
FT   CDS_pept        complement(88985..90178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0087"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: sco:SCO6570 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01488"
FT                   /db_xref="GOA:A0JR18"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR18"
FT                   /protein_id="ABK01488.1"
FT                   /translation="MTTAKPLRVGMVGYAFMGAAHSHAWRTAPRFFDLPLQPRLTAVAG
FT                   RNADGVRAAADKLGWESVETDWRRLIERDDIDLIDICTPGDTHAEIAIAALEAGKHVLC
FT                   EKPLANSVEEAERMTLAAETAAKQGILSMCGFSYRRTPALALAKRFVEQGRLGEIRHIR
FT                   AQYLQDWLSDANAPMTWRLDKSKSGSGSLGDIGAHSIDAAQWVAGQSITGVSALLETFV
FT                   PERPLAGDLVGLGGHGDLSGDAPRGKVTVDDAAIFSAKFDGGAGSTGAIGVFEATRYAL
FT                   GRKNAMRLELNGTKGSLAFDFEDMNVLSFYDAAESPDAGFRKIFVTEPEHPYVGNWWPT
FT                   GHGLGYEHGFTHQVVDLVTAIGEGRQPEPSFADALQVQRVLAAVEASAANSSQWQKV"
FT   sig_peptide     complement(90110..90178)
FT                   /locus_tag="Arth_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.455 at
FT                   residue 23"
FT   gene            complement(90207..91022)
FT                   /locus_tag="Arth_0088"
FT   CDS_pept        complement(90207..91022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0088"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sco:SCO0292 putative sugar
FT                   ABC-transporter integral membrane protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01489"
FT                   /db_xref="GOA:A0JR19"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR19"
FT                   /protein_id="ABK01489.1"
FT                   /translation="MRRLNVPAGLGGWIWLAIIIIPVYYVVITSLKTQAGYFGQNPLAL
FT                   PAEPTLENYQMVLEADFAKYFMNSTIVTLGAVIPTVLISFMAAFAIVRGKGRFLKLVNG
FT                   MFLMGLAIPLQATIIPIYLMIIRLNLYDSLLALMLPSIAFAIPLTVLILSNFIRDVPNE
FT                   LFESMRLDGCSEWQTMWRLALPLTRPAIVTVAIYNGLHVWNGFLLPLVLTQSPGLRVLP
FT                   LALWTFQGEYSVNIPAVLASVVLSTLPILVLYVVGRRQLLSGLTAGFSK"
FT   gene            complement(91115..92053)
FT                   /locus_tag="Arth_0089"
FT   CDS_pept        complement(91115..92053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0089"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sco:SCO0291 putative
FT                   binding protein dependent transport protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01490"
FT                   /db_xref="GOA:A0JR20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR20"
FT                   /protein_id="ABK01490.1"
FT                   /translation="MSNAVSTAPNTKAAARTATVKGGQRDKALAWLTAPALFFFVVFAV
FT                   VPLAGVLILSFASWDGIGAIGSAGLGNWFSVLADPGLYNALGLTFLIMLASWLVQTPIS
FT                   LLLGVFTAGSQRYRAALAVLYFLPLLLSSAAVAIAFKALLDPNFGLATGLGLPFLAQDW
FT                   LGVPHLAVGLVIFVIAWQFVPFHTLIYQGGVRQIPKSLYEAAEIDGAGTIKQFFHITLP
FT                   QLKYTIITSSTLMVVGSLTYFDLIFVLTGGGPGNSTRILALDMYLRGFRANLMGPASVI
FT                   AVILVLIGLALALFLQRLGGKDKQGSQLEGM"
FT   gene            complement(92050..93375)
FT                   /locus_tag="Arth_0090"
FT   CDS_pept        complement(92050..93375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0090"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: sco:SCO0290 probable solute-binding protein; TC
FT                   3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01491"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR21"
FT                   /protein_id="ABK01491.1"
FT                   /translation="MKQPQSSRRSFLALAALAPFAAMVTSACGTSGPGASSGGGASMWY
FT                   LSGEPNQTTMQKAVDAFGSANPDNKVTVTYFQNDAYKTKIKTAIGAGQAPTIIYGWGGG
FT                   TLKTYAEAKQVEDLTSWLAENPDLKDKFFPASFGAATVNGKVYALPNQYVAPIVLFYNK
FT                   ELFEKAGAQPPKTWDDIMSLVKTFNNMGVAPFSLGGQSRWTSMMWLEYLLDRIGGAEVF
FT                   TAIFEGKPDAWKDPAVIETGTKIQELVSADGFIKGFSSIAADSNADQALLFTGKAAMML
FT                   HGSWTYGAMKKGGQNFVQDGKLGFVQFPVVAGGKGDPKNGVGNPAQYMSISSKASEKEK
FT                   ETAKKFFKDGILTDTVIDTYINSGSVPIVNGIEDKLNTSPDKDFLNFVYDLAKNAPNFQ
FT                   QSWDQALSPTAAEALLNNIDQLFLKSITPQQFAENMNATLGK"
FT   sig_peptide     complement(93286..93375)
FT                   /locus_tag="Arth_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.403 at
FT                   residue 30"
FT   gene            93605..94645
FT                   /locus_tag="Arth_0091"
FT   CDS_pept        93605..94645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0091"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sco:SCO0289
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01492"
FT                   /db_xref="GOA:A0JR22"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR22"
FT                   /protein_id="ABK01492.1"
FT                   /translation="MATKTRQDKPTLVTVARQAGVSAPTVSKVVNGRDDVAPETRARVL
FT                   AALEKAGYQSPLQRRSAAEAATVVEVVIDFLDSAYTVEVLNGILRFAAGADVEILVSVT
FT                   GQAPSGGISPEGRAQRMLDEGRAGMIVVTSAFSEAQLHAFRRRQIPVVVIDPLNPPSAD
FT                   VVSVGATNWAGGKAATEHLLELGHRRIAYIGGIEGSECNQARLHGYMAALMAQGVPVDP
FT                   QYIVSGGKFRRDAGVSGLKALLELEQRPTAVFAGSDSIALGVLSEAGRHGLRIPDDISL
FT                   IGFDGTSQGQESVPALTSVAQPLEEMGRAALRSLLRQARGEVLDSHRVELATQVIVRDS
FT                   TAPPVA"
FT   gene            complement(94706..95416)
FT                   /locus_tag="Arth_0092"
FT   CDS_pept        complement(94706..95416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0092"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: sma:SAV6942 GntR-family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01493"
FT                   /db_xref="GOA:A0JR23"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR23"
FT                   /protein_id="ABK01493.1"
FT                   /translation="MATSAAATRGTSAALSSASTAAARLRVAVPSVADRVADELRLQLA
FT                   EGVLLPGARLTESTIAEDLGVSRNTVREAFAELASERLVIRHPNRGVFVASLEAGDIHD
FT                   VYTVRRTIEVSAIRGGGSPEAVAAVRAAVEEGKLAAAANDDEGLGTANQHFHGAIVALA
FT                   GSRRLNTIMSQVLAEMRLFFHKATMDAHFYSGYLKDNEEICEALEAGELERAAELLLAY
FT                   LDRSEEKQAEVHGE"
FT   sig_peptide     complement(95351..95416)
FT                   /locus_tag="Arth_0092"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.655 at
FT                   residue 22"
FT   gene            95523..96281
FT                   /locus_tag="Arth_0093"
FT   CDS_pept        95523..96281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0093"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: tfu:Tfu_1970
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01494"
FT                   /db_xref="GOA:A0JR24"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JR24"
FT                   /protein_id="ABK01494.1"
FT                   /translation="MVYMDLNSDVGESFGRWTLGDDTAMFQSVSSANVACGFHAGDPTV
FT                   IRRTCREAVQAGVMIGAHVGYRDLSGFGRRFVDIDPSELADDIVYQIGALQALAATEGA
FT                   RVRYVKPHGGLYNAIVSHTAQARAVVDAVKSIDASLPILGLPGSEVLRLAEAAGLRAVS
FT                   EAFADRAYNPDGTLVSRSLPGAVLHDPAQVAEHVLRMAADSAIRTVDGSILRINADSIC
FT                   VHGDSPGAVAMAVAVRAALSDAGIDIRAFA"
FT   gene            96387..97718
FT                   /locus_tag="Arth_0094"
FT   CDS_pept        96387..97718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0094"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B0925
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01495"
FT                   /db_xref="GOA:A0JR25"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR25"
FT                   /protein_id="ABK01495.1"
FT                   /translation="MTTHHSAARSGRKIPPGALKAYIASLTGTSLEYYDFAIYSVASAL
FT                   VFPKIFFPGNDEFVGLLLSFSAFAVGYLARPIGGVIFGRLGDKIGRKHVLVVTLMLIGV
FT                   ATVLIGLLPDYSVIGVAAPTILVLLRLAQGIGVGGEWGGAVLLSSEFGDANKRGFWSSA
FT                   AQIGPPAGNLMANGVLAVLAATLSTEAFLSWGWRVAFLASALLVVFGLIIRLKLEETPV
FT                   FKAIAAHGEQPKAPITEVFTREPRALIAAALSRVCPDVLYALFTVFVAVYATKELGLTT
FT                   GNVLTAILIGSAFQLFLIPLAGALTDRFNRRLVYGIAAVGTALYIPLFFLMIEGKSVLM
FT                   LIIGVVIGLAFHAFMYGPQAAYITEQFPARLRYAGSSLAYTLAGVIGGAVAPLIFTALY
FT                   AVSGDWFLIAAYLLVAAAVTVVGLALGRNPQTAEEERLLADSHA"
FT   gene            97771..99438
FT                   /locus_tag="Arth_0095"
FT   CDS_pept        97771..99438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0095"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; Allophanate hydrolase
FT                   subunit 1; KEGG: reu:Reut_A2450 allophanate hydrolase
FT                   subunit 2:conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01496"
FT                   /db_xref="GOA:A0JR26"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR26"
FT                   /protein_id="ABK01496.1"
FT                   /translation="MKAAAMETLTVHKVLSVRPVGTRAVLAELSGTQEVLALQALLVEA
FT                   PLPGQVDVLAAAQTVMVRADSPAAARRMGGLLLELDLTARAKQDGGLVFIDTVYDGEDL
FT                   AEVGRLTGLGTDGVIEAHTGQVWTVAFAGFAPGFGYMVGENQTLEVPRRSSPRTAVPAG
FT                   SVALAGNYSAVYPRRSPGGWQLIGRTGARMWDLNRAEPALASPGHRVQFRAVRDVVTMA
FT                   TEPAASDAAPAAGMPEELPGQETPSGLRVVSPGLQSLLQDLGRHGHSALGVSAAGALDR
FT                   ASLRRANRLVGNRSSAAAIESVAGGLRVQAVGDQVLAVAGAPSALTIDSPSDAGSDSDA
FT                   GKPARQRTVPMATPFALLDGEILTLGAPESGFRSYLAVRGGVDAAPVLGSRSTDTMSGI
FT                   GPAPLAAGQLLASGDVTESGVVGSPELQPDFPGDGVTVLDIVLGPRADWFDQSAIDSLC
FT                   GQDWVVKPQSNRVGMRLDGTPLQRSRQGELPSEGTVAGAIQVPPEGLPVLFLADHPITG
FT                   GYPVIGVVVDHQLDLAAQVPIGGSIRFRIVPEQTPQEK"
FT   gene            99447..101210
FT                   /locus_tag="Arth_0096"
FT   CDS_pept        99447..101210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0096"
FT                   /product="biotin carboxylase / biotin carboxyl carrier
FT                   protein"
FT                   /EC_number="6.3.4.14"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   sco:SCO6271 putative acyl-CoA carboxylase complex A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01497"
FT                   /db_xref="GOA:A0JR27"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR27"
FT                   /protein_id="ABK01497.1"
FT                   /translation="MRKVLIANRGEIAVRIARACDDAQLESVAVYADIDADAMHVGAAS
FT                   EAFSLDGNSPADTYLNIPKLLEVAARSGADAVHPGYGFLSENADFAQAVLDAGLAWIGP
FT                   APEAIRQLGNKITAREIAVRAGAPLVAGSDGPVDSAAEARAFAEQHGLPIAIKAAFGGG
FT                   GRGLKVVRNMDEIEESFDSAVREAVAAFGRGECFVERYLDRPRHVEAQVLADTHGNVVV
FT                   VGTRDCSLQRRHQKLVEEAPAPFLSDDQRQQICSAAKAVCREAGYSGAGTVEFLVAADG
FT                   TVAFLEVNTRLQVEHPITEETTGIDLVQEQFRIADGEALRITADPEPRGHSFEFRLNAE
FT                   DVGRGFLPSPGTIADFHAPTGPGIRLDTGVRAGSFVAPQFDSLLAKLIVTGADRQQALR
FT                   RARRALAEIEITGVATVLPFHRAVLQSPDFTSETGLGIHTRWIETDFADRIPADPGYST
FT                   TAPEGERRTITVELDGRRLAVGLPADLLDGWARSGGALPAGVSLDGASDGGAAAGSAAD
FT                   PGELRADMAGTVVKWLVEPGAEVSAGDAVVVLEAMKMETQVTAHRDGTVTGIRAEAGGV
FT                   VSVGAVLALIG"
FT   gene            complement(101361..101864)
FT                   /locus_tag="Arth_0097"
FT   CDS_pept        complement(101361..101864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01498"
FT                   /db_xref="GOA:A0JR28"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR28"
FT                   /protein_id="ABK01498.1"
FT                   /translation="MSPVPKRAGVLFDSGRMYYGRLPRAIIGGSALLLAGILLAIFITD
FT                   ALQSEPVAWTSIACALILITFLAFGFSRIQVLENEVRLRWFPFYRRRIPIAAIRRAAPA
FT                   TVHGLRYGFGLRFGAFGLGIIQDTGPAVQLDAGRGYLLSLGSADRQARFLAALAAAGVN
FT                   VQRF"
FT   gene            complement(101942..102307)
FT                   /locus_tag="Arth_0098"
FT   CDS_pept        complement(101942..102307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0098"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: tfu:Tfu_0872
FT                   regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01499"
FT                   /db_xref="GOA:A0JR29"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR29"
FT                   /protein_id="ABK01499.1"
FT                   /translation="MKDELPTGLVLSDVKAELFKSMGHPVRIQVLEMLADGPVAVSRLR
FT                   DDTGLEPSNLSQHLGVLRRQRLVIPSRQDGRLFYELSCPEVSSLLLSARSLLGTVLQST
FT                   RLTLKSVDVPAKEAVGH"
FT   gene            102640..102855
FT                   /locus_tag="Arth_0099"
FT   CDS_pept        102640..102855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01500"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR30"
FT                   /protein_id="ABK01500.1"
FT                   /translation="MAGMFELFADSDTSFRFQLTAPDGTVMALSRPFPDKRAAVAGIAA
FT                   VREYAGMGFVTESLRRPAAVADFPAW"
FT   gene            102861..103586
FT                   /locus_tag="Arth_0100"
FT   CDS_pept        102861..103586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0100"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; PAS fold-3 domain
FT                   protein; KEGG: nfa:nfa43830 putative transcription
FT                   antitermination regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01501"
FT                   /db_xref="GOA:A0JR31"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR31"
FT                   /protein_id="ABK01501.1"
FT                   /translation="MTARKVPQAHSSLLAAGECIAGTFRYDAVTGKLDWSEELFHIHGY
FT                   RRGEIVPTLDLLLSHKHPDDRSRGLEILTRIRNAGGSFFSYDRLIDARLREHRILTTGE
FT                   GVLDQAGRLSHIDAFVIDLTKMLQRETEQFARAAVTAANASRSTIEQAKGILMGALRIG
FT                   SEEAFKLLVAHSQHSNIKLARTATELVALANNAKDPALLDGFVQALHRGQALHRGPAGR
FT                   RPGTIGVHGPAGRRQQGSM"
FT   gene            103600..104214
FT                   /locus_tag="Arth_0101"
FT   CDS_pept        103600..104214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0101"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP2741c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01502"
FT                   /db_xref="GOA:A0JR32"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR32"
FT                   /protein_id="ABK01502.1"
FT                   /translation="MTADDANRSTLLPAQAMAGRDDPVDRILATAYELFSRRGIRDVGT
FT                   NELISRSGVAKATFYRHFPSKDALVLAFLALRDQVWTVDLIVSEARRRGTTPEERLLAI
FT                   FDVFGDWFHRDDFEACTFINVLLEMGPDHPLGKASIGYLTRIRGHIQALAEEAGLSRTE
FT                   EFARSWHILMKGSIISATEGDFLASKRAQQMAGWLIEHHRN"
FT   gene            complement(104219..105274)
FT                   /locus_tag="Arth_0102"
FT   CDS_pept        complement(104219..105274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0102"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: sco:SCO6990
FT                   putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01503"
FT                   /db_xref="GOA:A0JR33"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR33"
FT                   /protein_id="ABK01503.1"
FT                   /translation="MLEATKSHEHPKAGADADAAPLNPALAAEAKIARIAVTVFPLLVV
FT                   AAGIAGFLLPGAFKPMAPGVPYLLGVIMFCMGLTLTPPDFASVVKRPWAVVLGIVAHYV
FT                   IMPGAGWLIAVALNLPPELAVGLILVGCAPSGTASNVMAFLAKGDVALSVAVASVSTLI
FT                   APIVTPLLVLFLAGSFLQIDAGAMVVDIVKTVLLPVIAGLLARLFLKKLVAKVLPALPW
FT                   ASAVVISLIVAIVVAGSASKIVAAGGIVFLAVVLHNGFGLGLGYLAGKLGRLDDKARRA
FT                   LAFEVEMQNSGLAATLATAHFSPLAALPSAVFSLWHNISGAIVAAWLARRPLTDAPGRD
FT                   AQVHSAAARDA"
FT   gene            complement(105390..105584)
FT                   /locus_tag="Arth_0103"
FT   CDS_pept        complement(105390..105584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01504"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR34"
FT                   /protein_id="ABK01504.1"
FT                   /translation="MAGKFELVAAEQGGVRIRLVNGAGNILAVSGIYRDSAAAASGVTE
FT                   IREHAATAHIADYSGPPAQ"
FT   gene            complement(105694..107196)
FT                   /locus_tag="Arth_0104"
FT   CDS_pept        complement(105694..107196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0104"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: cjk:jk0187 sulfate permease and
FT                   related transporters (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01505"
FT                   /db_xref="GOA:A0JR35"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR35"
FT                   /protein_id="ABK01505.1"
FT                   /translation="MKPEQLQSVRATLRSPRRLKTEALAGLVVALALIPEAIAFSVIAG
FT                   VDPRIGLFASFTMAVTISFVGGRPAMISAATGAVALVIAPLMRSHGLDYLIAAVILAGA
FT                   FQILLALLGVTRLMRFIPRSVMVGFVNALAILVFMAQLPELINVPWLVYPLVAVGLVIV
FT                   IGLPRLTSAVPSPLVAIVALTLFAVLAKIDVPAVQDKGQLPESLPTLFIPNVPLTLETF
FT                   QILAPFALSMALVGLLESLMTAKLVDDITDTRSNKTRESWGQGVANIVTGFLGGMGGCA
FT                   VIGQTMINVKGSGARSRVSTFLAGVFLLVLVVALGDVVGLIPMAALVAVMIFVSAITFD
FT                   WHSIALKTLRRMPKSETAVMLITVGTVVATHNLAIGVGVGVLAAMAMFARRVAHFATVE
FT                   RTEIELNGETVATYTVDGELFFASSNDLYTQFEYARDAAPTVDRVIIDLHASHLWDAST
FT                   IAVLDAVTEKYRRHGREVELIGLNSASTQMRERLAGKLNAGH"
FT   sig_peptide     complement(107062..107196)
FT                   /locus_tag="Arth_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.673 at
FT                   residue 45"
FT   gene            complement(107203..108309)
FT                   /locus_tag="Arth_0105"
FT   CDS_pept        complement(107203..108309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0105"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: cdi:DIP1575
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01506"
FT                   /db_xref="GOA:A0JR36"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR36"
FT                   /protein_id="ABK01506.1"
FT                   /translation="MATNWDRLDAGLRESVQENVELYERVRPALKLVTREVLLTLRSML
FT                   KDTEVTPLFVTGRTKTVESFKEKISRTEKPLEPGGPPVLKFPDPFRTLNDMVGVRVITK
FT                   LPAENAVVANLIKRQRQLFDCRGDREKDIGSIESGTYGYSSRHLILRTIQNEAVKDYQK
FT                   VFNPDLQPNGSYFFECQIRTVFAHAWSEIEHDIRFKAEDPRAWTPHFDRQFTATAAMLE
FT                   TVEGAFADLHERYEEVRGYWDTDGEGAAQLTPNRIRDVWRTLLPHVDRKVDDDWGWAAE
FT                   LMAAHGLNQTVQLAELLSANRITEVRKALDHRYSPGPDRLLDDLLLWQYGTKHIDLTAE
FT                   APDAVPHPRRDSLLRRLKQIERYRQTKL"
FT   gene            108461..109360
FT                   /locus_tag="Arth_0106"
FT   CDS_pept        108461..109360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa52740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01507"
FT                   /db_xref="GOA:A0JR37"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR37"
FT                   /protein_id="ABK01507.1"
FT                   /translation="MCGVGPFFPQGLGAAAAVTLGALSASCSSGPKEDAVKRHKYQYGD
FT                   DPSQWGELFLPDAPGTRGVVVVIHGGYWRSQYGAELGEPLARDLAMHGMPAWNLEYRRA
FT                   GNGGGWPHTFEDVLAGIDKLRDVAAMHGLGLERVVALGHSAGGHLAVWAAGRSRLGQLG
FT                   APDADRQLQRKNDDGAVHLTGVVSQAGLLNLAEAEKLNLSNGAVSNLLGGSSAKYPKRH
FT                   KFVDPMSAVPLGVPVYAVHGSDDDDVPASQSLTYAGAAKAAGAPVQLLNVPGDHFSLID
FT                   PKAPAYRKCRDLVQELLG"
FT   gene            109469..110854
FT                   /locus_tag="Arth_0107"
FT   CDS_pept        109469..110854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0107"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; KEGG:
FT                   fra:Francci3_2583 Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01508"
FT                   /db_xref="GOA:A0JR38"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JR38"
FT                   /protein_id="ABK01508.1"
FT                   /translation="MILSTQRLGRFMSPAPTPAPDAKPRTVLGYGSYAESLRIGEILRK
FT                   ETVGGALLVAAAVIALIWANSPVSDSYFALRDYKIGYEPWHLELSLGAWAADGLLAIFF
FT                   FLVGLELKREFVAGDLRQLNKSIVPVAAAAGGVLVPALIYAAVNIYSPETLRGWAIPTA
FT                   TDIAFAVAVLAIIGSHLPSALRIFLLTLAVVDDLIAISIIAFFYSSDIQAAPLLLALIP
FT                   LALYAFLAQRYRRFFGAHFMAAWAILLPLGIVTWALVHASGIHATVAGVLLGFAVPVLR
FT                   SKASGGPEAGPGLAEIFEHRFRPISAGVAVPIFAFFSAGVAVGGWEGLGSALADPVAIG
FT                   IIMALVLGKPIGIMGTTWILTKATRARLDGSFKWIDVFGVSLLAGIGFTVSLLVAELSF
FT                   GHGSLHDDHAKVGILAASLLAAILATVVLRARNRQYRRAEELEKVDSDQDGIPDVYQHE
FT                   SRG"
FT   gene            110943..112307
FT                   /locus_tag="Arth_0108"
FT   CDS_pept        110943..112307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0108"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein; KEGG: sco:SCO0618 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01509"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR39"
FT                   /protein_id="ABK01509.1"
FT                   /translation="MDVVVIETPQLGDRSYLVHDGTVGLVIDPQRDTDRVEAAAREAGV
FT                   TITHVAETHLHNDYVTGGLELAKSHAATYLVNAADPVQFEREAITDGQTVRVGTLTVRA
FT                   VATPGHTHTHLSFIVDDGDKQAVFSGGSLLYGSVGRTDLVAPSDTVGLTHDQYASVRRL
FT                   VAEARHDAALFPTHGFGSFCSSGPATRSGSSTVGEQLTANHALTDPDEDHFVQELIANL
FT                   SAYPAYYAHMGAMNAKGPGPADLAVPESVDPAELTRRLEDGEWVVDLRRRVAFASNHLK
FT                   CSVSFEYGSGSNFTTYLGWVLPWDEKLTLVGSRDDVEKAIRDLSRIGIDSPDAAVGTEP
FT                   GALAPDAAVDSYPRVGWDGLLAGRADGDTVLDVRRTDEFAASHVAGAVNVPVHQLLTRM
FT                   DEVPAGKLWVHCGTGYRAGVAASLLQRAGRDVVHLDARFEDAGKAGVPLEKGPSA"
FT   gene            112341..113348
FT                   /locus_tag="Arth_0109"
FT   CDS_pept        112341..113348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0109"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mpa:MAP0876c
FT                   putative fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01510"
FT                   /db_xref="GOA:A0JR40"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR40"
FT                   /protein_id="ABK01510.1"
FT                   /translation="MTMLTVIGEGLVDVVQRSSGIEAHVGGSPLNVAVGLARLDHPVQF
FT                   IGRFGRDAYGESVAAHLKSSSVMVPQGPDALPTSVATALIDDDGAASYTFDLAWELPGL
FT                   ADRLPFMLQGTTLVHTGSIATMLAPGAAEVLAAVEHAHPSATISFDPNCRPTIITDVDY
FT                   ARRQAEKFVSLADVVKASDEDLEWLYPGVDVLDSARRWLSLGGPGGPALVVVTRGAAGP
FT                   WGITAAGEAEFPAPKVEVADTVGAGDSFMAALISGLVDRGLDGAQNRKELRELPAESLR
FT                   ELLAHAAWAAAVTVSRPGANPPTRAELNHFELESLERNAALSGDDLRNADSASN"
FT   gene            113326..113868
FT                   /locus_tag="Arth_0110"
FT   CDS_pept        113326..113868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0110"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /note="TIGRFAM: YbhB and YbcL; PFAM: PEBP family protein;
FT                   KEGG: tfu:Tfu_2116 YbhB and YbcL"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01511"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR41"
FT                   /protein_id="ABK01511.1"
FT                   /translation="MPTPPATERQHMSSHHSPSLNVSSESFQDGQTLPPAQRSGKMRAG
FT                   GKDESPQLSWSGAPAGTKGYAVTVFDPDAPGRGGFWHWAVLDLPAGATSLPAGAGAEGG
FT                   RLLPAGALQLKNDGGFHGYLGAAPPPGHGPHRYIVTVYALDVEHLGLDAGFSPAKLEAK
FT                   LAGHVLGRGTLTGIFER"
FT   gene            113905..114723
FT                   /locus_tag="Arth_0111"
FT   CDS_pept        113905..114723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0111"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase, type 3; KEGG: sma:SAV4256
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01512"
FT                   /db_xref="GOA:A0JR42"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR42"
FT                   /protein_id="ABK01512.1"
FT                   /translation="MRLVASDIDGTILGHDGKISHRTIRAFHACRDAGVELVFVTGRPP
FT                   RWLHPLEDQLGHAGTVICSNGAVVWDLEAGRLVSARSLALDAVFEARRIIKQLRPSALF
FT                   AAETLTGFHLEPGFIENDSSELLSEFTPAPLASTLTPDDAVVKFLAIVREGTADDFLAE
FT                   VSPAVAHLASATHSAPTVAMLELALPGVNKAVTLAEYAATLGIDAADVVAFGDMPNDIE
FT                   MLRWAGDGYAMASGHPEAIRAAGQQAPHFDDDGVAQILEAKLAGLGVKPV"
FT   gene            114737..115519
FT                   /locus_tag="Arth_0112"
FT   CDS_pept        114737..115519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0112"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sma:SAV6927 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01513"
FT                   /db_xref="GOA:A0JR43"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR43"
FT                   /protein_id="ABK01513.1"
FT                   /translation="MTDSQPFFAAGSASARIAMAHRGFSPDGLENSMAAFRAAVELGYR
FT                   YLEMDVHTTADGVLLVFHDPSLDRVTDGQGRIARLPAGTVARARIGGVEPIPLFEEMVR
FT                   AFPDVRLNLDVKDWNSVTGLAAAIERYGVHDQVLIASFSDRRRRAVVKQLSRPVAASAG
FT                   MVSNALFTMLGPVLPGAVMRRLLRGVHALQVPVSYGGIRVVTPAFVRRAHRHGLQVHVW
FT                   TINDPAEMDRLLDLGVDGIVTDRADLLKQVLQDRGQWD"
FT   gene            complement(115516..117054)
FT                   /locus_tag="Arth_0113"
FT   CDS_pept        complement(115516..117054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0113"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: rfr:Rfer_2016
FT                   diguanylate cyclase/phosphodiesterase with PAS/PAC
FT                   sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01514"
FT                   /db_xref="GOA:A0JR44"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR44"
FT                   /protein_id="ABK01514.1"
FT                   /translation="MFTDGDPRLGKLLDGIVRLAAGELHSRIEVSPARDELDAVIMGTN
FT                   LLAEDLQIMYQELEQRVELRTRLLNEAHLEMQKMALTDSLTGLANRAALVSAINEALAE
FT                   TGQGGLPPALLLLDLDAFKGINDTLGHAAGDQVLAAVGERIKGSVRDTDTVARLGGDEF
FT                   AVLMPATTLARAASVGNRILASLDGQVELENDSVQCGASMGLCIGGTGQSAEQLLIEAD
FT                   VAMYASKAGGRNRLKVFEPAMLHARQLRSQLIEDLRTAISGSELVLYYQPVVDLTTGRI
FT                   EGAEALVRWKHPSRGMVMPDEFIPLAEDAGLISELGGWVLRTAVRQLRDWRAEGRAGDE
FT                   FSMRINISPTDLQRLEFIEEVRDALSEAELNPELLVLELTEGAIVSGNELDRYSLNSLR
FT                   KLGVGLEIDDFGTGYSSISYLRRLPVDKVKVDRSLLKDLGTDPAQPALIAAILQLIRAC
FT                   GLEAVWEGVENAEQAEHLASIGCVSAQGYYFGRPVPADEFAAVLDAQRASRHGG"
FT   gene            complement(117044..117403)
FT                   /locus_tag="Arth_0114"
FT   CDS_pept        complement(117044..117403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01515"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR45"
FT                   /protein_id="ABK01515.1"
FT                   /translation="MSKPLGLMQEQIVRIVLPRDEHLDEQSAQLLAAGLQAPQWGSPLA
FT                   VLMDVTDVASVSRAARAVFSNVSTVAAWALLGRTPVDRILAHFILGGDFKSGPASYFTS
FT                   ETDALKWLKETTHVH"
FT   gene            complement(117510..118538)
FT                   /locus_tag="Arth_0115"
FT   CDS_pept        complement(117510..118538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01516"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR46"
FT                   /protein_id="ABK01516.1"
FT                   /translation="MPSPRNLTPYVVAELQARESARNRDYAAAKAQAAAAAALALESGD
FT                   YSGWWNMIYLKAECLRDEGSISECLEIARSLAESPLSADHALLAARAYTLLAVAQQGLG
FT                   RLPDAVSSAAAAANLVAGDAEYVYLHVEAQRALIAALAESRRLDEAWEQCLLLEGLLTE
FT                   LVDEDTAGKAYWVIGNVAFLTGRVTDGGRYHDMAAESLSPSKDVDLWARFNRASAVMRL
FT                   EAELTEPATLRCIERAELATEVVGGSDRDLLEMSFARAHWNFLTGDMATAINMLRPLCT
FT                   EAGILATQTAGEASFLLGKSLLANGERDEALQRLADAAELFDNAAASERSAQVRAFAAD
FT                   VR"
FT   gene            complement(118906..120606)
FT                   /locus_tag="Arth_0116"
FT   CDS_pept        complement(118906..120606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0116"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region, ATPase
FT                   domain protein domain protein; histidine kinase A domain
FT                   protein domain protein; KEGG: sth:STH749 two-component
FT                   sensor kinase, probably involved in phosphate sensing"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01517"
FT                   /db_xref="GOA:A0JR47"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR47"
FT                   /protein_id="ABK01517.1"
FT                   /translation="MRATHVTLQCTQPGTEGGSVVIQTAENSLVPRTAIVADPDSGRLS
FT                   ATAGVLVAAGFEVSTASSHEILTGLLEQHKPSIIVADHSFGGPPVDAPLLLLVDLADES
FT                   AAESLRTLGMADYIAKPAAPDELVHRADVLISRAAQRSDARQSAERLREKLRLVSSNIR
FT                   ATHDPRLISDCLVTGFGETFGADRVLFTTFDDDRVPRISAEWHRPGLPPVPDGLGLQES
FT                   SAHRVADRLWSEAEVLAVEDHHVHEWSPEDQELAAWSEDMGPWASAFVPVGEGKSSLGV
FT                   IWIAQLDEPRVWTRTEISLIQHVAGNVAYGLIQSHLMSAQQQVVKQLRQLDQAKTDFLA
FT                   TVNHELRTPLTSISAYLDMIQDGVGGPVPPEVSRMLDIIVRNSERLRRLIEDMLTVSRQ
FT                   DYDGANLHLGPVQLGHTLQIVTVALRPLAELGDVSISLELCDGDPAIIADEVQLEQVFT
FT                   NLVSNAIKFTPRGGRIVVSCRFQAMTDGEPGVNVHVRDTGVGIPEEEIPHLFTRFFRAS
FT                   NATSTAVPGSGLGLAIAHDIVKSHRGYLAVSSELGAGTTITVQLPVSGP"
FT   gene            120645..121016
FT                   /locus_tag="Arth_0117"
FT   CDS_pept        120645..121016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01518"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="PDB:3BL4"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR48"
FT                   /protein_id="ABK01518.1"
FT                   /translation="MSGDSEVGTEAGLTLGGDGILRLTWPRGAAITAADAERAMLRVNQ
FT                   LCGDDRHPMLVDMATTADVSRGARAVFGRPCQASRIALLGSSPVDRVLANFFLGINAVP
FT                   CPTKFFTSERDALTWLALT"
FT   gene            121070..121891
FT                   /locus_tag="Arth_0118"
FT   CDS_pept        121070..121891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0118"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sco:SCO6485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01519"
FT                   /db_xref="GOA:A0JR49"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR49"
FT                   /protein_id="ABK01519.1"
FT                   /translation="MLAALKKYLLVPKLMRLSAGAPRDHHIAWDRFWSNVKTTGASGDV
FT                   LWDSGSDHEMQGYVDRLRLHLDPGLPIVDIGCGNGSFTRQLAGHFPHAVGVDVSAHAVR
FT                   RARAETAGLANISYAVADMTASGAGSGLLEELAVLDTGGQAGGGANVFIRGVLHVLGER
FT                   DQHALAENARAITRANGRVFLAETNFRGNAVDYVTHLGATLRSIPAPLEGAIRGLPMPG
FT                   RFGPKERSLAFPASRWELIEEGPTTIETMPLSNPARSDLIPGYFAVLEGRN"
FT   gene            complement(122165..123139)
FT                   /locus_tag="Arth_0119"
FT   CDS_pept        complement(122165..123139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0119"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; KEGG:
FT                   xcb:XC_3173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01520"
FT                   /db_xref="GOA:A0JR50"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR002961"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR50"
FT                   /protein_id="ABK01520.1"
FT                   /translation="MSTPHSKPSAQPVTPTLLRDWPLPGGGSGKDDRGSVLVIGGARKT
FT                   PGAALLAGTAALRAGAGRLTLAVAGSTAVQVAVALPEAGVVGLAETDEGAVEGSGVSVL
FT                   AEELDKAAAVLVGPGLDDMDEAESLLRELLKLDSGNAGGDGRNPGGSASRPALVLDAYA
FT                   LGCLPGLLGELGPWAGRLILTPNVTESGVLLGREVEDLHRDVAEIARRYGAVVSCQGVI
FT                   ADPGPGGKEGGSPGNAPGTGNIQLWEITTGYGGLGTSGSGDILAGTIAGLRARGTSDAQ
FT                   ATCWGTHLHAAAGDRLASRFGSLGYLARELADELPALMMELGT"
FT   gene            complement(123123..123911)
FT                   /locus_tag="Arth_0120"
FT   CDS_pept        complement(123123..123911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0120"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: nar:Saro_0181
FT                   phosphoglycerate/bisphosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01521"
FT                   /db_xref="GOA:A0JR51"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR51"
FT                   /protein_id="ABK01521.1"
FT                   /translation="MPQSYDRNSSRRGPTGTGLTELVLVRHGESAGNVAATMARQAGAH
FT                   VIDVPARDADVELSATGRDQALALGRLFADFPEDQRPAGVWSSPYVRARQTAELAVKTG
FT                   GWPAGILIDERLRDRELGILDMLTSAGVEARLPEEAARRRWLGKFYYRPPGGESWADVV
FT                   LRLRSLLADLERQPGGGRIMLVCHDALILLFRYILEGLTEPELLDIAATSTILNASLTR
FT                   FVRPDGAGPWILESFNMADHLVSEGVPVTEHAGDANVHPA"
FT   gene            124103..124354
FT                   /locus_tag="Arth_0121"
FT   CDS_pept        124103..124354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO7330 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01522"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR52"
FT                   /protein_id="ABK01522.1"
FT                   /translation="MSTYHPENDPSNPDRPGSAEAASGRPETDKTEAKDRASKDPAATA
FT                   NPDPLEGNITGLEPGGGVPPGETPPAEDSMSGDQGHEE"
FT   gene            124389..125195
FT                   /locus_tag="Arth_0122"
FT   CDS_pept        124389..125195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0122"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; Thioesterase; KEGG:
FT                   noc:Noc_1448 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01523"
FT                   /db_xref="GOA:A0JR53"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR53"
FT                   /protein_id="ABK01523.1"
FT                   /translation="MKGAVTTDVEAGGLRGRMYASRATSDVRPRADAPTFVLIHGIGVS
FT                   HRYLVRLHHVLAGVADTISIDLPGFGSTPRPDRQLMVADQAAFIHDVLDQAGVGLRVLV
FT                   GHSMGAQFVLEAALQRPEQVPHVVLMGPVVDVRRRTLPRQILALTKDALLHETPGSNAL
FT                   VFSDYLRCGPLWYLKELRVMMNYRTEERIRGLTTPVMILRGASDPIATGEWCRILARRA
FT                   PAGTLVEVPGCGHVVQHTGTAQVADAITGFTGLPGSGAPEQTVNRQ"
FT   gene            125280..126404
FT                   /locus_tag="Arth_0123"
FT   CDS_pept        125280..126404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0123"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="PFAM: glycerate kinase; KEGG: sth:STH2490 glycerate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01524"
FT                   /db_xref="GOA:A0JR54"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR54"
FT                   /protein_id="ABK01524.1"
FT                   /translation="MRILIAPDKFKGSLTAAEAASAIAEGALRVYPDAVATQFPVADGG
FT                   EGTLEAAVAAGYEERLNAVVGPILAPIGAAWALRKDAFGGATAVIETAQASGLAHMEPT
FT                   PANALRAHSYGCGQLIAAALDAGASEIVLGVGGSAMTDGGSGALRALGLKPLDAAGNVV
FT                   PLGGGSLVDVVDVDVSGLDPRLGSVKFRIAVDVQNPLFGSDGAAHVFGPQKGADADAVE
FT                   LLDAGLRNWGSVLRQATGRDVNVPGAGAAGGFPASFLAFSGATLEGGFALVAGLTGLAG
FT                   QLAEADLVITGEGSMDSQSLTGKAPIALADAARERGIPVIVVAGRILVTPEDLAEHGVV
FT                   AAAQLLDVATSPEDAIANAAKYLTWATSQVLEGA"
FT   gene            complement(126426..127088)
FT                   /locus_tag="Arth_0124"
FT   CDS_pept        complement(126426..127088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01525"
FT                   /db_xref="GOA:A0JR55"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR55"
FT                   /protein_id="ABK01525.1"
FT                   /translation="MKKWVKEHGLMLANIGLFALFFSGMIVSGASDYSEDQLAHGQPAV
FT                   GIAGYLATGAFLEATFENWESEFLQMGMYVILTVFLFQKGSSESKPMDRTAPQDQDPRN
FT                   ATVKASTPWPVRRGGVVLKLYEHSLSIMFLLLFLASFTLHAVGGSEEYSQEQQSHGQPG
FT                   VTLLGYLATSRFWFESFQNWQSEFLAVAVLVGASVYLRERGSPESKPVAEPHYETGA"
FT   sig_peptide     complement(126996..127088)
FT                   /locus_tag="Arth_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.583 at
FT                   residue 31"
FT   gene            complement(127146..127637)
FT                   /locus_tag="Arth_0125"
FT   CDS_pept        complement(127146..127637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01526"
FT                   /db_xref="GOA:A0JR56"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR56"
FT                   /protein_id="ABK01526.1"
FT                   /translation="MSEGDAVVGDGRNESVNQQMDRNWGELIQELRVLQTGVQILAGFL
FT                   LTIPFQERFKTLDDYQVGLYLANVILAALTTAVILLPVSVHRRLFRKQLKKTLVSSADR
FT                   IAKVALTGVALLSAGTASLVFDVTAGRDAGLLAGGGLLAAMVLLLVLVPNWLLKRASKV
FT                   "
FT   gene            127852..128748
FT                   /locus_tag="Arth_0126"
FT   CDS_pept        127852..128748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0126"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   Insect alcohol dehydrogenase family; KEGG: atc:AGR_pAT_398
FT                   hypothetical oxidoreductase IN CITA-SSPB intergenic region"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01527"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR57"
FT                   /protein_id="ABK01527.1"
FT                   /translation="MTDNKKDHQPRDPRTGYHEGPFPEQVQEQPGLTAPMEPQPDHGEE
FT                   SYEGSSALTGKAALITGGDSGIGRAVAIAFAREGADVAISYLPEEEADAQDTAAWIRKA
FT                   GQRALLLPGDGRSEEFSTRIVADTLAEFGRLDVVVLNAAYQKNRDSFETLPTEEFDRVF
FT                   KTNLYSLLWTARAAVPHLKAGASIITTASIQAFNPSPGLIDYAMTKGAQVAFTKALAQE
FT                   LGPKGIRVNAVAPGPIWTPLIPATEWPEKLPKFGQDTPLGRAGQPAELAAAYVLLASDH
FT                   GSYISGAVLPVTGGKGL"
FT   gene            128798..129334
FT                   /locus_tag="Arth_0127"
FT   CDS_pept        128798..129334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01528"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR58"
FT                   /protein_id="ABK01528.1"
FT                   /translation="MTQENQGTPIEEEGGYGTPTVEQEMGGADTKKFAQPREEEAFDAA
FT                   GLSQDSPDGETYPAGVPDLSQFGAEDQDSAGEPGAGRFGGTEDQMNAENESADPGFEPE
FT                   NTEPENTGQSAEGDVAVPSADAEMDESNTEDPDAGRPFSSEPNPDAAGIPDGSGTDLPD
FT                   SKAPKDRGDDSFDAG"
FT   gene            complement(129394..130812)
FT                   /locus_tag="Arth_0128"
FT   CDS_pept        complement(129394..130812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0128"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM: Benzoate
FT                   membrane transport protein; Xanthine/uracil/vitamin C
FT                   permease; KEGG: lxx:Lxx08910 xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01529"
FT                   /db_xref="GOA:A0JR59"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR59"
FT                   /protein_id="ABK01529.1"
FT                   /translation="MLLRKIPSPLPTPIFFERLPAMSMLGTKWKLHGNGKSVRPGEVVA
FT                   PGERLTWPLTIGVGMQHVVAMFGATFLVPIITGMPPATTLFFSGIGTLLFLVITQGRVP
FT                   SYLGSSFAFIAPIMASQQQFGIPGALGGVVLAGAGLAVIGAVVQKFGAGWINRLMPPIV
FT                   TGAIVALIGLNLAPAAKNNFDAAPVTAAITLATIILVSVLFKGILGRLSILVGVVVGYL
FT                   VAMIRGEVDYAKMDAAAWVGLPHFQTPEFHLGVVGLFVPVVLVLVAENIGHVKSVSAMT
FT                   GQNLDGVSGRALMADGAATVLAGFGGGSGTTTYAENIGVMAATKVYSTAAYWVAGIFAI
FT                   VLSFSPKFGELIATVPPGVLGGAATMLYGMIGILGVKIWVQNKVNFSNPVNLTTAAVAL
FT                   IIGIANYTWTIGELTFTGIALGSAAALVIYHGMKAIAKARGSVAEPETEQAGLPPAVKA
FT                   AINAAAKRTPKKRP"
FT   gene            130956..131561
FT                   /locus_tag="Arth_0129"
FT   CDS_pept        130956..131561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0129"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: sco:SCO5049 putative
FT                   NADH dehydrogenase/NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01530"
FT                   /db_xref="GOA:A0JR60"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR60"
FT                   /protein_id="ABK01530.1"
FT                   /translation="MTIAHEEAVIDAAAVDAIFAEARTANTFTGEVTDEQARAIYELTK
FT                   FGPTAFNSQPLRVTYVRSDEARAQLVAALSSGNRAKTASAPLVAVLSYDTAWQDQWDNF
FT                   LPGYNAPKAMYDAAPELAAITGNNNAHLQAGYFILAVRSLGFAAGPMTGADFSAIDAAF
FT                   FPAGDQKSFLVVNIGQPGPDAWGAAKPKFAYEDVVRTV"
FT   gene            131798..132340
FT                   /locus_tag="Arth_0130"
FT   CDS_pept        131798..132340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01531"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR61"
FT                   /protein_id="ABK01531.1"
FT                   /translation="MRNLILVAFTEPVSDGLVFPRDDWPLHITLVRFDVEMKSGDAGTG
FT                   GEVGNGGGGGHVAGLDDRIAGLIDEPVRAALGSRLTIGEDAGFGRQESVPVSLVEPSRP
FT                   LQDLHESLVGTVMGLPGRVPTPHHILENYRPHVSHHGDKRPRPGDVVVLDRVALVDMAP
FT                   DGNHSVRRILHLWELTK"
FT   gene            complement(132330..133979)
FT                   /locus_tag="Arth_0131"
FT   CDS_pept        complement(132330..133979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0131"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /note="TIGRFAM: phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: sco:SCO7443 phosphoglucomutase."
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01532"
FT                   /db_xref="GOA:A0JR62"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR62"
FT                   /protein_id="ABK01532.1"
FT                   /translation="MASRAGTVAQPQDLVDLTALLDAYYDVSPDLSDPGQRVAFGTSGH
FT                   RGSSLKASFNEPHIVAITQAIVEYRAGQGITGPLYMAKDTHALSEPAQNSALEVLAANG
FT                   VNVLIDARHGYTPTPSLSHAILTHNRNAPAGAPQADGIVVTPSHNPPGDGGFKYNPPHG
FT                   GPADTDATGWIANRANELLENGLRGVKRIPVADALAAETTGKFDFLSSYVDDLPSVLDL
FT                   NAIREAGVRIGADPMGGASVDYWGEIGERHHLNLTVVNPTVDPQWAFMTLDWDEKIRMD
FT                   CSSPSAMASLINRMSSGANFDVATGNDADADRHGIVTPDGGLMNPNHYLAVAIDYLYRH
FT                   RTGWNPQSVIGKTLVSSSIIDRVAESLGRKLVEVPVGFKWFVPGLLSGEGAFGGEESAG
FT                   ASFNKMDGSVWTTDKDGILLALLASEITAVTGKSPSQLYKGLTDQFGDPVYARIDAAAT
FT                   REQKAALGKLSPSDVTATELAGETITAKLTEAPGNGASIGGLKVVTENAWFAARPSGTE
FT                   DVYKIYAESFKGADHLKQVQAEAKALVDGVIS"
FT   gene            134244..135059
FT                   /locus_tag="Arth_0132"
FT   CDS_pept        134244..135059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0132"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: fra:Francci3_4504
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01533"
FT                   /db_xref="GOA:A0JR63"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR63"
FT                   /protein_id="ABK01533.1"
FT                   /translation="MAAGEGASEQSRLAAERIARLKRQLDHAERAAETWGAGAEGERRT
FT                   AGRLGRLTPDGWFMLHDVHWPGRPLANLDHVLVGPGGVVVVDAKNWSGTVEVRDGILRQ
FT                   NGYSRNPAVEGALGQAAAVAALLGAPHRRLVRSIICLTGHPDFAEVTESGIEVLGINRV
FT                   VARIAALPAVLDPQTVVGLYSHLGQQLTQPQAPAVPDVRGNAARHPAPRPYQRGAYPSP
FT                   VPARVGYRSAASPPQLGNQASAGKLAAFLWSLLVLGIVAFSLSAPLWSR"
FT   gene            135156..135647
FT                   /locus_tag="Arth_0133"
FT   CDS_pept        135156..135647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0133"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: lxx:Lxx19900 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01534"
FT                   /db_xref="GOA:A0JR64"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR64"
FT                   /protein_id="ABK01534.1"
FT                   /translation="MTNQPAPGDEGTPQGYQPPSYIPPQGSQPVPPGAPYGEQPGFGQQ
FT                   PGPYGQPGYGQPEYGQQPGPYGTAYGQPSYYGMPPEPKGLSIASLCCGIAVFLGLGLFI
FT                   LPQLAAVILGHLALLREPAGRGLAIGGLVLGYIGLALTAIVLTFAVAAIFAAANAGYGY
FT                   "
FT   gene            complement(135687..137156)
FT                   /locus_tag="Arth_0134"
FT   CDS_pept        complement(135687..137156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0134"
FT                   /product="amino acid/peptide transporter"
FT                   /note="TIGRFAM: amino acid/peptide transporter; PFAM:
FT                   TGF-beta receptor, type I/II extracellular region; major
FT                   facilitator superfamily MFS_1; KEGG: lxx:Lxx02570 peptide
FT                   transporter, PTR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01535"
FT                   /db_xref="GOA:A0JR65"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR65"
FT                   /protein_id="ABK01535.1"
FT                   /translation="MSTTHLSDRPATTPGDTSFFGHPKMLASLFSVEMWERFSFYGMQG
FT                   ILLYYMYFTAAQGGLEIEQGLAAGLVGAYGGGVYLSTILGAWLADRLFGSERVLFGSAV
FT                   LIMAGHIALALVPGIPGLIAGLVLVGVGSGGLKANATALVGTLYGEKDERRDAGFSIFY
FT                   MGINAGALIGPLVTGWLQESRGFHWGFGAAAVGMALGLGIYAMGRGKLPEAAHHVPNPL
FT                   PAAQRTRYGLIFLGIAAVVAVLLATGAVNAENLAMSMAYAAIGASVLYFGLIFSSRKVT
FT                   GVERKRVVAFIPLYIASAAFWALFQQQFTFIAVYSEEKLDRNLFGWEMPAAWVQSINPV
FT                   FIIIFAGVMAALWTRMGNKQPGSALKFSIGLFVMGLAFLAFIPLAGSGKTPLLALVGIL
FT                   FLFTLAELFLSPIGLSVTTKLAPQAFHTQMVALFFLSVSLGTTLAGILSGLYNPDDELP
FT                   YFTGIGGTAMVLAVGLAAASPAIKKLMAGVR"
FT   gene            complement(137228..138640)
FT                   /locus_tag="Arth_0135"
FT   CDS_pept        complement(137228..138640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0135"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: tfu:Tfu_2207 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01536"
FT                   /db_xref="GOA:A0JR66"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR66"
FT                   /protein_id="ABK01536.1"
FT                   /translation="MADIHELSAVGLRDALHSGGLSAREVTEHFLARIEALNPGLGAFI
FT                   TVTGEQALADAADADARYARSAGQLPLLHGMPVAFKDLTDVAGVVTTHGSAALEHKPAS
FT                   VDGALAAVLRGAGAISLGKTQVPEFGLTAYSENLIAPPSRNPHALSRSSGGSSGGSAAA
FT                   VAAGLVPFAPGSDGGGSVRIPAAACGLVGLKPGRGLVPAGESTGDPARLVVAGPLARSA
FT                   GDAALMLDALVAEPEADGYLASVSRPPGPLRIGVSLDSPWQAIFPFTPAAEAMDALNEG
FT                   VRLLEAAGHSTAEAAVRYDNRYPDAFTTAWTAGVGSARIAPQREALLTPLTRTFRRRAQ
FT                   QRSASKLNEALGFLRQFERDTVAQYAQWDLMLMPALAQTPRPVGWFTGASHGDGYWPAS
FT                   EWAGDADGDYRKQCEYAPWSSMVNVCGLPAISIPVHWTGGLPGAGLPMGIQLVGPAGSE
FT                   KVLLQVAAQIGF"
FT   gene            complement(138633..139376)
FT                   /locus_tag="Arth_0136"
FT   CDS_pept        complement(138633..139376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0136"
FT                   /product="peptidase S51, dipeptidase E"
FT                   /note="PFAM: peptidase S51, dipeptidase E; KEGG:
FT                   sco:SCO7439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01537"
FT                   /db_xref="GOA:A0JR67"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR67"
FT                   /protein_id="ABK01537.1"
FT                   /translation="MAAQQPTILATSGGYKAGRRSRLEFDALLHHAVELSGVTGRAPRV
FT                   THIGTAAGDQRSFNAELDQAAKIAGFDFSHLNLFTMPSIDDPEAHLLEQDVVWVNGGSV
FT                   VNLLAVWRAHGLDGILRRVWEAGVVLAGVSAGSICWFQGGTTDSYGPQLRPVTNALGFL
FT                   PYANGVHYDSEVQRRPLVHRLVADGTLGETHCTDDGAGLVYFGTHLAEAVTEVRGKAAY
FT                   RVTRHIQGGGAATAAEERLEARFLG"
FT   gene            139489..139815
FT                   /locus_tag="Arth_0137"
FT   CDS_pept        139489..139815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0137"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: cjk:jk0272
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01538"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR68"
FT                   /protein_id="ABK01538.1"
FT                   /translation="MSDFETVTVTDVPADARILDVREDYEWSAGHAEGALHIPLDQLPA
FT                   RLGELDPDEDVYVICRTGGRSFRAAKWLVGQGYSAFNVAGGMDQWLESGLPLVSDNGLK
FT                   PVIL"
FT   gene            139898..140881
FT                   /locus_tag="Arth_0138"
FT   CDS_pept        139898..140881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0138"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: lxx:Lxx02400 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01539"
FT                   /db_xref="GOA:A0JR69"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR69"
FT                   /protein_id="ABK01539.1"
FT                   /translation="MPAQPVTYTFLGPEGTFTEAALMQVPGAGEAVRIPSSNVNTALDK
FT                   VREGSADAAMVPIENSVEGGVTATLDAIASGAELRIVREALVPISFVLVSRPGVEIEDI
FT                   RRISTHGHAWAQCRLWVEANMPDVEYIPASSTAAGAMGLLDEGGAHYDAAICAPIVATE
FT                   QPGLHVLAENIGDNPGAVTRFVLVSRPGALPHRTGADKTTVVVPLPEDRPGALMEILDQ
FT                   FATRGVNLSRIESRPTGQYLGHYFFSIDADGHVEDARVADALAGLHRISPATRFLGSYP
FT                   RADAQSPDVAQHTSDEAFQAAHEWVAGILKGASIEPVHAPQGSPTA"
FT   gene            complement(141220..142314)
FT                   /locus_tag="Arth_0139"
FT   CDS_pept        complement(141220..142314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0139"
FT                   /product="diacylglycerol kinase, catalytic region"
FT                   /note="PFAM: diacylglycerol kinase, catalytic region; KEGG:
FT                   lxx:Lxx21980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01540"
FT                   /db_xref="GOA:A0JR70"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR70"
FT                   /protein_id="ABK01540.1"
FT                   /translation="MNDWLLYLILAAALAFAVSSWWGVRRLKALHTRSAVQEDTHHPGM
FT                   AQQKVAVVMNPVKAKSSEARALIQRACLSAGWEAPLFFDTTAEDPGYAQAEAAVASGAD
FT                   VVLVGGGDGTVRVVAEKLARTNVPMGLVPLGTGNLLARNIHLDVNDLHGSIQTALFGHQ
FT                   RHIDTARMGIRNSRTGASSEHAFLVIAGMGMDAEVVGDTNDGLKKAVGWLAYTEAGVRH
FT                   LPGRRKKVSIALDDQPEQSRKIRSVLFANCGLIPGGIDFIPQAMIDDGMLDVVVMSPRS
FT                   AIGWIAMYTKVMFKHKGNLPVMSYYRSGKIVIKCAEPVATQVDGDPCGEATDVTVQVEP
FT                   RSLLVRVPERKGGETPAREASAPH"
FT   sig_peptide     complement(142252..142314)
FT                   /locus_tag="Arth_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.555 at
FT                   residue 21"
FT   gene            142404..143684
FT                   /locus_tag="Arth_0140"
FT   CDS_pept        142404..143684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0140"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: nfa:nfa1400 putative seryl-tRNA synthase;
FT                   TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA synthetase,
FT                   class II (G, H, P and S); seryl-tRNA synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01541"
FT                   /db_xref="GOA:A0JR71"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JR71"
FT                   /protein_id="ABK01541.1"
FT                   /translation="MIDVKDLSENPDKFRASQRARGADESVVDAIISADAARRAALIRF
FT                   ENLRAEQNAFGKKVAQAKGEEKQALLAEVKVLAASVKAASAEADVAQAQQEELLRAIPN
FT                   LIVDGVPEGGEDDYIVVKTVGEPREFPDFEPKDHLEIGELIGAIDMERGAKVSGSRFYF
FT                   LRGVGARLEMALLQMAMEQAIDAGFIPMITPTLVRPETMQGTGFDVKHDAEIYRLAEDD
FT                   LYLVGTSEVALAGYHADEILDLSAGPIRYAGQSSCYRREAGSHGKDTRGIIRVHQFNKV
FT                   EMFIYTTVEEAAAEHERLLAWEEEMLAKCELPYRVIDTAAGDLGNSAARKFDCEAWVPT
FT                   QGAYRELTSTSNCTTFQARRLNIRERVLNEDGAPKGTRAVATLNGTLATTRWIVAILEH
FT                   HQNEDGSVNVPRALQKYLGGLEVLPVL"
FT   gene            143817..144671
FT                   /locus_tag="Arth_0141"
FT   CDS_pept        143817..144671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0141"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase, type 3; KEGG: lxx:Lxx02360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01542"
FT                   /db_xref="GOA:A0JR72"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR72"
FT                   /protein_id="ABK01542.1"
FT                   /translation="MTETSVAGNDDQRNNGKNDPAQKLMVALDVDGTLVNHDGHMSAPV
FT                   RDAAQAVVAAGHEVLIATGRSLNATLPIIEQIGIDTGYAVCCNGGVTLRLDPAHPDGYE
FT                   VIRKATFDPGPALRALRKRLPLAKYALEDEHGNFLSTERFQDASFGVEAIGVDFQTMLD
FT                   ATAVRVVVFSSENTSEEFNEAIKHIGLSGVTYSVGWTAWLDIAAEGVTKASALEHLRGH
FT                   LSIESHLTVAIGDGRNDIEMLTWAGRGVAMGQAPDEVLAAADEVTMSVHDDGAAHVLRS
FT                   LLS"
FT   gene            complement(144715..145314)
FT                   /locus_tag="Arth_0142"
FT   CDS_pept        complement(144715..145314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lxx:Lxx06130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01543"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR73"
FT                   /protein_id="ABK01543.1"
FT                   /translation="MFTLTINQTDSRRDGDRVPQLLKDLRHIPARLDFDRSVEDEVQGI
FT                   VEFPQQAVEAALIALRCGSWFVGIGVGPVNEPLPNQIKDATGHGLIYARRAVDRLRNGK
FT                   ERVPVAVDGPFADLAAEAEAVLKLLGHIVHDRSAAEWRVLDLLTPGVRGQQKAVAHELG
FT                   ITTQAVSKAVARAQWNEEHAARPAAARLLQLILEVR"
FT   gene            145493..147928
FT                   /locus_tag="Arth_0143"
FT   CDS_pept        145493..147928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0143"
FT                   /product="Fructose-6-phosphate phosphoketolase"
FT                   /EC_number="4.1.2.22"
FT                   /note="PFAM: D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase; KEGG: mpa:MAP1573c putative
FT                   phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01544"
FT                   /db_xref="GOA:A0JR74"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR74"
FT                   /protein_id="ABK01544.1"
FT                   /translation="MANALGGDTVSDTTTNDVRTEVDSSDLGLVHRWWRAANYLSVGQI
FT                   YLRSNPLLREPLRAEDTKSRLLGHWGTTPGLNFVYAHLNRVIRRDRQEMLFIAGPGHGG
FT                   PAVVANAWLEGTYSEIYSNVGNDEAGLAELFRQFSYPGGIPSHAAPETPGSISEGGELG
FT                   YSLAHAYGSVFDNPKLITAVVIGDGEAETGPLAASWHSHNFLDPVADGAVLPILHLNGY
FT                   KIANPTVLARMPEAQLEQLLRGYGHTPHFVTVEDPDDFEGAHRDFAAAVDTCLAEIRAI
FT                   QAERRAAGTPSADEAGAPQWPMIVLRSPKGWTGPKQVDGKQVEGTWRSHQVPLSEVRTN
FT                   PEHLAQLEQWLQSYRPEELFDDGGRLRPDVAQNAPAGELRMSATPYANGGILLRDLKLP
FT                   DYRKHAVEVPRPGVERVSAMLTLGGWMRDVIVQNPETFRLFGPDETASNRLQDVYDVTD
FT                   KVWQYRIDDADEHLARAGRVMEVLSEHLCQGWLEGYLLTGRHGVFSCYEAFIHIVDSMF
FT                   NQHAKWLKVHRELAWRQPVASLNYVLSSHVWQQDHNGFSHQDPGFIDHAVNKKAEVIRV
FT                   YLPPDANTLLSVMEHCLASRDYVNIVVSGKQPSPTWLGPADAAHHCQRGLGIWEFAGSE
FT                   VPGEEPDVVLACAGDVPTVETVAAAELLKNGAPGLKIRVVNVVDLMRLQDASEHPHGLT
FT                   SRDFDGIFTADKPVIFAYHGYPSLIHRLAYRRTNQEGLHVRGYKEEGTTTTAFDMAMLN
FT                   GIDRFQLAIDAIDRVPGLAERHSLLRQSLQDSRIRAHNHTRSHGEDQAEISDWTLGGG"
FT   gene            complement(147934..148677)
FT                   /locus_tag="Arth_0144"
FT   CDS_pept        complement(147934..148677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01545"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR75"
FT                   /protein_id="ABK01545.1"
FT                   /translation="MGVDLAAATRKTAAAVLDWTHGGARLIHLSLDVTDEDIVELFGST
FT                   DMTGIDCPVGWPDAFLPFIAGHLNSDARPVLDHDGIEGRRLLAYRDTDRFVTGATGLIP
FT                   LSVSAGRLAHPAMRCAVIQAKIARDYGPQARDGSGRLAEVYPAASLKLWGIHARGYKGR
FT                   GTPEAERLALILDSLAQAAPWLDLAGHGEALAASDDMFDAVIAALTARAVSLGQTLMPP
FT                   VDHAAAALTEGWIHVPSGPLAALTG"
FT   gene            complement(148690..150027)
FT                   /locus_tag="Arth_0145"
FT   CDS_pept        complement(148690..150027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0145"
FT                   /product="Carboxylesterase, type B"
FT                   /note="PFAM: Carboxylesterase, type B; KEGG: nfa:nfa52210
FT                   putative carboxyesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01546"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR76"
FT                   /protein_id="ABK01546.1"
FT                   /translation="MNAPAVSPPCFSPPCGPVTGWRDGDVVRATGIPYATAGRFQPPAS
FT                   APDWTEVRAATSLSPACPQGPVPFLDDILGTRYGELPGSEDCQRLSITIPADLADGERV
FT                   PVMVWLHGGSYTSGSGDLAIFDPKALVAENRVIVVSVTYRLGLFGYLATGTGRPANLGL
FT                   LDQLEAFRWVQRNIGAFGGDPERVTAFGQSAGGDAVAHLMATPEAPSLFQRAIIQSAPL
FT                   GITRGREKMSAAMGVAAEHVTEDTPAMDVVAIEGRVSQVARKFGLKAAMPFGTQYGHAP
FT                   LPPEHEIEAAWNAAAPGIEVLIGHTADEARMFLPGNPAASRLARVPVVGTAVVDAISRA
FT                   VTEAVYGRSARKFARRHARAGGKAYSYVLTWAAPGNFFGAAHTVDLPLLFGDQQTWAGA
FT                   GLVAGASWDEINAQGRALRAVWARFASGEGLGNGGELPGALRYRPV"
FT   gene            complement(150191..150679)
FT                   /locus_tag="Arth_0146"
FT   CDS_pept        complement(150191..150679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0146"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: nfa:nfa3850
FT                   putative inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01547"
FT                   /db_xref="GOA:A0JR77"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR77"
FT                   /protein_id="ABK01547.1"
FT                   /translation="MKHDVTIEIPKGSRVKYEVDHETGRVRLDRVLFTSMQYPTHYGFF
FT                   ENTLGEDGDPLDALVLLQDFDLHPGVIVEARPIGVFNMTDDGGGDAKVLCVPTDARFDH
FT                   IKEVSDVSEYLIKEIEHFFTRYKDLEPGKWVKAEGWGDRAAAEAELEASIKRYVPASH"
FT   gene            150831..152303
FT                   /locus_tag="Arth_0147"
FT   CDS_pept        150831..152303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0147"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13, D-Ala-D-Ala carboxypeptidase C; KEGG:
FT                   fra:Francci3_4311 D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01548"
FT                   /db_xref="GOA:A0JR78"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR78"
FT                   /protein_id="ABK01548.1"
FT                   /translation="MKRMMSRAATHPWFENIRRQLPLALLTILIVALAVPAAMLVAPAL
FT                   TGQSPNPESTASAVPAWQQVPRDLSLPQGISPLKDSAPVPWPDKLAAQLNATLKTDGSG
FT                   SFAGVVQDAATGQVLFDRDGSNGRVPASNMKLLTAAAALRAVGPDQRFSTTVVAGVEAG
FT                   SVVLTGGGDVLLGTGESSRDAVMGHAGLATLARLTVKSLQENGVKGPVQVRLDDSLFTG
FT                   PALNPTWSPDDVAAGETAPLFPLALNSARYDPAVTTGPRPQDAAMSAAEAFSAQLTAAG
FT                   AAAGLSVAPGVERAKAPETGKVLAEVQSATLRQQVDLMLQTSDNYLAEVLGRLAALATG
FT                   QPGSNDGATSTVYKQVQDLGIPTDGLRVADVSGLSLGNQVSAGQLSEIVRAITSGTEPS
FT                   LRAAIGGFPVAGLTGTLGSRYTDASTEGGAGLVRAKTGTLNSVIALSGYVVDADGRLLV
FT                   FSFIGNGLEPGAAGNRTALDRTASALASCGCR"
FT   sig_peptide     150831..150971
FT                   /locus_tag="Arth_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.628 at
FT                   residue 47"
FT   gene            152412..153539
FT                   /locus_tag="Arth_0148"
FT   CDS_pept        152412..153539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01549"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR79"
FT                   /protein_id="ABK01549.1"
FT                   /translation="MDAMESTAGDSSVQAQALINWELAASTAARLAPAGPSLGSAEIGT
FT                   AVENLRLMADISVPHVHDITGLEAARDLRDSSVLVVDRASWAKANTQSFTVMLKPAMEK
FT                   MLEGRRGTMSPGAASVSGAITGSQLGAVLAFLSSKVLGQYDPFSALAEDSTAPAGGRLL
FT                   LVAPNIVQVERELNVAPEDFRLWVCLHEQTHRVQFAAAPWLRHHMLNEIDNLSEHLLGN
FT                   VDTLLERASAAAKSLKDRTAAGTAPGRGAILDLLQDPEEKASLSHLTAVMSLLEGHANV
FT                   VMDAVDASIVPSVKTIRQRFNARGKDRGVVEKFIRSLLGLDAKMRQYTDGAKFVRAVVD
FT                   VAGMEGFNRVWESAANLPTEPEIHDAKLWLERMGL"
FT   gene            153540..154670
FT                   /locus_tag="Arth_0149"
FT   CDS_pept        153540..154670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0149"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: fra:Francci3_4313
FT                   hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01550"
FT                   /db_xref="GOA:A0JR80"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR80"
FT                   /protein_id="ABK01550.1"
FT                   /translation="MSHAPSGRRRPGRLPPVVGKARKMLQNALAEAGYPERVLVACSGG
FT                   PDSLALAAVASYFGRRGHVDGHPVSVGAVVVDHQLQPGSAAVAAQTADVLRDLGLSPVD
FT                   VRQVDVASTGIGPEAAARDARHAALEEAAAQAGANVILLGHTLDDQAEQVLLGLARGSG
FT                   TRSLAGMRPVRGLLLRPFLGLRRADTLEICAVEGLDPWRDPSNADPSFARSRTRVEVLP
FT                   MLEDKLGPGVAESLARTAAILQLDADYLDDVANSTYEQLAEQSGGEISLPEAALGELAP
FT                   AIRFRVIAKAAAAVGGQQPSYQRLLAAEALLRRQGSAGPVELPGGVSAYRLSLAQILAG
FT                   EGQNPPGRAGDAANGGPREAARCGKLVFRPQKPPQE"
FT   gene            154700..155251
FT                   /locus_tag="Arth_0150"
FT   CDS_pept        154700..155251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0150"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: sma:SAV4665 putative hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01551"
FT                   /db_xref="GOA:A0JR81"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR81"
FT                   /protein_id="ABK01551.1"
FT                   /translation="MDSNDVQADLKHVLYTKDQIQQRITELAAQIDKDYEGRELLIVGV
FT                   LKGAVMVMADLARALHSHVSMDWMAVSSYGSGTQSSGVVRILKDLDTDLMGKDVLIVED
FT                   IIDSGLTLSWLKTNLESRGTASVEICTAFRKPTAAKVQIDVKYVGYDIPNEFVVGYGLD
FT                   YAEKYRNLDFVGTLAPHVYE"
FT   gene            155456..157525
FT                   /locus_tag="Arth_0151"
FT   CDS_pept        155456..157525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0151"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: lxx:Lxx21500 cell division protein; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   AAA ATPase, central domain protein; peptidase M41, FtsH
FT                   extracellular; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01552"
FT                   /db_xref="GOA:A0JR82"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR82"
FT                   /protein_id="ABK01552.1"
FT                   /translation="MKAKSFFKGPGIWIVVVVGMLLLAFATLAPGGATRIDTKPGLELL
FT                   ADKGKVEQAKIFDAENRVDLVLKDNLVIDGQDKGKNVQFFFVNARAADVVKAVTDADPS
FT                   SGYTDQPIENNWFSGLFSLLIPVLLLGVLFWFLLSRMQGGGSKIMQFGKSKAKLVNKDM
FT                   PQVTFSDVAGADEAVEELQEIKEFLQEPAKFQAVGAKIPKGVLLYGPPGTGKTLLARAV
FT                   AGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKASSPAIIFVDEIDAVGRHRGAGI
FT                   GGGNDEREQTLNQLLVEMDGFDVKTNVILIAATNRPDVLDPALLRPGRFDRQITVEAPD
FT                   LVGRDQILQVHAKGKPMAPGVDLKAVAKKTPGYTGADLANVLNEAALLTARSNANLIDD
FT                   RALDEAIDRVMAGPQKRSRVMKEHERKITAYHEGGHALVAAALRNSAPVTKITILPRGR
FT                   ALGYTMVVPENDKYSVTRNELLDQMAYAMGGRVAEEIVFHDPSTGASNDIEKATATARK
FT                   MVTEFGMSERVGAVRLGQGGGEPFLGRDAGHERNYSDQIAYIVDEEVRRLIDQAHDEAY
FT                   AILTENRDILDSLALELLERETLNQAEIAYVFRDIRKRDFREVWLSKETRPVQSAGPVE
FT                   SRHERAEREAQEEAKEARLEEPLDARPPHPQGVAGQETFGGGVTDVSTDGPQHG"
FT   sig_peptide     155456..155536
FT                   /locus_tag="Arth_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.690 at
FT                   residue 27"
FT   gene            157535..158179
FT                   /locus_tag="Arth_0152"
FT   CDS_pept        157535..158179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0152"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: sco:SCO3403
FT                   putative GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01553"
FT                   /db_xref="GOA:A0JR83"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR83"
FT                   /protein_id="ABK01553.1"
FT                   /translation="MTHFDDDDVSAGPGPSAADHAQHAGHIKVDRPRIEAAVREILLAI
FT                   GEDPDRGGLLDTPKRVAKAYAEVFAGLHHDPAEILSTTFDLDHEELVLVKDIPFYSTCE
FT                   HHLVPFHGVAHVGYIPSHDGKVTGLSKLARLVDMFAKRPQVQERLTTQIVEALVTHLKP
FT                   RGAIVVVECEHLCMSMRGIRKPGAKTVTSAVRGQLHDPATRAEAMSLILGR"
FT   gene            158190..159125
FT                   /locus_tag="Arth_0153"
FT   CDS_pept        158190..159125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0153"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: fra:Francci3_4407 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01554"
FT                   /db_xref="GOA:A0JR84"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR84"
FT                   /protein_id="ABK01554.1"
FT                   /translation="MDSLAAAPGTGPATSPLPILRKPRPVAKFEDLPSDRTLVMGILNV
FT                   TPDSFSDGGTHPTPDTAIAAGLRMFYAGADIIDVGGESTRPGAEEVSPEEEQRRVLPVV
FT                   EAMVKAGALVSIDTTHASTAAAALKAGATIINDVSGLTMEPEMAELAARTGAPYVLTHR
FT                   RGDAKTMNSLTDYGNVAEEVAAELVGVRDKLYAAGVAPEQIIVDPGLGFSKNDAQNWEL
FT                   LRNMAPLEALGHRLLVGASRKRFLGTLLTVAGKAAAPGERDHATAAITAISAARGAWAV
FT                   RVHDVGPSLDAVKVAARMSAGPLSHSSPTN"
FT   gene            159135..159494
FT                   /locus_tag="Arth_0154"
FT   CDS_pept        159135..159494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0154"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   tfu:Tfu_2891 dihydroneopterin aldolase
FT                   family:dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01555"
FT                   /db_xref="GOA:A0JR85"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR85"
FT                   /protein_id="ABK01555.1"
FT                   /translation="MDTITLSGVTAVGHHGVFDFERRNGQPFIVDAVLHLDFTKAAASD
FT                   DVLDTAHYGEVAERIKHWITGDPLNLIEALAVRIAEDLLEEFPLAAVDITVHKPKAPIE
FT                   VEFGDVSVSVHRRRS"
FT   gene            159491..160045
FT                   /locus_tag="Arth_0155"
FT   CDS_pept        159491..160045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0155"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: sco:SCO3401 putative
FT                   hydroxymethyldihydropteridine pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01556"
FT                   /db_xref="GOA:A0JR86"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR86"
FT                   /protein_id="ABK01556.1"
FT                   /translation="MNPPYSNNPYVRAVLALGSNLGERNDTLSSAVADLVDRPEVRLIA
FT                   VSPVVQTKAVGGPEGQPDFLNMVITVETSLPPSELLRHCQAVENKHHRVREVRWGPRTL
FT                   DVDIIAYGDVVSSDPALTLPHPRAAERAFVLYPWSLIDPSAELNGVRVGELAARAADFP
FT                   DLAPFDGFGDFDGLPTAGAVE"
FT   gene            160049..160576
FT                   /locus_tag="Arth_0156"
FT   CDS_pept        160049..160576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0156"
FT                   /product="conserved hypothetical membrane protein with
FT                   unknown function"
FT                   /note="KEGG: blo:BL1686 hypothetical membrane protein with
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01557"
FT                   /db_xref="GOA:A0JR87"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR87"
FT                   /protein_id="ABK01557.1"
FT                   /translation="MKPVNPFLLIVVGLVLAIAGWFATVMTTRYGLATPVLPQTGLVTM
FT                   GVIVALTLVLGIRVLRWRNGKKKKMLNPILAAWTLVLAQACAYTGTVLLGWHAGIFLDL
FT                   LRLWNLRSDQGITWLAFSMAGGGLAMIIVGLVVERFCRIPPEDGDADGATGTPGRGARK
FT                   PKGEGEYAYRGD"
FT   sig_peptide     160049..160150
FT                   /locus_tag="Arth_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.615 at
FT                   residue 34"
FT   gene            160617..161069
FT                   /locus_tag="Arth_0157"
FT   CDS_pept        160617..161069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0157"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: sco:SCO3393
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01558"
FT                   /db_xref="GOA:A0JR88"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR88"
FT                   /protein_id="ABK01558.1"
FT                   /translation="MTVRLVEWALGNLIAVALLSLPLVFRLAGWWEWVPLWLAVTVPAV
FT                   TLLLAVWRLLLIPRQVRAIGYAERDDDLLIRSGIFFQRTLVVPYGRMQYVDIGVGPVER
FT                   GLGLCTLKLHTASAGTNAEIPGLPADEGARLREQLSARGAARLAGL"
FT   gene            161084..162739
FT                   /locus_tag="Arth_0158"
FT   CDS_pept        161084..162739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0158"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: lxx:Lxx21430
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01559"
FT                   /db_xref="GOA:A0JR89"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR89"
FT                   /protein_id="ABK01559.1"
FT                   /translation="MTPGGAGPGPAPGAAGPSPGPAGQITGKPDGEWLRVHPASPFIRG
FT                   WVALAAIGFFFGRDTFERLLQGRPLMDDMFTGRVPFLLAGGGAVLVLAVLGFITTWYFT
FT                   RYQVAEGFVRVNTGFLFKQQRQARLDRVQAIDIMQPLLARIFGLAELKFEVADAGESAV
FT                   RLAYLRIDDARQLRATILARAAGLEPDPARPEAALPEAPEYAVLSVPPSRLVGSLLLSE
FT                   QSFFVVLGAVASVVLSAITESRGFYFYLIPAVLGLAAAYWGAFIKGYNFTAAISPDGIR
FT                   LRYGLLDTQAQTLPPGRIQAVKVTQPPLWRIFGWYRMQVNVAGYGGPGSNGEGASRTTL
FT                   LPVGVLADVMRMLALVLPDPGTPDPARVFAAGLTGLAPAGLSPAGPSPSSPSPSGGISG
FT                   EEPDGGFVTSPRRVRLLAPLGWRRNGFTATDTALLIRSGRLWRELVVVPHQRTQSMALH
FT                   QGPLARRFRVADLVLHTTAGPVSPRVIQAGLDEARDLFDAQAARARKARKRQTSEQWLA
FT                   QVAPEAAVEAGSETKPIKTKPVDLQTHQEGPHHG"
FT   gene            162732..163667
FT                   /locus_tag="Arth_0159"
FT   CDS_pept        162732..163667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01560"
FT                   /db_xref="GOA:A0JR90"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR90"
FT                   /protein_id="ABK01560.1"
FT                   /translation="MAKPGRLGVGIIGAGKVGAVLGAALRAAEHAVVGVSAVSDASRER
FT                   AETLLPGVPVLDVQDIVERSELVLLAVPDDALGGLVEGLAKLGAWQPGQLVAHTSGRFG
FT                   VGILHPVRAAGAVPLALHPAMTFTGMSLDLTRLLDCTFGVTADAAMLPIAQALVVEMGA
FT                   EPVVIAEGDRTQYHAALAHGSNHLVTLVAQASQLLREVGVESPERMLGPLLRATLENAL
FT                   ASGESALTGPVARGDVGTVAAHAEALREHDAGAGGDILEAYLAMARATAHRAGSRGLLK
FT                   PDQLDAIRKALDGVDNDGVDNDGPQATGGN"
FT   gene            163684..164598
FT                   /locus_tag="Arth_0160"
FT   CDS_pept        163684..164598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0160"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: cef:CE0115 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01561"
FT                   /db_xref="GOA:A0JR91"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JR91"
FT                   /protein_id="ABK01561.1"
FT                   /translation="MTTAAQLRAESARLLTEKQGSSQGLVPTMGALHEGHARLARTAVE
FT                   QNDVVVASIFVNPLQFGEAVDLDRYPRTLEADMELLDAEGVDLVFAPAVEEVYPGGEPL
FT                   VRVTAGRLAGKWEGASRPGHFDGALTVVAKLLHYGIPGTGLPGGGAFVTGAGAGLPAYR
FT                   AYFGQKDAQQLTLVRRMVTDLNFPVEIVAVPTVRSADGLALSSRNRFLSGEEREAALVL
FT                   SRALRLLEERANAHEPLDLESAQALVESQPLVGLDYFDVVDPETLEPLAENCKETPFRG
FT                   EGLAIIAAKVGPVRLIDNLPLSS"
FT   gene            164701..166185
FT                   /locus_tag="Arth_0161"
FT   CDS_pept        164701..166185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0161"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cgb:cg2971 lincomycin resistance protein LMRB"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01562"
FT                   /db_xref="GOA:A0JR92"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR92"
FT                   /protein_id="ABK01562.1"
FT                   /translation="MSTDVSSNAHGDPVPPAAVEASTAAPVKMSRESVTIIVTLLVATF
FT                   VVILNETIMNVALQRLMVDLGVDAPTVQWLSTGFMLTMAVVIPTTGFILQRLSTRAVFM
FT                   LAMGLFSGGTLLAALAPGFEVLLLARIVQAGGTAIMLPLLMTTILTLVPIERRGAVMGN
FT                   VSIAISVAPAMGPTVSGLILEHFTWRFMFVFVLPIALAAFAIGARYLTNIGESEKTRLD
FT                   ILSVLLTVPAFGGLVYGLSQIGGGHGGQSGPGAPAVAALAIGLVAMTAFVFRQLKLQKS
FT                   EGPLLDLRAFNFRMFTVSVLLLVVAMIALFGAVILLPLYLQEIRGLKSLETGLALLPGG
FT                   LAMGLLGPFIGRVFDKVGPLPLTVTGSVMMVLSLWQFSMLNAETAVWWIVTLHVVLSLG
FT                   LALLFTPAFTTGLNPLPPHLYSHGSAIMSTLQQVAGAAGTALLVSIYAVVSAGSGIIAG
FT                   MHSAFLTAAIIAVAAVVLSAMMRKTAGAEHTAPAAH"
FT   gene            complement(166223..167059)
FT                   /locus_tag="Arth_0162"
FT   CDS_pept        complement(166223..167059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0162"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mlo:mlr2262
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01563"
FT                   /db_xref="GOA:A0JR93"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR93"
FT                   /protein_id="ABK01563.1"
FT                   /translation="MTRENIKTPDGGTLELYTTGAELASAGSGVVVVQASMVTAADYTR
FT                   FAQKLSASLGRPVHTFNRRGRGESSAQPNDYTLDVDIRDLDTVMRHTASTDVFGHSFGG
FT                   AVALHAARTLPVERLAVYDPAVSVNHSVKADWIAEYERATAAGDDDRALAVLLRGLETG
FT                   GALSSRMPLSMLTLANKLTAGTPVGKQQRELMKTGVREIKAIIAADMPAEPFLALPLET
FT                   LIIVGEKSPAYFGIACGQIHDVLSGSSYTILPGAGHDGVNRAPDKLITELSEFFAG"
FT   gene            complement(167121..167975)
FT                   /locus_tag="Arth_0163"
FT   CDS_pept        complement(167121..167975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr2262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01564"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR94"
FT                   /protein_id="ABK01564.1"
FT                   /translation="MKQQLITTHDGGRLALYSYGTVDAPGERRVVVIGGAFLTALIYRP
FT                   FSEALSKGLGDGWAVDVYDRRGRGESTPQPADYSMATEIADVRTIMDATGARNLFGHSL
FT                   GGSVALNAVQEFVGTAHQPDRLAVYDAAVNIDGSVDTSWLDSFERSVNEGNVPHALAKL
FT                   KKGMQPGTAMARIPEPVLAGLMALVSRTKVNRLFKEVMPSGVGELKAVFDEADHVRDFS
FT                   VLPPNTRFMVGSKSPRYYKVTAELLHRAVPGSVLQVSPKCVHASIPAAVKELVADISAY
FT                   YKG"
FT   gene            complement(168002..168913)
FT                   /locus_tag="Arth_0164"
FT   CDS_pept        complement(168002..168913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0164"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mlo:mlr2262
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01565"
FT                   /db_xref="GOA:A0JR95"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR95"
FT                   /protein_id="ABK01565.1"
FT                   /translation="METRTISTDDGDGHLELHSFGSGGNSAGQPGIVVIHGTLVTDALY
FT                   RPFAMKIARLLGRPVHTYNRRGRGGSSGQPEDYSVATEVSDLRDVMRATGSTDVVAHSY
FT                   GGFVALQAARSEPIRRLVTYDAAVSLSGSLSRRWRPELEHSMAAGQLDHAWAHLVQGLE
FT                   TAGPISKLPLGALRMLSILSARTRLGAEMRQLLPTAVVEMRAVLDADAELADFADVTTP
FT                   TLMLSGGWSPPYFAETGRLLAEAVPSIEFALVPGQLHEGPLRPGHRLALTTARFLANDA
FT                   GLRLQRIRAAGYPLGNRFRMGP"
FT   gene            169014..170546
FT                   /locus_tag="Arth_0165"
FT   CDS_pept        169014..170546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0165"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; KEGG: pac:PPA0181 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01566"
FT                   /db_xref="GOA:A0JR96"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR96"
FT                   /protein_id="ABK01566.1"
FT                   /translation="MTSQNTPTPINAAEPADASEQMRIRMEKRAKLIERGVEAYPVGVE
FT                   RTHSLSEIREKYAHLEADETTGDIVGVTGRIVFIRNTGKLCFATLQEGGTDGKGTRLQA
FT                   MLSLANVGEESLAEWKSLVDLGDHVFIKGEVISSRRGELSVMADSWAMASKALRPLPVL
FT                   HAGLNEETRVRQRYVDLMVRDEAREMVYTRAAITRSIRESLHRRNYVEVETPMLQLVHG
FT                   GALARPFETHMNAFDQKMTLRIATELYLKRAVVGGIDRVYDMGRVFRNEGVDSTHSPEF
FT                   TTLECYEAWADQFVMADRIKEIILDAADAAGVGRTIQTEAGEINLDGEWTWLAVYPGLS
FT                   DAVGQEITPDTTVEELRAVAAKHDVKVDPKWDAEKLAVELFGEIVEPTLLNPTFVYDYP
FT                   PSAQPLARQHRNDDRLIEAWDLIIGGMERGTAFSELIDPVIQRERLTEQSMHAAAGDVE
FT                   AMQLDEDFLRALEYGAPPMGGIGLGIDRLVMLFTGAGIRETILFPLLKPEGH"
FT   gene            170549..170761
FT                   /locus_tag="Arth_0166"
FT   CDS_pept        170549..170761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01567"
FT                   /db_xref="GOA:A0JR97"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR97"
FT                   /protein_id="ABK01567.1"
FT                   /translation="MEYVAVLLPSLVVGLLFWFAMKSIFNADKSERQAEARAQAEADAS
FT                   AAESKPGPNGAPNTGTNAGNGDGTN"
FT   gene            170898..171224
FT                   /locus_tag="Arth_0167"
FT   CDS_pept        170898..171224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0167"
FT                   /product="Lsr2-like protein"
FT                   /note="KEGG: sma:SAV4695 Lsr2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01568"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR98"
FT                   /protein_id="ABK01568.1"
FT                   /translation="MAQKVKIILVDDLDGGTADETVRFGLDGVSYEIDLSAANAAELRS
FT                   SVERFVSSARKTSTGRATRTKVSGGRNQDSAQIRQWARENGYAVNSRGRIQAEIQEAYQ
FT                   KANS"
FT   gene            171594..174086
FT                   /locus_tag="Arth_0168"
FT   CDS_pept        171594..174086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0168"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase, central domain
FT                   protein; Clp N terminal domain protein; ATPase associated
FT                   with various cellular activities, AAA_5; ATPase AAA-2
FT                   domain protein; SMART: AAA ATPase; KEGG: sco:SCO3373
FT                   putative Clp-family ATP-binding protease"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01569"
FT                   /db_xref="GOA:A0JR99"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0JR99"
FT                   /protein_id="ABK01569.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLSISLDGVREQVQEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKETTGAGVGAGQPEGT
FT                   PAGSVVLDQFGRNLTQAARENKLDPVIGREQEMERVMQVLSRRTKNNPVLIGEPGVGKT
FT                   AVVEGLAQAIVRGDVPETIKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEIRTRGDI
FT                   ILFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHIEKDAALERR
FT                   FQPIQVKEPSVAHAIEILKGLRDRYEAHHRVTITDGALASAANLSERYISDRFLPDKAI
FT                   DLIDEAGARLRIRRMTAPPELKAMDERIAELKMEKESAIDAQDFEGAASLRDKEQKLIA
FT                   ERAEKERHWKTGGMDDISEVDEDLIAEVLANSTGIPVFKLTEEESSRLLKMEDELHKRV
FT                   VGQNEAIKALSQAIRRTRAGLKDPKRPGGSFIFAGPTGVGKTELAKALAEFLFGEEDAL
FT                   ITLDMSEYSEKHTVSRLFGAPPGYVGYEEGGQLTEKVRRRPFSVVLFDEVEKAHADLFN
FT                   SLLQILEDGRLTDSQGRVVDFKNTVIIMTTNLGTRDISKSVATGFQSGTDTQTGYNRMR
FT                   ARVTEELKQHFRPEFLNRVDDVVVFPQLTQDEIIEIVDLFVSRLEKRLKDKDMGIELTK
FT                   AAKVLLATRGYDPAMGARPLRRTIQREIEDQLSEKILFGEIHAGDIVVVDVDGEGDDAK
FT                   FTFEGNAKPRIPEIAPSV"
FT   gene            174306..176435
FT                   /locus_tag="Arth_0169"
FT   CDS_pept        174306..176435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0169"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; KEGG: ade:Adeh_0114 peptidase S9,
FT                   prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01570"
FT                   /db_xref="GOA:A0JRA0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA0"
FT                   /protein_id="ABK01570.1"
FT                   /translation="MASEDSAILSEQPATPFHDIDHYLAIPRVSGLALSPDGQRLVTTV
FT                   STLNGKGTEYVTALWELDPAGEKHARRITRSAKGEAGAAFAATGDLYFTSARPDPDSPD
FT                   DDPVSALWQLPADGGEARVVLSRAGGISQVITAKDSGATFVTASVLAGSADEEADEARR
FT                   KSRKDNKVSAILHSGYPVRYWDADLGPDQPRVFAVEPGEDKDPGKPATVDAAAPLKLRN
FT                   LTPEAAGMLRNADSVVSPDGRTIYTSFDKPLAKADSRSVLVAIDVATATHKILLDREGM
FT                   SYFAGPVSPDSRTLVVLSESDTTPRQAPRVKLHLLDVSAPGEPEDNLRPLAHEWDRWAI
FT                   KAAWLPDGAALLVTADDDGASPVFRITPAAAGAGAGEDQVTRVTLDAAAYADVVVSPDG
FT                   LSAYALRSSYEFPPEAVRIDLASGQVTRLQAPAERPRIQGSLERIEATAADGARIPAYL
FT                   ALPEGASAQNQAPLLLWIHGGPLGSWNAWTWRWNPWLLVARGYAVLLPDPALSTGYGQS
FT                   YIQRGWGEWGKAPFTDLMTITDAVVQRPDIDASRTAAMGGSFGGYMANWVAGQTDRFNA
FT                   IVTHASLWALDQFGPTTDASQYWLKEMTAEMALANSPHLHVEKISTPMLVIHGDKDYRV
FT                   PIGEGLRLWYELLSKSQLAADDNGRTPHRFLYYPDENHWILQPQHAKVWYGVVEHFLAR
FT                   NVLDQDAPLPAELGL"
FT   gene            176462..176971
FT                   /locus_tag="Arth_0170"
FT   CDS_pept        176462..176971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0170"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   lxx:Lxx21330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01571"
FT                   /db_xref="GOA:A0JRA1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA1"
FT                   /protein_id="ABK01571.1"
FT                   /translation="MTETFRIRPARTSDVAAIKRLVAPLADKRILMAKETVAYYESLQE
FT                   FRIAESADGEVIGCGALHVMWEDLAEVRTLAASDAWRGKGVGHVLVESLLEEARALGVS
FT                   RVFCLTFEVDFFKKHGFDVMADQTAVDPVVYSELLRSHDEGVAEFLDLARVKPNTLGNT
FT                   RMIRFL"
FT   gene            complement(176958..177278)
FT                   /locus_tag="Arth_0171"
FT   CDS_pept        complement(176958..177278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01572"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA2"
FT                   /protein_id="ABK01572.1"
FT                   /translation="MYPPARLSGFPKRPGGNPATPRRRYGMLTLHRAGPEDHYGSDPQE
FT                   DPFGTPKNPEKWRIRAFLSFEVVSEFGYYQATVINFIHRFDIWEGLEVRLNPHGGGRPR
FT                   ET"
FT   gene            177435..178436
FT                   /locus_tag="Arth_0172"
FT   CDS_pept        177435..178436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0172"
FT                   /product="dihydroxyacetone kinase DhaK subunit"
FT                   /EC_number="2.7.1.121"
FT                   /note="KEGG: lxx:Lxx09870 dihydroxyacetone kinase; TIGRFAM:
FT                   dihydroxyacetone kinase, DhaK subunit; PFAM: Dak kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01573"
FT                   /db_xref="GOA:A0JRA3"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA3"
FT                   /protein_id="ABK01573.1"
FT                   /translation="MKKLINDPRAVVDESVEGFGLAHADIVTVSAEPKFITRKDAPVAG
FT                   KVGLVSGGGSGHEPLHGGFVGLGMLDAAVPGAVFTSPTPDQIIPATLAVNSGAGVVHIV
FT                   KNYTGDVLNFETAAEMAEAEGVQVRTVLVNDDVAVEDSLYTAGRRGVGGTVLVEKIAGA
FT                   AAERGDDLDAVAAIGDRVNQNVRSMGVALSACTVPHAGVPSFDLEENEIEIGIGIHGEP
FT                   GRHRIPMENADGITDRLLEPILSDLGIASGEKVLLFVNGMGGTPQSELYIVYRRAAQVL
FT                   AEKGVTVERSLVGNYITSLEMQGCSITVLRLDDELTSLWDAPVHTAALRWGI"
FT   gene            178439..179071
FT                   /locus_tag="Arth_0173"
FT   CDS_pept        178439..179071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0173"
FT                   /product="dihydroxyacetone kinase DhaL subunit"
FT                   /EC_number="2.7.1.121"
FT                   /note="TIGRFAM: dihydroxyacetone kinase, L subunit; PFAM:
FT                   Dak phosphatase; KEGG: lxx:Lxx09880 dihydroxyacetone
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01574"
FT                   /db_xref="GOA:A0JRA4"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA4"
FT                   /protein_id="ABK01574.1"
FT                   /translation="MGLDVDWAVRWLTLSAQAMADHRVELIELDRAIGDSDHGENMDRG
FT                   FKAVMEKLAEAPPATPGAALKLTAMALMSKVGGAAGPLYGTAFLRASTSLGDTEDIDPA
FT                   ALAAAIQAARDGVVARGKAESGDKTMVDAWTPAVDAAAAQAAAGDGDVRKVLLAAAEAA
FT                   EAGAVATDPLIARKGRASYLGERSAGHRDPGAVSTALILRAAAGAAG"
FT   gene            179068..179742
FT                   /locus_tag="Arth_0174"
FT   CDS_pept        179068..179742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0174"
FT                   /product="dihydroxyacetone kinase DhaM subunit /
FT                   Phosphocarrier protein HPr"
FT                   /EC_number="2.7.1.121"
FT                   /note="TIGRFAM: phosphocarrier, HPr family;
FT                   dihydroxyacetone kinase, phosphotransfer subunit; PFAM:
FT                   phosphocarrier HPr protein; PTS system fructose subfamily
FT                   IIA component; KEGG: lxx:Lxx09890 PTS system enzyme I"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01575"
FT                   /db_xref="GOA:A0JRA5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA5"
FT                   /protein_id="ABK01575.1"
FT                   /translation="MTVSLVVVSHSEKIADGAAELAAQMAPDVVILPAGGTDDGRIGTS
FT                   LEKVMAALEQAAGQDGIVVLTDLGSAVMTAESAVEFLPDPDTVLLADAPLVEGLVAAAV
FT                   AAQSGADATGVKQAAEAVRRAPAPEAPSEAETLGPPEATGDFELVNQAGMHARPAAKIA
FT                   GGLAGLDAEVTVNGMDGASMTGLMTLGAGKGSILHVEAWGPDAARAVKYVGGLVEAGFG
FT                   EP"
FT   gene            complement(179788..180285)
FT                   /locus_tag="Arth_0175"
FT   CDS_pept        complement(179788..180285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01576"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA6"
FT                   /protein_id="ABK01576.1"
FT                   /translation="MRSLGVFLVAVTTSLIPSACLPEAVPCPAIAQAPVVALTVAASYA
FT                   STVKAIHLKACQDGTCREADLELMPGSTAVDQGCEPSSGPDGTCSATSSPDGTLTGMLM
FT                   MDILTESRIDATATGTSTAGAPLPERTLSFMPRAEYPYGEQCGKFITASLLLDAEGLRQ
FT                   AE"
FT   sig_peptide     complement(180226..180285)
FT                   /locus_tag="Arth_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.631 at
FT                   residue 20"
FT   gene            complement(180354..180788)
FT                   /locus_tag="Arth_0176"
FT   CDS_pept        complement(180354..180788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01577"
FT                   /db_xref="GOA:A0JRA7"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA7"
FT                   /protein_id="ABK01577.1"
FT                   /translation="MKTVLYIVWALFVVAAAVSITVAVRKGKRLEKLAEQWPRVQATVT
FT                   GSNAGWSSAVGSSGSRHRLYRPTYRFADPHGTLYFGESDVPFRTEPVPGSTVDVAYNPA
FT                   DPNQSIHQASKEKAGMGCMIAFFAVFAVASFLFIGIFPVS"
FT   sig_peptide     complement(180717..180788)
FT                   /locus_tag="Arth_0176"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.326 at
FT                   residue 24"
FT   gene            complement(180855..181898)
FT                   /locus_tag="Arth_0177"
FT   CDS_pept        complement(180855..181898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0177"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; SMART: iron-sulfur cluster loop; KEGG: sma:SAV4707
FT                   putative adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01578"
FT                   /db_xref="GOA:A0JRA8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA8"
FT                   /protein_id="ABK01578.1"
FT                   /translation="MGHHHAGRRTAGHIHYSICIEALAVPTALPPASRPALPPLAALHD
FT                   ALDDWFGTTARDLPWRDPECSPWGVLVSEIMLQQTPVVRVLPVWEDWLRRWPSPAHLAT
FT                   EASGEAVRHWGRLGYPRRALRLHAAAVAIVEKHDGGVPGTYDELLELPGVGSYTAAAVA
FT                   AFAFGRRETVVDTNIRRVHARLFSGTALPSQSLTAAEMRLAAELLPADVGLSVRWNAAV
FT                   MELGALVCTARAPKCGECPVRGACAWLAAGEPPPSYTPKGQSWHGTDRQVRGAVMAVLR
FT                   LADAPVAPDMFHQPAADLGFEAEGIGVPLAALHRLNSAPEQLERALAGLVSDGLAELHP
FT                   AGLTLPA"
FT   gene            181927..182607
FT                   /locus_tag="Arth_0178"
FT   CDS_pept        181927..182607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lxx:Lxx21320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01579"
FT                   /db_xref="GOA:A0JRA9"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRA9"
FT                   /protein_id="ABK01579.1"
FT                   /translation="MVRQGTSGKNGSKPKGTPGRQAGRPPLKAVYRRRRLFVGLVLLLV
FT                   ASVALGGFAAVSGAMRSSEQASSTDRNGSDGQGAKPEATPSASPTPSTPETPTCDQALV
FT                   TVSASTDKAAYAAGETPLLSLKVTNGGKAACEVNLGTSQMEYTVTSGSDRIFSSVDCQV
FT                   ESGDLVKTIAPGQSETANFPWQRNRSVPGCGAVSAKPGAGGAYYMFVARLGTKSSSKAV
FT                   FQLL"
FT   sig_peptide     181927..182091
FT                   /locus_tag="Arth_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.757 at
FT                   residue 55"
FT   gene            182775..183500
FT                   /locus_tag="Arth_0179"
FT   CDS_pept        182775..183500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0179"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: sma:SAV5220 GntR-family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01580"
FT                   /db_xref="GOA:A0JRB0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB0"
FT                   /protein_id="ABK01580.1"
FT                   /translation="MAPQEVSSARFSAQLRSHALQTRIMELILEQGLDVGDALPTEGEL
FT                   SAILGVGRNTIRESLKVLQALGVIEIRHGFGTFVAPNNFHALADGLAFRGRLSLRHRGD
FT                   EAMELVDVRQALESGLIGSAMDLMTAGQRDDLRSALAAMEDAAARGEPLFIHDAEFHRR
FT                   LFAPLRNDLLMNLMDVFWKVYRQIHLELGPGPVDLGKQVQDHADIYQAVAAGDKALASE
FT                   RLQRHFDGIRGKLRIVAAR"
FT   gene            183578..184366
FT                   /locus_tag="Arth_0180"
FT   CDS_pept        183578..184366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0180"
FT                   /product="glucosamine/galactosamine-6-phosphate isomerase"
FT                   /note="PFAM: glucosamine/galactosamine-6-phosphate
FT                   isomerase; KEGG: pac:PPA0476 glucosamine-6-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01581"
FT                   /db_xref="GOA:A0JRB1"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB1"
FT                   /protein_id="ABK01581.1"
FT                   /translation="MEFFTVQDAAAAGAVGAGFLAAVIRSNPDAVLGVATGGSPLPVYR
FT                   SLAGYGLEMSRIRCFALDEYVGLPAGHPESYAEVVRREVTGRLGLNPANVFVPDGSAAD
FT                   PERAACDYEAAIAACGGIDIQLLGIGHNGHLAFNEPGSALDSRTRVEVLAERTRQANAR
FT                   YFDSPRDVPERCITQGLGTILEARQLLLVVHGADKAEILHRALTGPVSADCPASVLQRH
FT                   PHVTVIGDEGAAALMGRATTPGTAAPVAVGAGAAGTGPGR"
FT   gene            complement(184369..185631)
FT                   /locus_tag="Arth_0181"
FT   CDS_pept        complement(184369..185631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0181"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: tfu:Tfu_2473 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01582"
FT                   /db_xref="GOA:A0JRB2"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB2"
FT                   /protein_id="ABK01582.1"
FT                   /translation="MTPADLFPSTSRHPAEGRTFVLAGTVLSDGRALPDHVVAVVGDRI
FT                   AFAGPQDCFDAADYPRAVELELPAGGFILPGLVDLHCHGAAGGDFPGGNGDACRTAVDF
FT                   LHRHGTTTLLASLVTASRDDLLTGIRSLRVLAGEGLIAGIHSEGPFLSAARCGAQNPGW
FT                   LRHPDLALAAEMLAAAGGTLKSMTYAPELPGARDLVSLLAQHGVTPSLGHTDADPGTAA
FT                   SSLEHTAESLAAAPGSWAGTRPTVTHLFNGMPPLHHRNPGPVSACLRLARAGTAAVELI
FT                   ADGVHLSPETVRMVFELVGAENVVLVTDSMAATGLPDGDYALGPAAVSVRDAVATLQSN
FT                   GALAGGTATMLDVVRRTVAAGVSAADAAASASCVPARILGMDNEVGSVRPGMRADLLAV
FT                   DAQFSLLTVLRAGTLLGSAAS"
FT   gene            complement(185659..186267)
FT                   /locus_tag="Arth_0182"
FT   CDS_pept        complement(185659..186267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0182"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="PFAM: putative N-acetylmannosamine-6-phosphate
FT                   epimerase; KEGG: pac:PPA1997
FT                   N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01583"
FT                   /db_xref="GOA:A0JRB3"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB3"
FT                   /protein_id="ABK01583.1"
FT                   /translation="MRDPRTTGQIAASAVIGGAAAVRVQGLADVQFTRAAVEVPVIGLW
FT                   KDGHDGVFITPTLRHALAVANAGAHVVALDGTRRERPDGLSLAETIAGIRAESHALVMA
FT                   DCGSLDDAAAAVDAGADIVGTTLAGYTGERPKTAGPDLALLEQIASAELGRPLIAEGRI
FT                   HTPAQARQALDAGAFAVVVGTAITHPATITGWFSDALRS"
FT   gene            complement(186342..187316)
FT                   /locus_tag="Arth_0183"
FT   CDS_pept        complement(186342..187316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0183"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: tte:TTE2418
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01584"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB4"
FT                   /protein_id="ABK01584.1"
FT                   /translation="MIHAIGVDLGGTKTAAGVVSGAGEVLFSATIPTLNRDGGEAILNA
FT                   TAALVYELTSRARANNLGIVGVGVGSAGVIDAGRGVVVSATDAILDWAGTELAAGLAGR
FT                   LGLAPESVRAVNDVHAHALGEAWTGAAAGTSSSLLVAFGTGVGGSLVLAGTPVLGHRYV
FT                   AGHLGHIASPFAYSRGRALPCVCGRAGHVEAIASGPAIREAYVRLGGSPEVPDTRAVFG
FT                   LAHDGDAAAATAVRDAATAAGQAVGGLANVLDPELLVVTGGLADAGELWWKPMEAALRA
FT                   ELLAPLAGMPVRPAALGNTAAVIGAASLVLNPPSSVEDLRETL"
FT   gene            complement(187385..188314)
FT                   /locus_tag="Arth_0184"
FT   CDS_pept        complement(187385..188314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0184"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   cdi:DIP0511 putative lysine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01585"
FT                   /db_xref="GOA:A0JRB5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB5"
FT                   /protein_id="ABK01585.1"
FT                   /translation="MSTQFQGVIPPVITPRHADGSIDTSSLKNVTRHLIDGGVSGLFVL
FT                   GSSGEVPYMTNAERELVVSTIADANASVGARAVPLIVGANEQTTNRVIEEAKKVIGLGA
FT                   DAIVVTSMYYAIGNAAETETHFRSIHAAVDKPIFAYDVPVRTHFKLPTDLLVRLGRDGV
FT                   IAGVKDSSGDDVSFRQLLLEAKDIPDFDIFTGHEVVVDGALLGGAQGVVPGLGNVDPAG
FT                   YRRLFDAAQAGDWATAAREQDRLADLFEIVYAPNGRVSGGAAGLGAFKTALQLMGVIES
FT                   NTMSQPMLSLNDDEAAAIRTILERNGLV"
FT   gene            complement(188352..189158)
FT                   /locus_tag="Arth_0185"
FT   CDS_pept        complement(188352..189158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0185"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cdi:DIP0512 putative oligopeptide transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01586"
FT                   /db_xref="GOA:A0JRB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB6"
FT                   /protein_id="ABK01586.1"
FT                   /translation="MSESTGKPVIELKDLKVYHRARTGGLFRPNIVKAVDGVDFTISRG
FT                   ETVGIVGESGCGKSTLASVLVGLQQPTSGQVLFHGKPAIKRNAAMRKEFGRSVSVVFQD
FT                   PATALNPRMTIQDILTDPLQIHGIGTGTTRAAKVKELLALVGLPQSAAEVTPSQVSGGQ
FT                   RQRVAIARALALDPDIIVADEPTSALDVSVRAQVLNLLSDLKTRLNLGMVFISHDIQTV
FT                   RYVSDRICVMYFGKIVEQGTAAQVFDNPGNDYTKKLLGAAPSLLHI"
FT   gene            complement(189155..191278)
FT                   /locus_tag="Arth_0186"
FT   CDS_pept        complement(189155..191278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0186"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: hdu:HD1671 ABC
FT                   transporter, ATP-binding protein and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01587"
FT                   /db_xref="GOA:A0JRB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB7"
FT                   /protein_id="ABK01587.1"
FT                   /translation="MRSKLAERLSAPGIRFKALPWSSRFALVFLVAVIAAAILAPVLAP
FT                   HDPLETFIPATSPGGEHLFGTDRLGRDIFSRLLYGSQSSLLIGLGAVALAVAAGALLGS
FT                   LAATSSKAVNELIMRLMDILMAFPGIALAAVLLAAFGNSIPTIIVAIAVIYTPQLARVV
FT                   RANVLSQYGEDYVRAERVIGAGRFYILLKHIVRNTAAPVLVFATVMVADAIILEASLSF
FT                   LGAGVQDPAPSWGNVISYGRNLVLSGGWWATTFAGLTILLTVLALNILAEGLTDAMVNP
FT                   KLRRAPVVKDDDGTASSVAGAAVDTEVATSVAQPSVVEEHELDGVRAASGDALTEEHYN
FT                   TSALLTDAKVAAASPHVLLDRELELLAAIEAKRTDRLPQVPSGARNVLEVKNLSIRFPG
FT                   RFGDTAIVDNVSFTVREGETMGLVGESGCGKSITSLAIMGLLPKTAQISGSITFDGKEL
FT                   LDPATGHSSPQAYEGLRGQQIAMVYQDALSSLNPSMKIKEQMEQLTRRGGRKTPTELLE
FT                   MVRLDPVRTLASYPHELSGGQRQRVLIAMALSRSPKIVVADEPTTALDVTVQKQVVDLL
FT                   NELREQLGFAMVFVSHDLALVASLAHRITVMYAGQVVESAQASELLQNPKHEYTRGLLG
FT                   AVLSIEADAVRLHQIPGTVPSPRDFAPGDRFAARSLRADADPNQRLVLTAVRSTQGNDA
FT                   DHYWASHLKEDAK"
FT   sig_peptide     complement(191159..191278)
FT                   /locus_tag="Arth_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.287 at
FT                   residue 40"
FT   gene            complement(191282..192238)
FT                   /locus_tag="Arth_0187"
FT   CDS_pept        complement(191282..192238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0187"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hdu:HD1670 ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01588"
FT                   /db_xref="GOA:A0JRB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB8"
FT                   /protein_id="ABK01588.1"
FT                   /translation="MVTILRLLGRRLAALPLMILGITLLVFLVLQAAPGDQASSALGEG
FT                   ASEEAKEQYRQDNGLNDPLFLQYLGFLAKLLRFDLGVTTPPAKSVATMIGSAFPLTLQL
FT                   TLLGVLIAVALSLAFGIVGALYRDKWQDQLVRVFSIAAVATPSFWLGILLIQWFALGSS
FT                   PMFPSGGIATPESGFGGWLNSMALPALALGIPVSASLIRVVRTSMVEELDRDYVRTAIG
FT                   NGVPYREVVSRNVLRNALVTPVTVLGLRIGYLLGGAVVIEMIFALPGMGQLILNGITNL
FT                   DVNLVQGVVLTISVTFVLVNIAVDLLYLLINPRIRTV"
FT   sig_peptide     complement(192140..192238)
FT                   /locus_tag="Arth_0187"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.984 at
FT                   residue 33"
FT   gene            complement(192272..193915)
FT                   /locus_tag="Arth_0188"
FT   CDS_pept        complement(192272..193915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0188"
FT                   /product="extracellular solute-binding protein"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: extracellular solute-binding protein, family 5; KEGG:
FT                   hdu:HD1669 putative ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01589"
FT                   /db_xref="GOA:A0JRB9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRB9"
FT                   /protein_id="ABK01589.1"
FT                   /translation="MDKTIKNRPLVNSASRRSFLKLSGAAGIAAAFASSLAACGGPAAT
FT                   TAGASGSTAPINKDLIIEAGISYALSTGFDPLSSSGATPLAANLHVYEGLIELHPATRE
FT                   PYNALAAADPKMVSPTTYQVSLRQGAKFHDGTPVTADDVVFSFTRVMDPANKSLFSQFI
FT                   PFIKEVKAVDAATAEFTLKYAFPGFGPRISVVKVVPKALANFPLGSEQLKAFDAKPVGT
FT                   GPYKLISAVKDDKIVFEANPDYNGPMPALAKGMTWLLLSDAAARVTAMQSGRVQAIEDV
FT                   PYLDVDGLKTKAAVESVQSFGMLFLMFNCTKGPFSDKRVRQALHYGLDKDSIIKKALFG
FT                   NAKAASSYFQEGHPDYVKAKNVYSYDANKAADLLKEAGVTSLEFELLTTDTAWVKDVAP
FT                   LMLESWNKIPGVKVTLKNLQSGALYADRVGKGDYSVVAAPGDPSVFGNDADLLLSWFYA
FT                   GDTWMKGRANWAATPERAQLVDLMAKAGQSAGDEAKKLTGEIVDLVSEEVPLYPIFHRQ
FT                   LPSAWDSTKLSGFKPLPTTGVSFVGVGRTA"
FT   sig_peptide     complement(193799..193915)
FT                   /locus_tag="Arth_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.400 at
FT                   residue 39"
FT   gene            194057..195826
FT                   /locus_tag="Arth_0189"
FT   CDS_pept        194057..195826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0189"
FT                   /product="Exo-alpha-sialidase"
FT                   /EC_number="3.2.1.18"
FT                   /note="KEGG: pac:PPA1560 sialidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01590"
FT                   /db_xref="GOA:A0JRC0"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC0"
FT                   /protein_id="ABK01590.1"
FT                   /translation="MTSHLFSSADGIPMARPATEHVLAERGRGGYRQYRIPAMAVTARG
FT                   TLLAAYDGRPNLDDLPSPIDLLLRRSGDSGRSWQAQQVVRTGVGLEGYGDPSLLVDAET
FT                   GRIFMFHAAGTRAGFFEAAEGAGNDGDVQHCDVSYSDDDGLTWRHRRLTDQLKLAAGRG
FT                   RGITGIFAAAGQGIQIHAGPFSGRLVQQYVVLVQGNILAASAYSDDHGETWTLGEFIGP
FT                   STAGGEAGAPTAGEAAPNENKVACLNDGRLLLHSRATPRRLSALSGDGGHSWSPLTAIA
FT                   DLPDPSDNGSVTRFDGLPLPLGHATAETDAWVLATNNHDTALRRNTVLSLSRDNGASWP
FT                   AKLVICPGSSAYSTAARLPDGNIGVLYERQGYREIVFCSIPPAQLTDAAALRQGNRRDA
FT                   RQDSARPDQPSGRASGPPASGMVFDMELRSITPGRPEVWQNAGEFHVLAADAGQWDVHT
FT                   WKEIGQGYSPESAQVVGTREAQDLNYGPVSTGYKAGDILAFTGRARNSGPEVLAGVRLT
FT                   GPGAEEFGPADLQPGEESLYFTPVCTVTAQDVGRGSLDVRYGVEWTAAGVNGRLERRFT
FT                   FNMADGSVDIGPV"
FT   gene            complement(195857..196933)
FT                   /locus_tag="Arth_0190"
FT   CDS_pept        complement(195857..196933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0190"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: sco:SCO3352 putative DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01591"
FT                   /db_xref="GOA:A0JRC1"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC1"
FT                   /protein_id="ABK01591.1"
FT                   /translation="MARSPEDSLKATLGRVAPGTALRDGLERILRGRTGALIVLGSDRT
FT                   IESICSGGFDIGIDFSPTRLRELAKMDGAIICDKDAGNILRAAVQLVPDSSIETQESGT
FT                   RHRTAERVAIQTGVPVISVSQSMQIIALYVNGLRHVLEGSEKVLARANQALATLERYRS
FT                   RLDQVTSSLSALEIEAMVTVRDVAVTLQRQEMVRRISEEISQYVLELGEDGRLLSLQLD
FT                   ELTVGRGPGSDVIIRDYAGPNASPEDIDGAVSALLSLGPTELIDLSRIAGIIGFAGGVE
FT                   TLDAVVQPRGYRLLSGLKAVPKAVADRLVDHFGGLQYLMAATIDDLMTVDGIGDQRART
FT                   VREGLSRMAEASLLDRFL"
FT   gene            197294..198901
FT                   /locus_tag="Arth_0191"
FT   CDS_pept        197294..198901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0191"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein; KEGG:
FT                   tfu:Tfu_0359 peptide chain release factor 3:small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01592"
FT                   /db_xref="GOA:A0JRC2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC2"
FT                   /protein_id="ABK01592.1"
FT                   /translation="MSQEVLSPARVQEIHKQAARRRTFAVISHPDAGKSTLTEALALHA
FT                   KVIGTAGASSGKANRKETVSDWMQMEKDRGISISSAALQFAYRDTVINLLDTPGHADFS
FT                   EDTYRVLAAVDCAVMLVDAAKGLETQTMKLFEVCKQRNLPIITVINKWDRPGLDALALM
FT                   DEITERTGLQPMPLTWAVGISGDFRGVWDLRNDRFARFQRNNAGANIALTEYFTPEEAA
FT                   VNQGEDWSNAVDEAGLVIESNLEFDVDAFHAGKATPILFSSAALNFGVKEILDALVDFA
FT                   PPAAPRPDVEGEPRAVDAPFAGFVFKVQAGMNKAHRDHVAFIRVCSGVFERGMVVTQTR
FT                   TGKSFATKYAQQVFGREREVIDEAFPGDVVGLVNASSLRVGDSLFLDEPVEFPAIPLFA
FT                   PEHFQVARSKDPSRFKQFRRGIEQLEHEGVIQVLRSDIRGDQAPVLAAVGPMQFEVVED
FT                   RMALSAPMRLERLPYSMARISTADAMPALANVPGAEVLLRSDGEYLALFNDIWALRRIE
FT                   KNHPDLTLLPIGTHNPAK"
FT   gene            198980..200395
FT                   /locus_tag="Arth_0192"
FT   CDS_pept        198980..200395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0192"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; GAF domain protein; SMART:
FT                   tyrosine protein kinase; serine/threonine protein kinase;
FT                   KEGG: gvi:gll1816 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01593"
FT                   /db_xref="GOA:A0JRC3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC3"
FT                   /protein_id="ABK01593.1"
FT                   /translation="MAASMEPGYLLSGRYRIEALIGRGSQSGVYRAFDELLQREVAVKL
FT                   FRDDPGNLDHTRRQGEEVRILAGMSHHALVTLLDAGADFSDPRHRRTYLVMELVRGPDL
FT                   RARAAQGPINAAHLALIGHDLADGLAYIHHHGIVHRDVKPANILLVDYNNDDRRPRAKL
FT                   SDFGVAMILGDGNRTGPAESSGTPQYLSPEQAASEPVGPPSDVYSLGLVLLEGLTGNPV
FT                   YPGAPIASAMARLLRDPHIPDVVAPKWAALLSSMLSREPSARPGARDVSLALRQEVISA
FT                   AGRRRSISPSPSEVPAEAPPSYDSAANEEARIRAVERYRILDSPPDGTFDRIVGLAARM
FT                   FSVPVAIVSVVDHDRIWFKAHHGTEVGEIGRDPGLCASAILQDEVWVVPDAVTDPRTLA
FT                   NPLVAGEFGLQFYAGVPLRTPDGYNLGTICILDRQPREFTAEDSRALEDLAAIVMNDLE
FT                   LRLQSRSAVASAR"
FT   gene            complement(200404..201693)
FT                   /locus_tag="Arth_0193"
FT   CDS_pept        complement(200404..201693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0193"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /note="KEGG: fra:Francci3_3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01594"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC4"
FT                   /protein_id="ABK01594.1"
FT                   /translation="MLDRGIFLLPRHTIERSKLFPRNNLWKSLMNPPASKSPAAPAYDP
FT                   PWLALPREVSDLLRPKMPGIVEAIIDAVPQLVPAYARPIEGRFGRGLRRGVAAALERFL
FT                   QLPGTRLPALSEESRQLVAGLGSGEFRQGRSMDALLSAYRMGARVTFREMSRISMEKDL
FT                   GQSVVVDLGESILAYIDELSAVSAEAYAFEQSERAGAVDRRRTELLELLLMGQADEAAL
FT                   RQAASMADWSLPARLVVVTLPLDRSAGLRLQLGPGTLVVERETDAVALVPARKSEAARA
FT                   ALEKALKGRSASVGPAGGWEKVPDSLRLAVLAASVLPPREGPEDPPIWADDHLAQIVLG
FT                   SEPSAIAELAERRLAPLEGLRPAQRERLAETLLSWLRHWGQRAPVAAELGIHPQTVGYR
FT                   AAQLRELFGDALEDPRARFELELALHAGRR"
FT   gene            201706..202830
FT                   /locus_tag="Arth_0194"
FT   CDS_pept        201706..202830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0194"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mpa:MAP3344c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01595"
FT                   /db_xref="GOA:A0JRC5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC5"
FT                   /protein_id="ABK01595.1"
FT                   /translation="MIRLRKLARAASVLTTPLAPEDILSLFNPVFSARQLRGIVTRVVA
FT                   ETADSATIFFRPGRGWKAHQAGQWARIGVELDGVRHWRSYSLSAPAGQDPAITVTDVGA
FT                   VSGVLVRNTRPGDVLFLAPPQGDFVLPEHPRPLLMLTAGSGITPVMSMVRTLVPHRPDS
FT                   DVVLIHSARTPEDSIFREELSELADQFPNFKVTHWFTGERGRMDFTSPAVLDELCPDWR
FT                   HRAAYACGPEGFLDDAEALWSAEAAAAAAESSAADGESHQPEGPFAADPINLIIERFTT
FT                   SLAAGAGHDGGLVTFEASDREVEADGSTPLLDVGEDAGVLMPSGCRMGICHSCLIPLRA
FT                   GHVRDLRTGEVHGEPGQLIQTCVSAAAGPVNLDI"
FT   gene            202844..204019
FT                   /locus_tag="Arth_0195"
FT   CDS_pept        202844..204019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0195"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: nfa:nfa46040
FT                   putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01596"
FT                   /db_xref="GOA:A0JRC6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC6"
FT                   /protein_id="ABK01596.1"
FT                   /translation="MAIVTNHEAETTEDAVVPAKTRRGALAASGSPLIRPPAAAHLSDE
FT                   QVAELGRELDAIKDDILAKRGASDAAYIRRMIKIQRGLEISGRATLLVSRNKAAWITGT
FT                   TLLSLAKILENMEIGHNVLHGQWDWMRDPDIHSTTWEWDFVTPARAWQHTHNDLHHRWT
FT                   NVVGKDNDVGYNLLRMDPQQEWKPFNLGNPLYNAILAPVFEWGIAIYDLELQDYKEGKK
FT                   SKEALVKDLKALGVKALKQFTKDYAATPAVAMLTGSGKQALYGTLTANAVRNVWAHAVI
FT                   FCGHFPEGTDTFTEEMVEGETRGDWYVRQMIGSANISGSKFMHLMTGNLSHQIEHHLFP
FT                   DIPSNRYAEVAPKVQEICKRYGLPYTTGPIWKQVGSTWAKVFKLALPPRKA"
FT   gene            complement(204076..204717)
FT                   /locus_tag="Arth_0196"
FT   CDS_pept        complement(204076..204717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0196"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sco:SCO1247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01597"
FT                   /db_xref="GOA:A0JRC7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC7"
FT                   /protein_id="ABK01597.1"
FT                   /translation="MPEASQRNSSFGQHFARVGPRMDARGAADHRRRLVEAAHGTVVEI
FT                   GAGYGATFPFYPSAVTSVLALEPDPTLRALALAEAIRAPVPITVQDGTAESLPAADGSV
FT                   DVVVSSLVLCSVADQSAVLTETLRVLRPGGLLLFYEHVRSAHPVLAAAEDLLTSLWSRL
FT                   AGGCHPNRDTAGRIAAAGLTLQHVERFGFSALPGNPRIAHVLGAAEKLGT"
FT   gene            complement(204734..206893)
FT                   /locus_tag="Arth_0197"
FT   CDS_pept        complement(204734..206893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0197"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: cjk:jk1429
FT                   copper-exporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01598"
FT                   /db_xref="GOA:A0JRC8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC8"
FT                   /protein_id="ABK01598.1"
FT                   /translation="MEPRHGAGQLHTGQPDQGQPHAGHSAHPEHGTHQLPGQGTQPAGH
FT                   GPVDDEHMVHSHGQHAGHSVAMFKNRFWLTLALAVPVVFFSPMFGHLLGYMPPAFPGST
FT                   WIPPLLGTVIYLYGGQPFLRGGLTELKSRKPGMMLLIGMAITVAFVASWATSLGIGGFD
FT                   LDFWWELALLVAIMLLGHWIEMRALGSAQGALDALAALLPDEAERITDAGSETVAVSEL
FT                   RSGDLILVRSGGRMPADGIVSDGQAEFDESMITGESRTVLRSPGDPVVAGTIATDNAVR
FT                   VQVSAIGEDTALAGIQRLVAEAQASSSKAQALADRAAAFLFYFAAGAGVITFAAWTLMG
FT                   SISDAVTRTVTVLVIACPHALGLAIPLVIAISTERAARAGVLIKNRMALERMRTVDVVL
FT                   FDKTGTLTKGEPELKDVAAVEGMDRDGLLALAAAVESDSEHPVARAIVAAARGRGLTVP
FT                   KATEFSSMTGRGVRAGIDGRTVHVGGPALLRELGANEPETLAAITAAWMDRGAAVLHVV
FT                   DDGGRVLGAVSLEDAVRPESRQAVAALQNRGIKVAMITGDARQVARAVAADLKIDEVFA
FT                   EVLPADKDKKVAELQGRGLRVAMVGDGVNDSPALARAEVGIAIGGGTDVAVESAGVVLA
FT                   GNDPRAVLSMVDLSRASYRKMWQNLVWATGYNIIAVPLAAGVLAFAGVVLSPAAGAVLM
FT                   SASTIVVALNAQLLRRLKLNPAQAR"
FT   gene            complement(206980..208458)
FT                   /locus_tag="Arth_0198"
FT   CDS_pept        complement(206980..208458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0198"
FT                   /product="multicopper oxidase, type 3"
FT                   /note="PFAM: multicopper oxidase, type 1; multicopper
FT                   oxidase, type 2; multicopper oxidase, type 3; KEGG:
FT                   tth:TTC1370 laccase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01599"
FT                   /db_xref="GOA:A0JRC9"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRC9"
FT                   /protein_id="ABK01599.1"
FT                   /translation="MSRRSALLLGGLGAAATAAGSAGLWWSAASRSSSRPAPVTGAELS
FT                   QPSELRSAGGRLEVRLDAAAGRIQLAGQQARAMGYNGGSPGPTLRLRPGDVLSVRLANN
FT                   LDQPTNLHVHGLHVSPEGSGDNVFVVVNAGAVHDYEYRLPADHPPGVYWYHPHHHGMVA
FT                   DQIFAGLFGAIIVEDPEPVPVSTERVLVISDTTLDGGGNVVRVSQMERMLGREGELLLV
FT                   NGQSNPEFTAMPGQRERWRIINACVARYLPLRLDGQQLQLLGIDSGRYRTPSPVEELLL
FT                   APGNRADLLVATAAGESVLRAAYYDRGSMAGMMGQRGPRQAIQPGAAGAALATLRVAGS
FT                   TAPSPTPPPPLPAGRDPDDLRTAAVAARRQVALSSGAGMGMGGGMMGFTIDGREFSPAR
FT                   TDTVVAAGSVEEWTLTNASPMDHPFHLHVWPMQVIEEGGRAPDRPEWRDVINVPAQGRV
FT                   KVRVAFRDFSGRSVYHCHILDHEDLGMMGAIEVR"
FT   sig_peptide     complement(208393..208458)
FT                   /locus_tag="Arth_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.442 at
FT                   residue 22"
FT   gene            complement(208578..208898)
FT                   /locus_tag="Arth_0199"
FT   CDS_pept        complement(208578..208898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2227 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01600"
FT                   /db_xref="GOA:A0JRD0"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD0"
FT                   /protein_id="ABK01600.1"
FT                   /translation="MMWGYGPDMGWMWLWGVLMLVGIALLVLVAVRLFSGGGRGGFQSG
FT                   GFTHTGQPGPGGPWPGAGGPGPGGPGQGRSRARQILDERFAKGELTSDQYREQVRILGE
FT                   EH"
FT   gene            complement(209010..210383)
FT                   /locus_tag="Arth_0200"
FT   CDS_pept        complement(209010..210383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0200"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: sco:SCO3351 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01601"
FT                   /db_xref="GOA:A0JRD1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD1"
FT                   /protein_id="ABK01601.1"
FT                   /translation="MATKTSRASKAPAYKCAECGWTTVKWVGRCGECQAWGTVEETGAA
FT                   VARTTAATTVLEPARRIADVDATTAAFLPTGVDELDRVLGGGLVPGAVILLAGEPGVGK
FT                   STLLLDVAAKFARTAQDVLYITGEESAAQVKLRADRIDAVAESLYLSAETDLGQALGQV
FT                   EKLEPRLLVVDSVQTLSSADVEGSAGGVSQVREVAASLIAAAKRRNMTTLLVGHVTKDG
FT                   SIAGPRLLEHLVDVVCQFEGERHSRLRLLRAVKNRYGPTDDVGCFDLNEDGIVGLADPS
FT                   GLFVSRTKEPVSGTCITVTLEGRRPLLAEVQSLLAESASSQPRRATSGLDSSRVAMLLA
FT                   VLQQRAGCLLHKDDSYVATVGGVKLSEPATDLAVALAVASAKAKKPLPVRLIAFGEVGL
FT                   AGEVRPVPGINQRIQEAHRLGFTHAVVPASPNGPGPVPAGFSVREVGHLAEALSLLIS"
FT   gene            complement(210469..211596)
FT                   /locus_tag="Arth_0201"
FT   CDS_pept        complement(210469..211596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa53760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01602"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD2"
FT                   /protein_id="ABK01602.1"
FT                   /translation="MAIPAGLSASGRFLRGRIRTGLVRSRNSLIPAVQMTGCAVGAYAF
FT                   AEYVLGHSGPLFAATSSLIALGFSREPRLRRVVEVGLGCTIGIAVGDLLLHWLGGDIWV
FT                   AAVVLLTSILLARFLDSGNIFTTQLGLQSLLVVLLPAPAGGPFTRSIDAIVGGLFALLV
FT                   TILIPKDPRREPRKDVRKLLHELAEVLRECAQALLESDSTQAWHALIRGRNCQPLVDAM
FT                   RQTLRASGEVATLAPAYRRHRDELDRLEQSLDFIDLALRNSRVFARRLTSAINHAALSD
FT                   EATENIAEVLQETAAAIDELSLGLAETHEGARRAHLRTARQDLSGIALRLHPKLLDVQR
FT                   LEGETVVMLFRPLMVDLLEASGMDALEARDILPPL"
FT   gene            211831..212952
FT                   /locus_tag="Arth_0202"
FT   CDS_pept        211831..212952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0202"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: lxx:Lxx18420
FT                   phosphate porter; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01603"
FT                   /db_xref="GOA:A0JRD3"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD3"
FT                   /protein_id="ABK01603.1"
FT                   /translation="MKALRFGRHAAIAVIAAGALALTACGSDNATNTAQSGAPSATGAK
FT                   VTGTLTGIGSSAQGAAMDVWKTNFASANQGANVQYSPDGSGAGRKAIIDGSAQFAGSDA
FT                   YLKDEELASSKEKCGPEGAINIPVYISPIAIAFNIPDVKELKLDAATVAKIFRGEIANW
FT                   NDPAIAAMNPDAKLPDLKVTPVNRSDDSGTTSNFTDYLAAAAPEVWTDKAAGVWPASLK
FT                   GENAKGTSGVVKTVTDTPGAVTYADDSAVSGKLGIAQVKVGDTFTKISAEAAAKAVDAG
FT                   KPVEGRSANDLSIKLDRKTTIEGAYPVVLVSFHVVCSTYATQETVDLVKAFENYVVSDA
FT                   GQQAAADAAKSAPLSKELQEKAAKAIETIKVKS"
FT   sig_peptide     211831..211923
FT                   /locus_tag="Arth_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.517 at
FT                   residue 31"
FT   gene            213147..214079
FT                   /locus_tag="Arth_0203"
FT   CDS_pept        213147..214079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0203"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: lxx:Lxx18430 ABC
FT                   transporter, permease protein; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01604"
FT                   /db_xref="GOA:A0JRD4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD4"
FT                   /protein_id="ABK01604.1"
FT                   /translation="MTTTSLTQSRGAGRAGDKVFSGAALAAGCLILAVLFGVALFLVVQ
FT                   AIPALVASPDKIQGGEGFFAYIWPIVIGTVIAAVIALVIATPVAIGVALFISHFAPRGL
FT                   ASGLGYVVDLLAAIPSVVYGAWGAAFLAKEISPAYDWLANNMGWLPIFQGPASATGKTI
FT                   LTAGIVLAVMVLPIITSLSREIFLQTPKLHEEAALALGATRWEMIKMAVLPFGRPGIVS
FT                   AVMLGLGRALGETMAVALVLSSGALTASLIQSGNQTIAAEIALNFPEASGLKVSTLIAA
FT                   GLVLFVITLGVNMIARWIIGRHKEFSGAN"
FT   sig_peptide     213147..213287
FT                   /locus_tag="Arth_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.663 at
FT                   residue 47"
FT   gene            214080..215189
FT                   /locus_tag="Arth_0204"
FT   CDS_pept        214080..215189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0204"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: tfu:Tfu_2742
FT                   phosphate transport system permease protein 2; TC
FT                   3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01605"
FT                   /db_xref="GOA:A0JRD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD5"
FT                   /protein_id="ABK01605.1"
FT                   /translation="MTSTLTPVRKRSALTKGQLPKFAPYVVLAIALVVGAAILAVIGFN
FT                   AFGWGIVSAILFTAGLVGWSAAVEGGRRAKDKLATCLVVGSFLVALLPLISVIWTVLVN
FT                   GLPGLLDPGFLTTSMNGVTGAFDNKSVEEGAPVVGGIYHALMGTIQITLLATVISVPVG
FT                   LLTAIYLVEYGEDRPLARAITFFVDVMTGIPSIVAGLFAAAFFFAVVGPGTKTGAVAAV
FT                   ALSVLMIPVVVRSSEEMLKIVPNELREAAYALGVRKWRTILKVVIPTAISGIASGVTLA
FT                   IARVIGETAPILVTAGFATSINNNVFGGWMASLPTFIYTQILNPTSPSNPDPSSQRAWG
FT                   AALVLIILVMLLNLGARLIARIFAPKTGR"
FT   sig_peptide     214080..214226
FT                   /locus_tag="Arth_0204"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.735 at
FT                   residue 49"
FT   gene            215236..216015
FT                   /locus_tag="Arth_0205"
FT   CDS_pept        215236..216015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0205"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="KEGG: lxx:Lxx18450 ABC transporter, ATP-binding
FT                   protein; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01606"
FT                   /db_xref="GOA:A0JRD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD6"
FT                   /protein_id="ABK01606.1"
FT                   /translation="MSKRIDVKDLNVYYGKFLAVEDVNINIEAKSVTAFIGPSGCGKST
FT                   FLRTLNRMHEVIPGARVEGEVLLDGDNLYGPGVDPVTVRSQIGMVFQRPNPFPTMSIRD
FT                   NVLAGVKLNNQKISKGEADALVERSLQGANLWNEVKDRLAKPGSGLSGGQQQRLCIARA
FT                   IAVEPQVILMDEPCSALDPISTLAIEDLINDLKDQYTVVIVTHNMQQAARVSDRTAFFN
FT                   IAGTGKPGKLIEVGDTHTIFSNPTQKATEDYVSGRFG"
FT   gene            complement(216023..217039)
FT                   /locus_tag="Arth_0206"
FT   CDS_pept        complement(216023..217039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0206"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: tfu:Tfu_2744
FT                   phosphate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01607"
FT                   /db_xref="GOA:A0JRD7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD7"
FT                   /protein_id="ABK01607.1"
FT                   /translation="MTLFFFTVVVLFAAAFAFLNGFRDASTSVALAVRTRALTPTVAVL
FT                   LAALFNFVGAGLSGLLALQVSRTWISLPPGENGLTILIAGLLSAVAWGIYTWWRGIPSS
FT                   STHALVGGLAGAGLASVLVGGNAVDGVNNSLLFQVVLPLLVSPVIAFVGAYLLVWPATW
FT                   AARYTPPSVVNSRSRRAQAIAAGAVAFGHGLQDGQRTGAVLLLALLAAGLSDGGGIPGW
FT                   VPLLTAAMLAAGTLAGGWRISYTIGYKLTRIDPLRGFVAQLYSSVILLLGAIGLQWPIS
FT                   TTHTVTAAVLGAGSNQGFPVTNRKLVLRILAFWVLTPVLTAAAAFVLELSLSPLTEL"
FT   sig_peptide     complement(216962..217039)
FT                   /locus_tag="Arth_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.710 at
FT                   residue 26"
FT   gene            complement(217041..217733)
FT                   /locus_tag="Arth_0207"
FT   CDS_pept        complement(217041..217733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0207"
FT                   /product="putative Pit accessory protein"
FT                   /note="KEGG: sma:SAV4077 putative Pit accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01608"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD8"
FT                   /protein_id="ABK01608.1"
FT                   /translation="MRVNVKSHGPRATFPAAPCLHRNPKVKLRLFPQEPAGLHLLSQMA
FT                   RQIVLATATLAEILGVPATEHNRLVEDMHDHEAKSAELHFALLTHMRTSFVNPLPREDM
FT                   YALSRYLNEAMEKLDAAAELVALYKLERLPRRAADQLEIISRQAELTVDAMRQLNNLDD
FT                   LEDYWIEILRLAKRAERTHRVWVADMIKDMKWAQYARNRDIANQLVEVTKDMRRIATQV
FT                   GSIIVKES"
FT   gene            complement(218022..218681)
FT                   /locus_tag="Arth_0208"
FT   CDS_pept        complement(218022..218681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lxx:Lxx18480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01609"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRD9"
FT                   /protein_id="ABK01609.1"
FT                   /translation="MSEQAGSKPYGGANRHHKPKPFAPIDFEPFAGGADPARVSEAAHL
FT                   AAQALVRHGRDSDDPKVTKRLVKLADEQGLEAIAEMWAESPARSLPGALWRLYALRAAT
FT                   IQDPERISVYFKAGKDTAQVSNVVAGAAEPPGADEMKTMADAILSGAFDGEFDVALERS
FT                   AAFCRVVALGQATLADGAEHSNENHASKLTRNSHLLVKTAEDLEHAANAWRLGELD"
FT   gene            218923..218995
FT                   /locus_tag="Arth_R0005"
FT                   /note="tRNA-Lys2"
FT   tRNA            218923..218995
FT                   /locus_tag="Arth_R0005"
FT                   /product="tRNA-Lys"
FT   gene            219011..220876
FT                   /locus_tag="Arth_0209"
FT   CDS_pept        219011..220876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0209"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: mfa:Mfla_1491 arsenite-activated ATPase
FT                   (ArsA); TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01610"
FT                   /db_xref="GOA:A0JRE0"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027541"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE0"
FT                   /protein_id="ABK01610.1"
FT                   /translation="MENLRLPGDRRPEVFCCQEVAALTSIDHRRYAGRVKFLQNAPRFL
FT                   FFTGKGGVGKTSVACATALTLARAGRKVLLVSTDPASNVGQVFGVTIGNTVTAIQDVPG
FT                   LSALEIDPEQAVEAYRERIIAPVRGLLPETELAGIAESLSGSCTTEIASFDEFTNLLAD
FT                   DSSYREYDHIVFDTAPTGHTIRLLQLPGSWTDFLAAGKGDPSCLGPLSGLEKHKQVYAK
FT                   AVQALTDPAKTRLVLVSRAQTSSLGEIERTYLELNQIGIGSGYVVVNGVLPDAAGEEAL
FT                   AQALRAREAAAMEAIPDAVAGLPRDVLDLKPGNMVGIPALESLFAPTSGAPITDDAALV
FT                   PEIEDAPLAALVNEVELDGHGLVMCMGKGGVGKTTVAAAIAVALAKRGHAVHLTTTDPA
FT                   AHLTETLHGSIPGLKVSRIDPEAAIQEYRIHVMETKGRNLDDDGRAALAEDLMSPCTDE
FT                   VAVFRQFSRVVQESRRHFVVIDTAPTGHTLLLLDATGSYHREIARQVGDTMGFVTPLMR
FT                   LQDPAQTKVVLVTLAETTPVLEAEELKSDLERAGIHPWAWVINNSIAAAHPQTPFLRAR
FT                   AASEIEQITKVHTLTDRVALIPLLPEEPIGEEKLSALTVLSSLPA"
FT   gene            complement(220925..221158)
FT                   /locus_tag="Arth_0210"
FT   CDS_pept        complement(220925..221158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01611"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE1"
FT                   /protein_id="ABK01611.1"
FT                   /translation="MDNETTATEDRLRAMLENVRTATANTRQAMDSPGDENWVQDGESD
FT                   AEYLRGIQRDTIARLEATARDIEALLAQRLDG"
FT   gene            complement(221231..221608)
FT                   /locus_tag="Arth_0211"
FT   CDS_pept        complement(221231..221608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0211"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG:
FT                   fra:Francci3_3239 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01612"
FT                   /db_xref="GOA:A0JRE2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE2"
FT                   /protein_id="ABK01612.1"
FT                   /translation="MSICVHNRPMNSLQTVEPALDEACCAPSGRPVLSAEDARRKALVF
FT                   KALSDPNRLRLLSIVKSGGSGEACVCDLTEPLDLGQPTVSHHLKILVDAGLLHREKRGT
FT                   WAYYSIVPGAMEQTAGLLASL"
FT   gene            221689..222786
FT                   /locus_tag="Arth_0212"
FT   CDS_pept        221689..222786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0212"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: nfa:pnf2250 putative arsenic
FT                   resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01613"
FT                   /db_xref="GOA:A0JRE3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE3"
FT                   /protein_id="ABK01613.1"
FT                   /translation="MSTQTVSSPTREGEAAVVGKLSTLDRFLPVWIIAAMVLGLFLGSF
FT                   VPGLNTALEAVKVGEVSLPIAIGLLVMMYPVLAKVRYDQAHRVVGDRKLMITSLVLNWL
FT                   LAPAFMFALAWIFIPDLPDYRTGLIIVGLARCIAMVMIWNDLACGDREAAAVLVAINSV
FT                   FQVIAFGALGWFYLQLLPGWLGLPTTSADFSFWAITASVLVFLGIPLLAGFLTRTIGEK
FT                   AKGRAWYEGTFLPKLGPWALYGLLFTITLLFALQGGTITSRPLDVVRIALPLLVYFLVV
FT                   FGAGMLIGRWLDLGYAKTTTLAFTAAGNNFELAIAVAIGTFGVTSGQALAGVVGPLIEV
FT                   PVLVALVYVALWARKRHFITSPLSI"
FT   gene            222813..223235
FT                   /locus_tag="Arth_0213"
FT   CDS_pept        222813..223235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0213"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: fra:Francci3_2325 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01614"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE4"
FT                   /protein_id="ABK01614.1"
FT                   /translation="MSTETAKKPSVLFVCVHNAGRSQMAAAFLTTLSKGAIEVRSAGSQ
FT                   PADKVNPAAVAAMAELGIDMSAEIPKVLTTEAVKESDVVITMGCGDTCPIFPGKRYEDW
FT                   ELEDPAGQGVDAVRPIRDDIKARIEDLIASLTPAAK"
FT   gene            223261..224250
FT                   /locus_tag="Arth_0214"
FT   CDS_pept        223261..224250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0214"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   sco:SCO3890 thioredoxin reductase (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01615"
FT                   /db_xref="GOA:A0JRE5"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE5"
FT                   /protein_id="ABK01615.1"
FT                   /translation="MSTEVSTEQLIIIGSGPAGYTAAIYAARAGLKPLVLAGSVTAGGA
FT                   LMNTTEVENFPGFPAGVQGPELMDGLQEQAQRFGAQVVFDDVTEVVLTGHLKRVVTGTG
FT                   DIHEAPAVILATGSAYKELGLPEEKKLSGHGVSWCATCDGFFFRDQDIIVVGGGDSAME
FT                   EATFLTRFARTVTVVVRKGELRASRIMAQRAKDNPKISFAWNSAVTAIHGDPKVTGVTL
FT                   TDTRTGETREQPATGIFVAIGHVPRTELVEGQVDLDAEGYIKVDSPTTVTNLSGVFACG
FT                   DAVDHRYRQAITAAGTGCAAALDAERYLAALDDADSIATALVEEPTHA"
FT   gene            224344..225729
FT                   /locus_tag="Arth_0215"
FT   CDS_pept        224344..225729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0215"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sco:SCO6828 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01616"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE6"
FT                   /protein_id="ABK01616.1"
FT                   /translation="MDVTTTLPVAVVGAGPIGLAAAAHLIERGLEPLILEAGATPASAI
FT                   EQWRHIRLFSPWQYNTDAAAVRLLARSGWEAPEPTALPTGGELIDHYLTPLAELPAIAS
FT                   RLHAGARVVAVTRHGMDKTHSRDRDTTPFVVRVEHADGEVRDYRAAAVIDASGTWSTRN
FT                   PLGTSGLPAPGEADAAARISSPLPDVLGRDRGAFAARTAVVVGAGHSAANTLINLSELA
FT                   AQVPGTKIVWAIRGSSAAKVYGGGDADGLAARGQLGSRLRGLVDSGAVELHTGFGIAYL
FT                   TAADGAVTLTSTDGRTLDADIVVPATGFRPDLGILRELRLELDPGVEAPRELGPLIDPE
FT                   FHSCGTVEPHGARMLAHPEADFYIVGMKSYGRAPTFLLATGYEQVRSVAAALAGDRQAA
FT                   DTVQLELPETGVCSSDIGTSCDIPAATPGGFVAETSGGCCGTPQPVLVGFPTGLAHGRS
FT                   GGN"
FT   sig_peptide     224344..224412
FT                   /locus_tag="Arth_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.380 at
FT                   residue 23"
FT   gene            225775..226221
FT                   /locus_tag="Arth_0216"
FT   CDS_pept        225775..226221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0216"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: nfa:pnf2260 putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01617"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE7"
FT                   /protein_id="ABK01617.1"
FT                   /translation="MTDHTEHRPGLQDKTPSVLFVCSKNGGKSQLAAGLMNQIAAGTVT
FT                   VHSAGTKPGKSLNPESVDALAELGIDITGEHPKPVTDDVLNAVDVVIVLGNEAKVEAPA
FT                   GKRLEVWDTDEPSERGIAGMERMRLVRDDIRSRVRKLYAELTGN"
FT   gene            226224..227435
FT                   /locus_tag="Arth_0217"
FT   CDS_pept        226224..227435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0217"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sco:SCO6809 integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01618"
FT                   /db_xref="GOA:A0JRE8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE8"
FT                   /protein_id="ABK01618.1"
FT                   /translation="MPAPAPTRILVAEGAPRGGLAAMCLTQTTAWGVLYYALVAAVPRI
FT                   SEDTGWGPAGVTGAFSAGLLVSAVAGIFVGRILDRTGPRTLMIGGSLIGVLALAIVSVA
FT                   PNLPVFFAAWLVAGAAQAAVLYQPAFTVISRWYGPARMRPLTVLTLVAGFASTIFAPFT
FT                   AALTDAFGWRGAFIILAGTLGIITVPLHARFLNRDWAPAAITPPAAERRDAVRTVRRSG
FT                   EFLGLQALMVLLCLGLYTVTLNVIPLLIEKGADYTTAALGLGLVGAGQVGGRLLFGAIP
FT                   QAARLPVITGTATGAALLLAVMPGPVPALMAAGMLAGAVRGCQTLLQATVVADRWGTQH
FT                   LGTLQGLFAAPLTAVTAIAPAAGPALATWLGSYTNMAYATAAATGTAAVIAVVASRRPR
FT                   RILP"
FT   gene            complement(227456..228259)
FT                   /locus_tag="Arth_0218"
FT   CDS_pept        complement(227456..228259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0218"
FT                   /product="Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B; KEGG: tfu:Tfu_0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01619"
FT                   /db_xref="GOA:A0JRE9"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRE9"
FT                   /protein_id="ABK01619.1"
FT                   /translation="MTQTLDRPPVLFLSHGAPPLADDARWTSELSAWSGAFGRPTDILM
FT                   VSAHWENAPVTLSATTRNPGLVYDFWGFPQKYYDVSYDAPRAVELATEVEKLVSTHGHH
FT                   VERDEERGLDHGAYVPLVEMYPEADIPVLQMSMPTLDPQGLFNLGKTLAPLRDRGTLIV
FT                   GSGFTTHNLRWFNPAGGPDTAPPAASSEFDHWAQETMAAGDVDSILDFLHKAPAALEAH
FT                   PRSEHWAPLYVALGAAYESGDLNAKTAIDGFWFGLSKRSWTLTGK"
FT   gene            228401..229456
FT                   /locus_tag="Arth_0219"
FT   CDS_pept        228401..229456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0219"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sco:SCO6349
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01620"
FT                   /db_xref="GOA:A0JRF0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF0"
FT                   /protein_id="ABK01620.1"
FT                   /translation="MRCRLAHNSFMAYSSERRLPRLEDVAERAGVSHQTVSRVINNHPN
FT                   VSKATRERVEAAIAELGYRRNTAARSLVTRRSHTIGVLASELSQYGPANTLLGVEQAAR
FT                   DAGYFVSIAAIREVGAESIADAARHFMDQGVDGIVALVPHAGTLQALEQLNLDVPVVVV
FT                   GSSGAGRFSGAMVDQKMGARLAVEHLIERGHKRIGHISGPRDWIDAAERAEGWREALAA
FT                   EGLPADLLVEGDWSAGSGYGIGQKLAVERNATAVFVGNDQMALGVLRAFSEAGVRVPRD
FT                   VSVVGFDDQPEAGYFTPPLTTVRQDFEELGRRCVDLMLRLLEDGAAAGTTVVEPRIVVR
FT                   ASTARPDASPR"
FT   gene            229616..230449
FT                   /locus_tag="Arth_0220"
FT   CDS_pept        229616..230449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0220"
FT                   /product="lipoprotein"
FT                   /note="KEGG: sco:SCO0195 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01621"
FT                   /db_xref="GOA:A0JRF1"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF1"
FT                   /protein_id="ABK01621.1"
FT                   /translation="MRRSIFTAGAGVAAIAAAIALAGPAQAADGDARLSVLHGVPGLTV
FT                   DVWVNGDRTLDDFVPGTFAGPLALPAGAYEIAITASDAADASAPVIGPVTVTLAASGNY
FT                   TAVANLDAAGKPTANFFTNDVSQIAAGKGKLTVRHAAAAPAVDVLAGGTAVISKLANPG
FT                   EQTLSLDPATISAAVAATGATTPLIGPADVTVAEGTHTIVYAWGSLADSNLQLAVQTIE
FT                   GLHSAPGSVPGARDGSSRTSAAGPAVVTVGFGAAALALLLGGVGVARTIAARRKG"
FT   sig_peptide     229616..229699
FT                   /locus_tag="Arth_0220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            230565..231281
FT                   /locus_tag="Arth_0221"
FT   CDS_pept        230565..231281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0221"
FT                   /product="peptidase C60, sortase A and B"
FT                   /note="PFAM: peptidase C60, sortase A and B; KEGG:
FT                   sco:SCO2841 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01622"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF2"
FT                   /protein_id="ABK01622.1"
FT                   /translation="MKPGTTTAGASRRRYSFLRRAAAGAAAALLLAACAPSEPVPQPSA
FT                   AVRSEGALPAATPSPPAAAPAASQSPAQSKESILRRPAKLPESAEAAPAPISLSVDGTS
FT                   INMTVVPVGVSPDRAMEIPEAFDQAGWYRFGPAPGAAAGTAVIAGHVDTTSEQAPFSQL
FT                   KTLAPGTAVQVGRRGAPALNYRVVSVELMAKDSFDGGSLFRRYGPHELKIVTCGGRWLQ
FT                   DRMDYSDNVIVTAALE"
FT   sig_peptide     230565..230702
FT                   /locus_tag="Arth_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.355 at
FT                   residue 46"
FT   gene            231398..233155
FT                   /locus_tag="Arth_0222"
FT   CDS_pept        231398..233155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0222"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /note="TIGRFAM: L-ribulokinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: pac:PPA2319 ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01623"
FT                   /db_xref="GOA:A0JRF3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF3"
FT                   /protein_id="ABK01623.1"
FT                   /translation="MDVIADGSDSYVVGVDYGTLSGRAVVVRVRDGKELGSGVFEYPHA
FT                   VVTEALPADLAGVTEGAAARLPGEWALQVPDDYREVLRRAVPAAIADAGIDPAAVVGIA
FT                   TDFTACTMVPVKADGTPLNELPGFANRPHAYVKLWRHHAAQPQADRINALAAAREESWL
FT                   PRYGGLISSEWEFAKGLQLLEEDPGAYAAMDHWVEAADWIVWQLCGNYVRNACTAGYKG
FT                   IYQDGGYPSEEFLSALNPDFKDFVSSKLEHTIGRLGDAAGRLTAEAAAWTGLPEGIAVA
FT                   VGNVDAHVTAPAAKAVEPGQLVAIMGTSTCHVMNGAELREVPGMCGVVDGGIVDGLWGY
FT                   EAGQSGVGDIFGWFTSNGVPPEYHRAAAEQGLGIHEYLTDLASRQAIGEHGLIALDWHS
FT                   GNRSVLVDHELSGVVVGQTLATRPEDTYRALLEATAFGTRTIVEAFRDSGVPVKEFIVA
FT                   GGLLKNKLLMQIYADITGLPLSTIGSAQGPALGSAIHAAVAAGEFPDIRAAAAAMGSEP
FT                   GGVYIPVPENVAAYEELFREYRALHDYFGRGTNSVMHRLKAIQRGARPSFAAAAEATSI
FT                   EAAGEEVPA"
FT   gene            233152..233832
FT                   /locus_tag="Arth_0223"
FT   CDS_pept        233152..233832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0223"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: blo:BL0273 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01624"
FT                   /db_xref="GOA:A0JRF4"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF4"
FT                   /protein_id="ABK01624.1"
FT                   /translation="MSSLLETIAQVRREVCELHAELTRYELVVWTAGNVSARVPGQDLM
FT                   VIKPSGVSYADLTPESMVVTDLYGAPADGEWGNPPFSPSSDTAAHAYVYRHMPEVGGVV
FT                   HTHSTYATAWAARGEAIPCVLTMMSDEFGGSIPVGPFALIGDDSIGQGIVETLRNSTSP
FT                   AVLMQNHGPFTIGKDARSAVKAAVMCEEVARTVHISRQLGEPLSIDQASIDSLYARYQN
FT                   VYGQ"
FT   gene            233867..235402
FT                   /locus_tag="Arth_0224"
FT   CDS_pept        233867..235402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0224"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="PFAM: L-arabinose isomerase; KEGG: aba:Acid345_0326
FT                   L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01625"
FT                   /db_xref="GOA:A0JRF5"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JRF5"
FT                   /protein_id="ABK01625.1"
FT                   /translation="MSNPNYTSANGTSLSQYEVWFLTGSQHLYGEDVLKQVAAQSQEIA
FT                   DALNGSSDVPVKVVWKPVLTDSDAIRRTALEANADDSVIGVTAWMHTFSPAKMWIQGLD
FT                   LLRKPLLHLHTQANVELPWADIDFDFMNLNQAAHGDREFGYIQSRLGIPRKTVVGHVSN
FT                   PEVTRQVGVWQRASAGWAAVRTLKLTRFGDNMRNVAVTEGDKTEAELRFGVSVNTWSVN
FT                   ELADAVHGAAESDVDALVAEYERLYEVVPELKAGGARHESLRYSARIELGLRSFLEANG
FT                   SAAFTTSFEDLGELRQLPGMAVQRLMADGYGFGAEGDWKTAILVRAAKVMGSGLPGGAS
FT                   LMEDYTYHLAPGQEKILGAHMLEVCPSLTATKPRVEIHPLGIGGKEDPVRMVFDTDAGP
FT                   GVVVALSDMRDRFRLVANAVDVVDLDEPLPNLPVARALWSPKPDFATSAAAWLTAGAAH
FT                   HTVLSTQVGMDVFEDFAEIAKTELLTIDEGTTIRQFKKELNWNAAYYRLAGGL"
FT   gene            complement(235433..236530)
FT                   /locus_tag="Arth_0225"
FT   CDS_pept        complement(235433..236530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0225"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: fra:Francci3_1988
FT                   peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01626"
FT                   /db_xref="GOA:A0JRF6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF6"
FT                   /protein_id="ABK01626.1"
FT                   /translation="MISARAGTGVRAGAALALLAILGSAVTGCTGADQRPAPASSSAAG
FT                   SPATGSSGTAPATRPGTPQAAADIPSIVENVQPSVVTVLTHGGLGSGVVFAAEGLILTN
FT                   EHVVRGNTEVEIAFADGQRVAGTVKATDAISDLALVEAKRTGLPAAKFQSELPRVGELA
FT                   IVIGSPLGFENTATAGIISGLHREIPGSAASSQSLVDLIQTDAAISPGNSGGAVVNSRG
FT                   EVIGISEAYIPPQSGAVALGFAIPAATAVRVAGQLREDGTADHAFIGLRPGEITSQIAD
FT                   TLGLENTRGALVLSVVDGGPADRAGIRPGDVLVSLDGKELASPEDLLAELRGKNPDQTV
FT                   NVGYRRGTEAKEAKVTLAARPASGG"
FT   sig_peptide     complement(236432..236530)
FT                   /locus_tag="Arth_0225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.370 at
FT                   residue 33"
FT   gene            236713..238260
FT                   /locus_tag="Arth_0226"
FT   CDS_pept        236713..238260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0226"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: sma:SAV5743 putative alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01627"
FT                   /db_xref="GOA:A0JRF7"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF7"
FT                   /protein_id="ABK01627.1"
FT                   /translation="MSTTESAAGRITAKITLDAAFTVGPVRRRTFGAFVEHLGRCVYTG
FT                   IFEPGHPKADGDGFRTDVLELTRELGVSTVRYPGGNFVSGYRWEDGVGPVEERPARLDL
FT                   AWHSTDPNHVGVDEFAKWSAKAGVEPMMAVNLGTRGTQEALDLLEYCNIDGGTAFSDQR
FT                   RANGAENGYGIKMWCLGNEMDGFWQIGHKNAMEYGRLAADTARAMRMVEPDLELVACGS
FT                   SAPTMATFGEWERVVLTETYELVDLISAHQYFEDFGDLQEHLSSGHRMEAFIKDIVAHI
FT                   DHVKSVKKSAKQVNISFDEWNVWHMSRDESKTPAGKDWPVAPVLLEDRYTVADAVVVGD
FT                   LLITLLRNTDRVHSASLAQLVNVIAPIMTEPGGRAWKQTTFHPFALTSEHAKGTVLQLA
FT                   VESPRLSGGKTADFAALSAVATFDAAAGEAVVFAVNRSATDSITLSAAVAGLGNAKVIE
FT                   SVTYANKDPYWQATADDSTSVLPGQNVSVKLDGGRLTAELPAVSWSMIRLAVDGAGS"
FT   gene            complement(238257..239255)
FT                   /locus_tag="Arth_0227"
FT   CDS_pept        complement(238257..239255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0227"
FT                   /product="glycoside hydrolase, family 43"
FT                   /note="PFAM: glycoside hydrolase, family 43; KEGG:
FT                   bfs:BF3514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01628"
FT                   /db_xref="GOA:A0JRF8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF8"
FT                   /protein_id="ABK01628.1"
FT                   /translation="MPPAASPLFRCPVFDGAADPTVIHRRGTGEWWMYYTARRATLATG
FT                   GVDWITGTRIGIAVSTDAGATWQYRGVVEGLDPEDSPGLNTHWAPEVVWHDGGYHMFLT
FT                   WGAGAPGTWAEQTRRRLVHFTSPDLEQWTFESRVDVGSENVIDAAFAVVADGRPRLWFK
FT                   DEVDGSTTWSAVREGAPEEADGRWRAEGQVIGLPAHEGPNVFRLGGWYWMVVDEWRGQA
FT                   VHRSADGLSWTRQEAGGGLILDAPGAGADDATYGRHADVVTQGDHAYIFYFTHPDWQDT
FT                   EMANGLADPARAVREQRTSIHAARLHVEGDVLVCTRDLDAPVHLDPALLED"
FT   gene            239406..240410
FT                   /locus_tag="Arth_0228"
FT   CDS_pept        239406..240410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0228"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: blo:BL0185
FT                   LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01629"
FT                   /db_xref="GOA:A0JRF9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRF9"
FT                   /protein_id="ABK01629.1"
FT                   /translation="MAVTMNDVARAAGVSLKTVSNVLNDYEFIRPATRQKVLDAIAELG
FT                   YEANLTARSLRSGKTRMLGLVLSDLSIPYYAELASRLMTVAAARGYRVLVEQSGATAAN
FT                   ELSALKGPFRQLTDGLLFTPLTLDAGTVAAHRGAKPVVMLGEHIADPRFDLVTMKNAEA
FT                   AAAITGHLLARGRRRIAVLGASAGDTTDSPGLRLNGYRQALDAAGVDFDPALVVQCDWR
FT                   RDGGASAVGGLLGSGVRFDAVFGLNDAIALGALHELLIRGISVPDDVAVAGFDDIDEAR
FT                   FASPSLTTVSPGMAEIAERSVALLVDRIEGVEPAAEGLRVEAGFELKIRDSAP"
FT   gene            240546..241400
FT                   /locus_tag="Arth_0229"
FT   CDS_pept        240546..241400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0229"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: lxx:Lxx16260
FT                   high-affinity iron transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01630"
FT                   /db_xref="GOA:A0JRG0"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG0"
FT                   /protein_id="ABK01630.1"
FT                   /translation="MTANYLIGLREGLEATLIVVLLMAYLLKTGRQHLLPRLWAGVAVA
FT                   VSVSAGFGALLTFGPRGLTFEAQEAIGGGLSVVAVGLVTWMVFWMARTARSLGTELRSQ
FT                   VDRAADGAGWGLAVVAALAVGREGLETALFLWAAAQATGESATPLFGALLGLATAVLLG
FT                   FLLHRGVLRINLGAFFTWSGAALVVIAGGVLAYAVHDFQEAGILPGLHSLAFDVSAAVP
FT                   PSSWYGTVLKGTLNFSPATTWLEAAAWLLYVPAVLFFYLRSNRRGRASSQPDTAARAAV
FT                   AAF"
FT   gene            241436..242665
FT                   /locus_tag="Arth_0230"
FT   CDS_pept        241436..242665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0230"
FT                   /product="protein of unknown function DUF451"
FT                   /note="PFAM: protein of unknown function DUF451; KEGG:
FT                   lxx:Lxx16270 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01631"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG1"
FT                   /protein_id="ABK01631.1"
FT                   /translation="MPSPSLPEFDRSAAARTPGRRQSAAARLAAAAAVAVLPLTMAACT
FT                   DNAAPASTAGAVGPIQVTSTGDACKVSTASAKSGNLTFAVQNDGEQVTEFYLLAEDGLR
FT                   ILGEVENIGPGLTRNLVVTVPAGKYTTACKPGMEGDGIRAGFEVTESGSQPAVDSDLKA
FT                   LSDHGTAQYVAYVKDQTEQLLAGTKKFAEAYASGDAATAKNLYAATRMHWERIEPVAES
FT                   FGDLDPKLDAREADLAEGEEWTGWHRAEKDLFPPAGFQPLAAAEREKLAAQLVADTEEL
FT                   AQRTRTVELTADKLGNGAKELLDEVATGKVTGEEEIWSHTDLWDFQANVDGARIAFENL
FT                   KPVLAQKDPELSKSLDTKFAALQAELKTHAKGDGFAYYNELSPEQVQRLAALVDSLGEP
FT                   LSNLTAAVVL"
FT   gene            242698..244047
FT                   /locus_tag="Arth_0231"
FT   CDS_pept        242698..244047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0231"
FT                   /product="Tat-translocated enzyme"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   Tat-translocated enzyme; Dyp-type peroxidase family; PFAM:
FT                   Dyp-type peroxidase; KEGG: lxx:Lxx16280 putative
FT                   iron-dependent peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01632"
FT                   /db_xref="GOA:A0JRG2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG2"
FT                   /protein_id="ABK01632.1"
FT                   /translation="MGDTSQAPASADSAPNGAADAKAAAARGVSRRGLLSFAGVGGAGA
FT                   LAGIAAGLWGRDAVFAAEPAVEPADDTVPFHGERQAGITTAAQDRLHMAAFDVLTEDRD
FT                   ELIRLLKDWTAASEAMTQGRETGETGAAGGSYDAPPQDTGEALGLSAGKLTVTFGFGAS
FT                   LFEKDGKVRFGLEGRRPDALIDLPHFPGDDLQAGRSGGDIIVQACADDPQVAVHAVRNL
FT                   ARLGFGKVRVRWSQLGFGRTASTSRAQQTPRNLFGFKDGTNNLKVEDTELLENHVWAGA
FT                   GTRPGEAWMEGGSYLVARRIRMHIEIWDRTSLGEQEALIGRTKAEGAPLSGGKEFTAPD
FT                   FTIKGKDGKPLMGLDSHVRLAHADQNGGVRMLRRGYNYTDGSDGLGHLDAGLFFIAFVK
FT                   DPRTHYVPMQMAMAKQDTLAVEYLKHTGSALAAVPPGTRPGGFLGEGLFS"
FT   gene            complement(244040..245242)
FT                   /locus_tag="Arth_0232"
FT   CDS_pept        complement(244040..245242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01633"
FT                   /db_xref="GOA:A0JRG3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG3"
FT                   /protein_id="ABK01633.1"
FT                   /translation="MTALRVPVATVLPEDAEDALLIGRLWDVDTSGPRVVAVQGGDVFD
FT                   LQHLAGTVSELLERADPAADVRAAMSTPRWKTADVVSASLRQDITRPHLLAPVDLQVIK
FT                   ACGVTFVDSMIERVIEERCGGDAGRATEMRDLVGKSLGGSIGEVRPGSPEAAKAKRVLM
FT                   AEGLWSQYLEVGIGPDPEVFTKAPVLSSVGLGAGVGIPAFSSWNNPEPELVLIATSGGK
FT                   VVGATLGNDVNLRDVEGRSALLLGKAKDNNASSALGPLIRLFDGGFTLETLRQEEILLR
FT                   VEGADGYRLEGRNTVARISRPFEELVAATFGSHHQYPDGFALFTGTLFAPTQDRHEPGQ
FT                   GFTHKMGDVVTIRSRHLGALVNTVGAAEELPPWHFGLRQLFAYLAGEERSASAAGAASV
FT                   S"
FT   gene            complement(245239..246711)
FT                   /locus_tag="Arth_0233"
FT   CDS_pept        complement(245239..246711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0233"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: sma:SAV6389
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01634"
FT                   /db_xref="GOA:A0JRG4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG4"
FT                   /protein_id="ABK01634.1"
FT                   /translation="MNTTAGQLNASVEAAHAAFEKARLAGPGTRAAWLEAVAAGLEGDA
FT                   VTLIGIAAAETHLAEPRLQGELKRTVFQLRLFADEIRRGEHFDATIDHEDAAWGMGPRP
FT                   DLRRYNVPLGVVGVFGASNFPFAFSVMGGDSASALAAGCAVVHKAHDGHRELAVRTAET
FT                   VTTALEAAGAPSGLFSLVTGRQAAEALVEHPLVKAIGFTGSTAGGRALFDRAAARPEPI
FT                   PFFGELGGINAVFVTGNAWSARREEILGGFAGSFTLGMGQFCTKPGVLFLPAGETEKVR
FT                   DSLRKALADFAPAPLLSERLHEGFRQAVAGLRDTAGVQVLVDGDFAESPAPTVLMTTAD
FT                   AVRRDPGILRQEMFGPASLVVEYNDDSELAALAGLLEGQLTTTLQAEAEDDVAELAGRL
FT                   ADISGRLLWNGWPTGVTVSYAQHHGGPYPATTSGTTSVGTAAIRRFLRPVAFQSFPEPR
FT                   LPEPLQDANPWNVPQRVDGVWQRPSAQPDGQP"
FT   gene            complement(246708..248054)
FT                   /locus_tag="Arth_0234"
FT   CDS_pept        complement(246708..248054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0234"
FT                   /product="L-fuconate dehydratase"
FT                   /EC_number="4.2.1.68"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: sma:SAV7282 mandelate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01635"
FT                   /db_xref="GOA:A0JRG5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG5"
FT                   /protein_id="ABK01635.1"
FT                   /translation="MPSITSITTQDVRFPTSLELDGSDAVNVDPDYSAAYVVIRTDAGD
FT                   EGHGFVFSCGRGSEILTAAINSYAELLRGRDIEELIYDLGSASKRLIHDSQLRWLGPEK
FT                   GVTQMAAGALVSALWDIRARRENKPLWLLLSEMSPEEIVDVVDFTHIRDALNPQQALDI
FT                   LRAGQDGKAARIASLRADGYPAYTTSPGWLGYSDEKLVRLSKEAAAAGFSMIKLKVGGD
FT                   LADDRRRMALARQAVGNLPIAIDANQRWEVSEAIEWVNQLAEFNPYWIEEPTSTDDILG
FT                   HADIRKGVAPVRVATGEAVASRIVFKQLLQAGAIDVLQLDSTRVGGVNENIANLLLAAK
FT                   FGVPVCPHAGGVGLCELVQHFSFFDYAAITGSQDGRMIEYVDHLHEHFAEPVRIVGGRY
FT                   AAPERPGTGAEMLSASRTRWEFPSGAGWLEVGNRAAVTGASLAPAGAGR"
FT   gene            complement(248189..248917)
FT                   /locus_tag="Arth_0235"
FT   CDS_pept        complement(248189..248917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0235"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: sme:SMa0267 putative GntR-family regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01636"
FT                   /db_xref="GOA:A0JRG6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG6"
FT                   /protein_id="ABK01636.1"
FT                   /translation="MPPRQSSDISRGKAAVSDVYSSMRASILEGEIAPGTRINIDAVSR
FT                   SLGVSQTPVREVLQRLEGDNLVVYNPGRGYSTTPLLDLAELRSLFEFRLLVEPWAARSA
FT                   AVDRLANPSAALEKEITAFRGAMTSSGDLRQDLVAHDTRFHDTILAAAGNTVVRHAFAQ
FT                   THCHLHTFRLYPADVDGAITVAEHSAVREAIKACQPEQAEAAMAEHIRNSFARFAQAFE
FT                   DHADLAPLEDGGPPRRHIVD"
FT   gene            249162..250502
FT                   /locus_tag="Arth_0236"
FT   CDS_pept        249162..250502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0236"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B1357 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01637"
FT                   /db_xref="GOA:A0JRG7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG7"
FT                   /protein_id="ABK01637.1"
FT                   /translation="MTALGSKVASTSSPKNPRLMTRKRWVIIWLAFIGLSINYLDRSSL
FT                   SVALPFMGKDFELTATQQGLIFAAFFWAYDFCQLAAGWYVDKVGPRKSFSLAALWWSVF
FT                   TMVTAAATSFWSLFAARFLLGVGESPAPSTAAKVVATWFPVRERAFATSIWDSGSRVGA
FT                   VIALPIVTLIVALTSWHAVFIIIGIAGVIWAAVWWKVYRSPQEHPGANAAEVAYIEEGG
FT                   ARGEGSDDANAAKLPWRSLFKYRTILSMMFGFFCLNSAIYFFITFFPSYLVKERGFDLL
FT                   KLGFFGAIPGICAVLCGWLGGYLADRAVRAGASVTKVRKTAIAGGLAGGSVIMFAALVP
FT                   EAWMALALLSVAYSSLTVAATGIWSLPADVAPSSKHVGSIGGLQNFASNLAGIFTPILI
FT                   GVLVDQTGSFVAPLAVIGAISLVGAANYLFVMGKIEPLKVKEPVAVA"
FT   gene            complement(250598..251560)
FT                   /locus_tag="Arth_0237"
FT   CDS_pept        complement(250598..251560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0237"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="PFAM: PfkB domain protein; KEGG: pol:Bpro_2756 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01638"
FT                   /db_xref="GOA:A0JRG8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG8"
FT                   /protein_id="ABK01638.1"
FT                   /translation="MDASQQLGSKPILTLTVNPALDISTSTEQVSSGHKLRCGASRLDP
FT                   GGGGINVARVIQRLGGQTLAVYTAGGPTGEAYRRLIEAERIPTLVVPIQGSTRQDFTVD
FT                   ETSTGKQFRFVLQGPELKEPEWQACLDLVAASMPMGGYVVASGSLPPGVPDDFYARVAR
FT                   LARQAGAHCVVDASGPALTEALAAGVFLVKPSLRELGTHFGAALDTEPSQVDAASALVA
FT                   DGAAEHVALTLGESGALLASKSGLIRLTVPKVPVVSTVGAGDSFLGAFVLRLAQGQPLD
FT                   AAFRAAVAAGSATVMTPATELCHRADVERLEAELANTAP"
FT   gene            251632..252267
FT                   /locus_tag="Arth_0238"
FT   CDS_pept        251632..252267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0238"
FT                   /product="DedA family protein"
FT                   /note="KEGG: plt:Plut_0566 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01639"
FT                   /db_xref="GOA:A0JRG9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRG9"
FT                   /protein_id="ABK01639.1"
FT                   /translation="MQAFFDGLLNASPVLVACVVFAFVFAEDALFIGFVIPGETAAVVG
FT                   GVIAGKGSIPLAAMIAVVVSAAILGDTVGYEIGKHLGPRLMSLKTFDRKRHQLEKAQEF
FT                   LKRRGGPAIFLGRFTAFFRAAMPALAGLSGMPYRRFALWNITGGVLWGSLFVTLGYLAG
FT                   NLYDEVARTAGSAAAIVVAAVAVGVLVTWRIRRHRQSTAADSSAHPQR"
FT   sig_peptide     251632..251712
FT                   /locus_tag="Arth_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.899 at
FT                   residue 27"
FT   gene            complement(252325..253851)
FT                   /locus_tag="Arth_0239"
FT   CDS_pept        complement(252325..253851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0239"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: fra:Francci3_0800 HNH
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01640"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRH0"
FT                   /protein_id="ABK01640.1"
FT                   /translation="MGASLAALAACAGCGAGRGAGNGAGNLASSGADPLRDEADACLDG
FT                   LAGVGGLEAMLAALKVHFAAGYVRAAAALTAPAVSPQERTARAMAVTAEVACVLTVSER
FT                   SAAALLADSVILTTRLPLTLSALRSGGISWQHARVMCDETSGLDPVAAAALEGHFLDPE
FT                   APFAARGCPAGELVPGRFRAKARSWRERHHPVSLEARHRKAVTDRRLDYAPDRDGMAWL
FT                   SAYVSADVAAGVWARATDAARALQGPAESRTLTQLRADVAADWLIAGIAEGVPSPKAQV
FT                   LVTVPVLSLLGAGTEPATLDGYGPVPPSMARRLLGEGAGSFLRVLTDPRSGAPLEIGRS
FT                   SYPVPKAMRQWLRLRDGRCPFPGCNNHSLDNEADHLLAWSAGGGTDITNLGQPCPKHHR
FT                   LKHTTAWTPVDATRDQPPRWISPAGRSYPSEQQDWEPPHWPDLPAGAEPAGENPAVEDD
FT                   DPGWVPEWEPPHWPDLPAGAEGSTGATGPGETGPPLPADPFPDWALFIAA"
FT   sig_peptide     complement(253792..253851)
FT                   /locus_tag="Arth_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.401 at
FT                   residue 20"
FT   gene            254269..254571
FT                   /locus_tag="Arth_0240"
FT   CDS_pept        254269..254571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV2403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01641"
FT                   /db_xref="InterPro:IPR025242"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRH1"
FT                   /protein_id="ABK01641.1"
FT                   /translation="MATDYDEVRSDVKESQENSLEALQSANAPDARSVVRELDETDALD
FT                   DGMVPGGEFVAEELVVQVIPQAQDEFTCYSCFLVRHRSQIAREKNGHAYCVECEG"
FT   gene            254686..254988
FT                   /locus_tag="Arth_0241"
FT   CDS_pept        254686..254988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0241"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: cgb:cg0113 probable urease gamma subunit;
FT                   TIGRFAM: urease, gamma subunit; PFAM: Urease, gamma subunit
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01642"
FT                   /db_xref="GOA:A0JRH2"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JRH2"
FT                   /protein_id="ABK01642.1"
FT                   /translation="MHLMPREQEKLMIVVAADLARRRQARGLKLNFPESVAIISYELIE
FT                   GARDGRTVADLMSYGTTLLTRDDVMEGVPEMIHDVQIEATFPDGTKLVTVHDPIR"
FT   gene            254997..255344
FT                   /locus_tag="Arth_0242"
FT   CDS_pept        254997..255344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0242"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: cef:CE0994 urease beta subunit; TIGRFAM:
FT                   urease, beta subunit; PFAM: Urease, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01643"
FT                   /db_xref="GOA:A0JRH3"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JRH3"
FT                   /protein_id="ABK01643.1"
FT                   /translation="MIPGEYVLGSTPVVINAGRDAIDVVVVNTGDRPVQVGSHYHFAEA
FT                   NAALAFDRAAAYGRRLDIPAGTAARFEPGDSKTVRLIELAGSREVYGLSNAVNGTLDAG
FT                   NARQEAKTEAK"
FT   gene            255341..257071
FT                   /locus_tag="Arth_0243"
FT   CDS_pept        255341..257071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0243"
FT                   /product="urease, Metallo peptidase, MEROPS family M38"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: cgb:cg0115 urease alpha subunit; TIGRFAM:
FT                   urease, alpha subunit; PFAM: amidohydrolase; Urease
FT                   alpha-subunit domain protein; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01644"
FT                   /db_xref="GOA:A0JRH4"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JRH4"
FT                   /protein_id="ABK01644.1"
FT                   /translation="MSFELTRRQYADLYGPTTGDSIRLADTELFLEIEKDLTVYGEEVV
FT                   FGGGKVIRDGMGQNGQVTRDEDVPDTVITNAVILDYTGIYKADVAIRDGHIIKIGKAGN
FT                   PQITDGVDIVIGASTEIIAGERKILTAGGVDTHIHFISPDQVPTALTSGVTTMVGGGTG
FT                   PAEGTKATTVTPGKWHIQRMLQATEGMPINIGLFGKGHASAVEPLAEQIRAGAIGLKVH
FT                   EDWGSTTSSIDNSLKVADEYDVQVAIHTDTLNECGFVEDTIRAIGGRVIHTFHTEGAGG
FT                   GHAPDIIKIAGLPNVLPASTNPTLPYTRNTIEEHLDMLMVCHHLNPDIPEDVAFADSRI
FT                   RAETIAAEDVLQDLGIFAITSSDSQAMGRVGEVITRTWQVADKMKKQRGVLKDPAGGAH
FT                   GSEDSDNFRLKRYVAKYTINAAIAQGMADSIGSVEEGKFADLVLWDPAFFGVKPELVLK
FT                   GGQIAYALMGDANASIPTPQPRTMRPMFAAFGKAVQQSSITFLSQAAIDAGVPEELGLQ
FT                   KVIRAVSGIRSLSKADLKYNDATPDIQVDPETYKVTVDGEDVTCEPADVLPMAQRYFLF
FT                   "
FT   gene            257094..257579
FT                   /locus_tag="Arth_0244"
FT   CDS_pept        257094..257579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0244"
FT                   /product="UreE urease accessory domain protein"
FT                   /note="PFAM: UreE urease accessory domain protein domain
FT                   protein; UreE urease accessory domain protein; KEGG:
FT                   cef:CE0996 urease accessory protein UreE"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01645"
FT                   /db_xref="GOA:A0JRH5"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JRH5"
FT                   /protein_id="ABK01645.1"
FT                   /translation="MIIEKILGNLHELPASEAGAFAGLHQEKVVLPSAQLVKRIQRVTT
FT                   DHGKELGIRLPAGSGDLRDGDILHVAETNMIVISVLPTDVLVVAPRSIHEMGVVAHSLG
FT                   NRHLQAQFFDAGSEYAADVMVCQYDHTVEDYLKHVGVPYERQERVMPVPFRHAEHSH"
FT   gene            257584..258261
FT                   /locus_tag="Arth_0245"
FT   CDS_pept        257584..258261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0245"
FT                   /product="Urease accessory protein UreF"
FT                   /note="PFAM: Urease accessory protein UreF; KEGG:
FT                   cef:CE0997 urease accessory protein UreF"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01646"
FT                   /db_xref="GOA:A0JRH6"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JRH6"
FT                   /protein_id="ABK01646.1"
FT                   /translation="MAAAGSYQLALQQLTDSALPTGAFAHSLGFETYIERGLVHDEASF
FT                   GVWLSAFVGQQLSYSDGLAIRFLYEGVSFAELDALLTAQLLPRQLREASTKMGTRLLEI
FT                   GTEVFPSPELAEYRALVGAGRAAGHQPLAFAVVARSLGVPLTESLAAYLFAAVTSLTQN
FT                   AVRAIPLGQNAGQRLLRKASDDVAAAVERIGRLAPDDFGAVSPGLEISQMRHERQRARM
FT                   FMS"
FT   gene            258274..258891
FT                   /locus_tag="Arth_0246"
FT   CDS_pept        258274..258891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0246"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein, P47K; KEGG: cgb:cg0118 urease
FT                   accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01647"
FT                   /db_xref="GOA:A0JRH7"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRH7"
FT                   /protein_id="ABK01647.1"
FT                   /translation="MSEPIKIGIGGPVGAGKTQLVERLTRHMSREISMAAITNDIYTIE
FT                   DAKILAANGILPEDRIIGVETGGCPHTAIREDTSMNTAAIEELKKRHPDLQVIFVESGG
FT                   DNLSATFSPELVDFSIYIIDVAQGEKIPRKAGQGMIKSDLFIINKTDLAPHVGADLAVM
FT                   ERDSREFRGEKPFCFTNLKTDEGLDAVIEWVRRDVLMLDLAS"
FT   gene            258984..259769
FT                   /locus_tag="Arth_0247"
FT   CDS_pept        258984..259769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0247"
FT                   /product="Urease accessory protein UreD"
FT                   /note="PFAM: Urease accessory protein UreD; KEGG:
FT                   cgb:cg0119 urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01648"
FT                   /db_xref="GOA:A0JRH8"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JRH8"
FT                   /protein_id="ABK01648.1"
FT                   /translation="MAAHQYHRGALRILRPHYLDDSGQVCYVVVNPGGAYLGADLYVID
FT                   VEVGDGAKLLLTTQSATKIYRTPGSFAEQRVCLRLGEGAQLELAPDQLIAYREASYRQN
FT                   TRITVRPSSSLVMAEVVTPGWSPDGASFRYEELRLRNEIQVETPGGTGLLALDNLLIRP
FT                   PLNDVTGMGFMEGYSHLGSLVVVDARVEQALADEFHALTAGHDACTGVSLTASVGGTTG
FT                   LVLRSLSNSTEELNRLLGACTALLRERWYGQSPLNLRKY"
FT   gene            259769..260821
FT                   /locus_tag="Arth_0248"
FT   CDS_pept        259769..260821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0248"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   sma:SAV2333 high-affinity nickel-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01649"
FT                   /db_xref="GOA:A0JRH9"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRH9"
FT                   /protein_id="ABK01649.1"
FT                   /translation="MTTLTGFAAMYRDREQLPLRTRLLFALGAVAALHLAAVVLLLVSS
FT                   AGAAQPLALGLVLTAYLAGIKHSYDWDHIAAIDNSTRKFVAQHKDPVSVGFAFSLGHSS
FT                   VVILAGALVVGGAAMVGQFMEDGTTGNLVLGLIGSGVSGLFLLAMGLFNGSAFLRAARA
FT                   YRNVQGGCELREGDLEAKGFVACLLAKPLSKVRRPRNIYVIGFLFGLGFDTATTIGLLV
FT                   MTTAASLAGVSPLALLALPMAFTAAMTLCDTVNGVAMMRMYRSAIHNPQRKLGFNALIT
FT                   GISAVSALFISAITLGGFFNAALGLEDPLTTWLGTVDLGEAGLLLVGVLLAVWCVAAWR
FT                   GRVKGASTAV"
FT   sig_peptide     259769..259915
FT                   /locus_tag="Arth_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.740 at
FT                   residue 49"
FT   gene            260889..261473
FT                   /locus_tag="Arth_0249"
FT   CDS_pept        260889..261473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0249"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; KEGG: mpa:MAP2628c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01650"
FT                   /db_xref="GOA:A0JRI0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR017658"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI0"
FT                   /protein_id="ABK01650.1"
FT                   /translation="MELHITGDPAADKLLSDDAFALLTGMLLDQQVTMESAFAGPEKIR
FT                   TRIGSMDPAAIAGYNPQDFVEMFKERPAVHRFPGSMAGRVQALAETVHQDWNGDATAIW
FT                   TQGDPDGPEVLRRLKALPGFGEQKAKIFLALLGKQCGLQAEGWREAAGHYGQQDSYLSV
FT                   ADIVDPESLTKVRASKQAAKAAAKAAKTAGH"
FT   gene            261512..263062
FT                   /locus_tag="Arth_0250"
FT   CDS_pept        261512..263062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0250"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; FAD dependent
FT                   oxidoreductase; KEGG: mma:MM1656 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01651"
FT                   /db_xref="GOA:A0JRI1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI1"
FT                   /protein_id="ABK01651.1"
FT                   /translation="MGDQLAGRLGSLWAATGGPVQYAALDEDLHGALDVDVAVIGGGIA
FT                   GLTAALALKRAGQTVAVLEAARVGTGVTANTTGKVTSLHRLAYTELAGRHGKEAARTYG
FT                   QANEAAIEHVADTVAGEGIDCGFRRVSNYTYAESERALALVREEAALAGRLGLPASFTT
FT                   EVPLPLPVGSFPVAGAVRFDNQAQIHALRYVQGLARAVDGGGSFVFEDSPATGFRDGSP
FT                   AVVDTERGSVRAKEIIVATNMPFGDNGFFAGRTYAHRSYIVAAHTDAAPLDSTFVSVEE
FT                   PMRSILTTDVDGVSYVLAGGEGHPASEQVDSAERYGRLAAFARDRLGAGEIAFRWSTQD
FT                   AMPADGLPFVGRLSQDFRHIHVITGLRKWGLTNGTAAALILRDLLCGRTNPWAALFDST
FT                   RTVPAQGAVPPASDLREAAPPREPPQRTPAAPPEAAPGQGRVVDVNGAKTAVYVSPAGG
FT                   VSAVSAVCTHLGCTVEFNAADVTWDCPCHGSRFSTDGTVIQGPATRNLAASPAPADPG"
FT   gene            complement(263076..263684)
FT                   /locus_tag="Arth_0251"
FT   CDS_pept        complement(263076..263684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0251"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; Tetracyclin
FT                   repressor domain protein; KEGG: sco:SCO7785 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01652"
FT                   /db_xref="GOA:A0JRI2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI2"
FT                   /protein_id="ABK01652.1"
FT                   /translation="MGRPLLPLISVEALTTAALELVDESGDFSFPKLAKKIGVSQSSIY
FT                   NHVSGRDEILELLRHRIITEEPYPPVDHSDWEAALRVLIRAYRDAFVRHPRLAPLLVLQ
FT                   TITDPDVIGLYEDLALALEAAGFRGRDVVAAISTIDSFALGAALDLAAPDIVWDPPAEG
FT                   YPTLKRAVGNAGPSEQRGGHAFDFGLDVIIGGLRAKLAG"
FT   gene            263840..265297
FT                   /locus_tag="Arth_0252"
FT   CDS_pept        263840..265297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0252"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   nfa:nfa27870 putative permease; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01653"
FT                   /db_xref="GOA:A0JRI3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI3"
FT                   /protein_id="ABK01653.1"
FT                   /translation="MPDTQTRPPTSSADGSLKRNALGTGGIAFLVISAAAPLTVMAGVA
FT                   PVAIGVGGIGAPAGYLMAGIVLTLFAIGFMAMTRHVKASGGFYTYISLAMGKTVGLASA
FT                   ILAIVSYNCLQIGVYGLFAVQTHDMFKVLFGLEVPWPAIALAAVAAVWFLGYRGIDVGA
FT                   KVLGVLLVAETGILAVMGAGILGSGGAHGISAGSFSPENAFGPGVLAILGICFAAFMGF
FT                   ESTVLYRSEARNPDKSVPRAMYIAVGFMSVFYAFIVWTVVQAYGEDRAVEAAGELAGGM
FT                   FFQTINHYVGPWAEVVMYVLIVTSVYASQLAFHNAINRYVYMLARDGVLPAFLGRTHRR
FT                   FQSPHRAGQLQTILAAVVIAVCALLNADPYQQLLIWVNTPGIFGIVGLQGLVSVAAFLY
FT                   LRRNPAAATHKLMVPLSLASAILLFGVVLLIGLNIELLTFADTLTNTILILVAPLVFTA
FT                   GLLAARWVRRHRPATFAQIGSFETHES"
FT   sig_peptide     263840..263968
FT                   /locus_tag="Arth_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.900 at
FT                   residue 43"
FT   gene            265287..266942
FT                   /locus_tag="Arth_0253"
FT   CDS_pept        265287..266942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0253"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bms:BRA0635
FT                   twin-arginine translocation signal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01654"
FT                   /db_xref="GOA:A0JRI4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI4"
FT                   /protein_id="ABK01654.1"
FT                   /translation="MNPDVIILADTIHTMEGGSAQGPAPQAVAVRDGVIAAVGSRSDAE
FT                   AWPAAEVVDFGSAVLTPGLVDCHIHPVFGLDLTRGCDLSGAKDLAEVRALLRATAEATP
FT                   PGDWVRAWGLDPNVFGSAAAHRELIDDVVSGQPCLIRLFDGHSALASSRALEIAGVTGP
FT                   RAFDQASEVVCDPGGRPTGLLLEAAAIELVARLMPAESFDGRKARLAELFRQFSRSGLT
FT                   GAHVMDCGEGSLELFRALEEDAADSIDGGLPLRLRISPWCMPGSGEEDWRRLAEQIGVG
FT                   GKRWEVAGIKLFVDGTVDNGTAWLFEPDTYGESVTPFWPRPEEYAAAVRFFAGRGISTA
FT                   THAIGDAGVAAVLDAFESLPPAVRSAAPEAVHRIEHLETVPDALIERFSRAGLVASMQP
FT                   THCTHYSRADQSDNWSTRLGTERANNAWRCADLRSAGTTLGLGSDWPIAPFEPLPILAD
FT                   AQLRRRSGHPGEQPVVPGQALTALQALEGYTSHAAKAAGEWAVSGSVTVGKRADFTVFD
FT                   VDPLTVAPDDLAAARVLATFVDGRAQHLTVGSAR"
FT   gene            267156..267515
FT                   /locus_tag="Arth_0254"
FT   CDS_pept        267156..267515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01655"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI5"
FT                   /protein_id="ABK01655.1"
FT                   /translation="MAIARFPSFVIDCPDPKALAGFYGALLGWNERVDDGWVEIRPDDG
FT                   SNCIAFQQVDGYQAPEWPGQAHPQQMHMDMVVEDLDDGEQEAIRLGATKAETQPGTTFR
FT                   VFLDPAGHPFCLCLS"
FT   gene            268037..269080
FT                   /locus_tag="Arth_0255"
FT   CDS_pept        268037..269080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0255"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   oih:OB0786 NADP-dependent alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01656"
FT                   /db_xref="GOA:A0JRI6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI6"
FT                   /protein_id="ABK01656.1"
FT                   /translation="MLTANAYAAPSADGDLVPTTIERRDVGPHDVLIGIKFAGICHSDI
FT                   HTVRGDWGPQQYPLAPGHEIAGIVTDVGSEVTKHAVGDRVGVGCMVNSCRECVNCQKGE
FT                   EQYCLKGNIGTYGAVDRDGTITQGGYSTHVVVTEDFVVRIPEGIELDVAAPLLCAGITT
FT                   YSPLHHWGAGPGKKVAVVGLGGLGHMAVKIAHAMGAEVTVLSQSLKKQEDGLKLGADHY
FT                   YATSDENTFSDLAGSFDLIINTVSASIDISSYLQLLTLDGALVNVGAPAEPLPVNAFAL
FT                   IAGRRSFAGSMIGGIRETQEMLDFCAEHNLGAEIEVIPAEKINEAYERVLASDVRYRFV
FT                   IDTATLN"
FT   gene            complement(269187..272204)
FT                   /locus_tag="Arth_0256"
FT   CDS_pept        complement(269187..272204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0256"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; alpha
FT                   amylase, C-terminal all-beta; SMART: alpha amylase,
FT                   catalytic sub domain; KEGG: sco:SCO2226 bi-functional
FT                   protein (secreted alpha-amylase/dextrinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01657"
FT                   /db_xref="GOA:A0JRI7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI7"
FT                   /protein_id="ABK01657.1"
FT                   /translation="MVAALVAAAALAAPAQAAPEPKGPGAPSASHSLRAPVTDENFYFV
FT                   MADRFSNGSSANDDGGLGSDPMVSGYDPTKKGFYNGGDLKGLLDKIDYIQGLGTTSIWL
FT                   TPSFKNKAVQPEDKSAGYHGYWVTDFTQIDPHLGTNAELKALIDEAHSRGMKVYFDIIT
FT                   NHTADVIGYKEGARTAYKSKDVAPYKTADGEVFDDRDYAGTDTFPELDPATSFPYTPVL
FT                   DEAEKDLKVPGWLNNPALYHNRGDTTFQGEDSFYGDFFGLDDLFTENPEVVDGMTKVYE
FT                   DWIKDFGVDGFRIDTMKHVNDEFWQEFGPKVLEYAKEQGKDEFFMFGEVFDTSKSFTSQ
FT                   FTTRNKMQAVLDFPFQDAARNFASRSQSASQLETFFAGDDWYTDADSNVYELPTFLGNH
FT                   DMGRIGSFIAADNPGADDAERVARDRLAHELMYFSRGNPVVYYGDEQGFTGPGGDQDAR
FT                   QTLFASQVPEYLDDDLLGTDATHATDNFNTGHPLYSKISELAALTAEHPALRNGAHQNR
FT                   YAAQGQGIYAFSRTDAKDQREYVVAVNNSGTAQTAAVPTYIAKRNYSRIYGDAGGSAAE
FT                   SKTADDGKLTVTVPPLSAVVYESSGRIPRSKAAPAVGLQEPATAEGDNGRIRVAADVDG
FT                   SSFYEVTFQARTAGGEWEPIGTDDTAPYQVFHDVTGLNPGTAVEYRAAVLDNGGHTSVS
FT                   AARTGTVPSPVLAMQKPAEGSSVDGKVEVSATASPEKADYTVSFERSVDGGGWAPIGSD
FT                   SSSPVYTVFDDLAALALADGTQLRYRATMSVPGAENVVSDIRTVVAGEIPQPDSVTVAG
FT                   SLNSEMGCPDDWQPACLKAFMALDPADQVWRLTVPELPAGTYEFKAALNGKWDENYGAG
FT                   GAFDGGNIVLEHPGGAVTFRYDHTTHVLSPVYASQQPGAVAAAGSMNLEQGCPEDWMPG
FT                   CDQAQLVLDPADLVWKLSVPALPPGNYEFKAALNRSWTESYGAGGSPNGANISLAHDGG
FT                   PLTIRYDHFTHVMTAG"
FT   sig_peptide     complement(272151..272204)
FT                   /locus_tag="Arth_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 18"
FT   gene            272361..273302
FT                   /locus_tag="Arth_0257"
FT   CDS_pept        272361..273302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0257"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: fra:Francci3_0236
FT                   modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01658"
FT                   /db_xref="GOA:A0JRI8"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022446"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI8"
FT                   /protein_id="ABK01658.1"
FT                   /translation="MHRLFPANPKVAWYLSGFGSMKPTDPELRELPLPPERPMPPSRTV
FT                   PSDSPEGRRPDESVQRLRAAGCVFAEEEALLLTGAAASAAELESMIERRVAGLPLEHIL
FT                   GWAEFCGLRIGVTAGVFVPRRRTGFLVRQAELLLRATHDGGVPRVVDLCCGSGAVGAAL
FT                   AARVAGIELHAADLDPTAVLCAKGNIEPAGGHVHQGDLFEALPARLRGRITVLVANAPY
FT                   VPTAAIGTMPPEARAHEPLMSLDGGPDGLDIQRRVIAGAPAWLAPGGHVLIETSRRQAR
FT                   RTIGLMRGAGLAARLASDPELDATVAIGLRRD"
FT   gene            complement(273407..274462)
FT                   /locus_tag="Arth_0258"
FT   CDS_pept        complement(273407..274462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0258"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   cya:CYA_0270 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01659"
FT                   /db_xref="GOA:A0JRI9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRI9"
FT                   /protein_id="ABK01659.1"
FT                   /translation="MRIGILAPPWIPVPPPSYGGTESVVHTLAAGLAEAGHDVVLAASN
FT                   DSTCPVPRVQGLSDSSELSMDSGRQELLHVLRAYDAMEDVDVIHDHTLLGPLCQRTMPG
FT                   VPRATTLHGPFDEELTLIYRAMQRETALVAISHHQASTARGVKIDAVIHHGIDVRGVLY
FT                   SPSHTGGACFLGRMHPNKGLLQAIMVARRAGIPLRIGAKMREPFELDYFHDVIEPLLGP
FT                   DVEYLGELGTADKYRLLGESVALLNPIQWPEPFGMVMIEALAAGTPVVATRRGSAPEII
FT                   SDGETGFLADSLQGLAEALQGCSWLRRSDCRRSAEQRFSSQRMVREYIRFYSELLEGSP
FT                   RASKQAAAAGF"
FT   gene            complement(274477..276636)
FT                   /locus_tag="Arth_0259"
FT   CDS_pept        complement(274477..276636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0259"
FT                   /product="Amylo-alpha-1,6-glucosidase"
FT                   /note="PFAM: Amylo-alpha-1,6-glucosidase; KEGG:
FT                   tfu:Tfu_2979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01660"
FT                   /db_xref="GOA:A0JRJ0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ0"
FT                   /protein_id="ABK01660.1"
FT                   /translation="MSGWNLDTAGSVGPNAVTIVEGSSFFISAGNGDLDPGLAHGVFYQ
FT                   DTRILSRWNLLVNNHVVEGLLAVNPEPYRAVFTGRAPQPDGAADRPMVVERDRQVGDGV
FT                   RETLTLRNYSSSPAPCSIKLAVEADFADLFEVKAGRKTRQLRPSHRPEGDRLIISGRHN
FT                   GRLLGVTIRAPGADVNRHGVMFKVTVPAKGSWTATIVVTPSSDGSEPAGRFSASTPQHE
FT                   SAPALRHRTWGAAAPVISMDNPMLEKILRQSQRDLGSLRITDPAHPDRTVVAAGAPWFM
FT                   ALFGRDALLTSLMALPVDPAIALGTLQTLAEHQGQKINKITEEQPGRILHEVRLGSGAA
FT                   LSLGGERTYYGTADATPLFVTLLGEVSRWGLEPRAVQELLPNADRALEWITHHGDRDGD
FT                   GFVEYERATRHGLLNQGWKDSYDGINFADGTLAEPPIALCEVQGYAYSAYVARALLALD
FT                   AGDTALARSWGDRAAALKDEFNRRFWLPQRGYFAVALDKDKLPVDSCASNMGHCLWSGI
FT                   VDDDKAPFVAQRLMEPDMFSGWGVRTLSSSMGAYNPVSYHNGSVWPHDNALIAAGLMRY
FT                   GFIEEAQRVAMALFDAAEAFGGRLPELFCGFPRESGRPPVAYPSSCSPQAWASATPIHL
FT                   IRVLLRLDPSAPTGRLWVSPAFPEGFGYLKKEQVPLAGSRLTIEVSGNAVQVTGLPPSI
FT                   ELHLGTQEPLADLIRVHHDHGRKAG"
FT   gene            complement(276989..277525)
FT                   /locus_tag="Arth_0260"
FT   CDS_pept        complement(276989..277525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx01060 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01661"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ1"
FT                   /protein_id="ABK01661.1"
FT                   /translation="MKAKLLFGTGMAAGFVLGSRSGRAAYEKIKARAAALWDSKPVQDK
FT                   VAAATEAVKEKAPEVSDQLTEAARRAGTVISSAVHRDKPSDSAKDSPAASGVPATEGEL
FT                   PAGDYVPSHSTHPETVNLGTADSSTAGTTDSATAGGMPDTTSDPALNDSTGQDWSDEGG
FT                   ATPAGAATNTNPERT"
FT   sig_peptide     complement(277451..277525)
FT                   /locus_tag="Arth_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.802 at
FT                   residue 25"
FT   gene            complement(277679..277942)
FT                   /locus_tag="Arth_0261"
FT   CDS_pept        complement(277679..277942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0261"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   pac:PPA1762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01662"
FT                   /db_xref="GOA:A0JRJ2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ2"
FT                   /protein_id="ABK01662.1"
FT                   /translation="MGFFAFLILGLIAGAIAKAILPGRQGGGIFITLLLGVVGAFLGGW
FT                   IGSLLFGVGINEFFSLSTWLLAIGGAIIVLLVYGMITKRTAR"
FT   sig_peptide     complement(277883..277942)
FT                   /locus_tag="Arth_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.763) with cleavage site probability 0.470 at
FT                   residue 20"
FT   gene            complement(278076..278906)
FT                   /locus_tag="Arth_0262"
FT   CDS_pept        complement(278076..278906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0262"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: fra:Francci3_1172
FT                   2,5-didehydrogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01663"
FT                   /db_xref="GOA:A0JRJ3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ3"
FT                   /protein_id="ABK01663.1"
FT                   /translation="MALSPVIELNDGHRIPQIGLGTWPLDDHQVAAAVVNAVEGGYRHI
FT                   DTAVKYGNEKGVGNGIRSSGLDRSELFITTKLDGEFQGQDRAVAGLDGSLKRLGLDYVD
FT                   LLLIHWPLPRRDEFISTWKTFERLQADGKVRSIGVSNFKPAHLERLMAACDVVPAVNQI
FT                   QVSPAITRIVDIAYNRRHGIVTESYSPLGAGSDLLNAPVLGRIAQKHGKTPGQIVLRWH
FT                   VEQGLVAIPKTANPQRMKENLDIFGFTLDADDTSAIATLDGGDESGVNSDVQGH"
FT   gene            complement(279015..280031)
FT                   /locus_tag="Arth_0263"
FT   CDS_pept        complement(279015..280031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0263"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   lxx:Lxx06550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01664"
FT                   /db_xref="GOA:A0JRJ4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ4"
FT                   /protein_id="ABK01664.1"
FT                   /translation="MSLPATVAAPSDILFIGGTGVISAAAAEHAVALGHRLTILNRGKS
FT                   AGRPTPEGAEVVTADIRDSAAVREALRGRTFDAVADFISFTPEHAAAAIEQFSGRTGQY
FT                   VFISSASAYQKPPARLPILESTPLRNPFWQYSRDKIACEDLLMRAYRDDGFPVTVVRPS
FT                   HTYDRTKIALLGGWTDIHRMREGLPVLVHGDGTSLWTLTHSRDFAKAFVGLLDRPQAVG
FT                   ESYTITSDEFLPWDQVYRLFARAAGVAEPELVHVASETIAAHDSERGPWLLGDRAHSVV
FT                   FDNSKVKSLVPSFQASIPFADGAREIVRWHDTHPELQQVDDGFMELSDRLVGWSRRR"
FT   gene            complement(280028..280999)
FT                   /locus_tag="Arth_0264"
FT   CDS_pept        complement(280028..280999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0264"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sco:SCO4352
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01665"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ5"
FT                   /protein_id="ABK01665.1"
FT                   /translation="MQYTHLGRSGLQVSRLCLGTMNFGPQTEETVAHSIMDSAQDSGIN
FT                   FFDTANVYGGTDHRGWTEEIIGRWFAQGGERRERTVLATKLYGTMTDRPNESKLSALNI
FT                   RRALDASLKRLQTDYIDIYQFHHIDRNTPWDEIWQAMEVAVQQGKILYAGSSNFAGWHI
FT                   AQAQESAARRNFTGLVSEQSIYNLLTRDLELEVIPAAQQYGLGLIPWSPLHGGLLGGVL
FT                   KKERDGVRRTEGRAAETLKKHQEQIRQYEDLADDLGHEPGDVALAWLLHQPAVTAPIVG
FT                   PRTQEQLDAAIRALDVTLDEDALKRLDDIFPGHRTAPEDYAW"
FT   gene            complement(281090..281935)
FT                   /locus_tag="Arth_0265"
FT   CDS_pept        complement(281090..281935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0265"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sma:SAV1849
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01666"
FT                   /db_xref="GOA:A0JRJ6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ6"
FT                   /protein_id="ABK01666.1"
FT                   /translation="MSQTQQNTIPQLTLNNGVKIPQLGFGVFQVPPEETQRIVEDALEA
FT                   GYRHIDTAAAYRNEAGVGAAISASGIPREDIFITTKLRNGEQGNAHEAFQNSRKALGVE
FT                   FVDLYLIHWPVPSQGLYTEAWKAMEKLYANSQIRAIGVSNFLGEHLDTLLPAADVVPAV
FT                   NQVEIHPTFQQQELAAKCRELGIAVEAYSPLGQGADLNATAVKDLAGKYDATPAQIVLA
FT                   WHLAQGTIVIPKSADSKRMRENLGAVAVELSPAELSEISALESGARAGADPAVAAFSQM
FT                   "
FT   gene            282114..283019
FT                   /locus_tag="Arth_0266"
FT   CDS_pept        282114..283019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0266"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   sma:SAV3315 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01667"
FT                   /db_xref="GOA:A0JRJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ7"
FT                   /protein_id="ABK01667.1"
FT                   /translation="MEGMGQSAEFGKFLKAMRSRLKPEDAGLPGTSGARRVPGLRREEI
FT                   ARLADVSTDYYTRLEQGRNIHPSRAVLDSVARALRLDSSEQAHMMDLLENCAESQRSPI
FT                   PAQGVRPALRQLLGAVGDVPALVLGRRSDVLAGNPLAFLLFADFPAMPAGERNLTRWLL
FT                   LDPRARELFPGWKAVAAEAVGALRVDVGRHPNDAQANQLVGELAVHSEHFRQWWAGHRV
FT                   AAPSAGSIRLCHPVVGDLELDFENLVLPEDPDQVLRIFSAKPGSASADSLTLLGSFGAG
FT                   MDGVASGPAAAVVQLPHETG"
FT   gene            283022..283303
FT                   /locus_tag="Arth_0267"
FT   CDS_pept        283022..283303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01668"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ8"
FT                   /protein_id="ABK01668.1"
FT                   /translation="MGIRPLGDPGRFPSLGIDLFDYQGWDSTMKRIALLRERVATAGAT
FT                   GTHCPASGLWAPADAPHDGHTFFEGHIFPSYNGSPTVWRRKSPQETSR"
FT   gene            complement(283315..283524)
FT                   /locus_tag="Arth_0268"
FT   CDS_pept        complement(283315..283524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0268"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   sco:SCO0915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01669"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRJ9"
FT                   /protein_id="ABK01669.1"
FT                   /translation="MSNHTYSISEIVGTSNEGVDAAVRNGIAEAAKTLRNLDWFEVKEI
FT                   RGHLENGQVADWQVTIKLGFRLER"
FT   gene            complement(283602..284492)
FT                   /locus_tag="Arth_0269"
FT   CDS_pept        complement(283602..284492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0269"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family; KEGG:
FT                   lxx:Lxx11940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01670"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK0"
FT                   /protein_id="ABK01670.1"
FT                   /translation="MGNVSTFSIPGPARIPSAATTPAPHPWNRYVALGDSFTEGYGDPE
FT                   PQSPGGVRGWADRVAEELSLGHQDFAYANLAVRGRLLQQIMDDQLGPALELRPDLVTLS
FT                   AGGNDLVFRGSDPDKLAERLDPAIGLLSATGATVVLFTGPDWGNTPVFGRIRGKVAIFN
FT                   ENLRTIAARHDGVVADLWTLRQLAAPHMWDPDRLHFSPLGHHTIAAMVLETLNVPHTLK
FT                   PLEPKVLPVSSWREARSSDLVWAKDYLFPWVVRRVRQRPANLGLKAKRPEPGPIFGPGV
FT                   AHGPFPAGPLTAGKP"
FT   gene            284644..284901
FT                   /locus_tag="Arth_0270"
FT   CDS_pept        284644..284901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0270"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   cef:CE0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01671"
FT                   /db_xref="GOA:A0JRK1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK1"
FT                   /protein_id="ABK01671.1"
FT                   /translation="MELDPADMKPVINRLRRAQGQLAAVTRMIEEGRDCKSVVTQLAAV
FT                   SSALDRAGFSIIATGLQQCLQQEDPSLDKAELEKLFLSLA"
FT   gene            complement(284950..285660)
FT                   /locus_tag="Arth_0271"
FT   CDS_pept        complement(284950..285660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0271"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: tfu:Tfu_1787 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01672"
FT                   /db_xref="GOA:A0JRK2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK2"
FT                   /protein_id="ABK01672.1"
FT                   /translation="MARKSLVGVVADELLDRIIAGEFPPGSSVPGELELSAKHEVSRMT
FT                   VREAMKTLEAQRILSVERGRGTFVNPLNRWASLEAVLRAASEGVNDASAAVQLIELRRM
FT                   LETGACELAAGRISDAEIGTLHGYVAAMRKAHDTDDLAGFVEADLAFHDVILRASENVF
FT                   VAVLFEPLHRVLEKRRTQTSKFRDIQEHAIGHHQAIADALESRDAGRSRSAMDAHMQQT
FT                   LDDLKTYVLEAKTA"
FT   gene            285813..287321
FT                   /locus_tag="Arth_0272"
FT   CDS_pept        285813..287321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdi:DIP2080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01673"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK3"
FT                   /protein_id="ABK01673.1"
FT                   /translation="MPLEADVLAAFPAEVQIPAELVADAVAASSAASPRVLVVLDDDPT
FT                   GTQSVADLPVLTRWDVADFTWAFAHIRDNQTKPAVYVLTNTRSLDAAEAAERNEEIVRN
FT                   ALTAAGSAGSEAGTAGSGLRLGFVSRSDSTLRGHYPLEPDVIAATVAAVSGEATDGVVI
FT                   IPAFPDAGRVTIGGVHYMRGTGDEAGTLTPVAETEFAKDASFGFANSEMAKYVEEKSQG
FT                   RFAADSVIVLDLNIIRASTDPHISAKAIADAIESATESTPIVADIVSENDLRALSLGLE
FT                   EAERRGKKLLYRVGPPFVRARIGQEIRAELSGEEAYAGNTPSEAGGLIVVGSHVGVTTR
FT                   QLKALTEQHSAARIVEIDVEKLLGDAAASYLDETVDMVVEALRGGDVIVHTSRLLIRTD
FT                   DAAESLRIARTVSAAVVAVVNRTLKTFPPRFVIAKGGITSSDVAAHGLEIRHAIVRGPM
FT                   LPGIVSLWEPVDGPAKGIPFIVFAGNVGDDQSLAEVTRKLSNTF"
FT   gene            287353..288252
FT                   /locus_tag="Arth_0273"
FT   CDS_pept        287353..288252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0273"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   cdi:DIP2079 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01674"
FT                   /db_xref="GOA:A0JRK4"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK4"
FT                   /protein_id="ABK01674.1"
FT                   /translation="MTSNCTITVLGLGAMGLPMATRLASQLTVHGFDIAEPRLKLAEEA
FT                   GIRTFASAREASEGADALLLAVRNGEQLNDVLFGANGVASVLKPGAVVILGSTVGTDAI
FT                   PATVDRLAEYGVELVDAPLSGGPKRAGEGDLLIVVGASPEAQEKARPALELLASTLTVV
FT                   GDKPGDGQALKTVNQLLCGVHIAAAAEALALADALGLDQEKTLKALEAGAAGSFMLSNR
FT                   GPRILEAYNEGGAEVLSRLDIFVKDMGIVGKATRAAGLAAPVAAAAEQLYLLGQAQGLA
FT                   AADDSAVIKVVAPTKRNA"
FT   sig_peptide     287353..287427
FT                   /locus_tag="Arth_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.929 at
FT                   residue 25"
FT   gene            288345..289763
FT                   /locus_tag="Arth_0274"
FT   CDS_pept        288345..289763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0274"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: eca:ECA4331
FT                   gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01675"
FT                   /db_xref="GOA:A0JRK5"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK5"
FT                   /protein_id="ABK01675.1"
FT                   /translation="MSALALLAIAVAGVALLLVAVIKFKIPAFLALLVVSVGVALVAGI
FT                   PLPDIIKTVTEGMGGTLGSVAILVGLGAMLGKMIEISGGAQSLAGKFTQLLGPRRVIAA
FT                   LTAAAFLLAIPVFFDVGFIILIPIIYGFSKAAGVNPVKIGLPVGAIMLAIHVVVPPHPG
FT                   VVGGAGILKADIGWATIFGLLICIPVGFLGYFVAKKLNRREYSMLSTTAEQFRLFGSGK
FT                   SEVEQDAPQGTSTSSVLTAVKTAPSPAMIITLIVLPILMIMVGTVGAVMLPKDSFASQL
FT                   AAFIGAPLIALLTALGLAYYFLGIRRGWSSQHTGEVMDSALAPTAIVILVTGAGGVFGK
FT                   VLTVSGIGKALAEGLQSAGLPVILMAFILAAILRASQGSATVAIITTAGLLAASVADGG
FT                   YSPVQTALILVAIGFGAFGLSHVNDSGFWIVTRYLGLSVSDGLRTWTVLTTILGLAGFA
FT                   LTFVAWILVGGLSA"
FT   sig_peptide     288345..288407
FT                   /locus_tag="Arth_0274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.791 at
FT                   residue 21"
FT   gene            289763..290635
FT                   /locus_tag="Arth_0275"
FT   CDS_pept        289763..290635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0275"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: ketose-bisphosphate aldolase, class-II; KEGG:
FT                   mta:Moth_0609 fructose-1,6-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01676"
FT                   /db_xref="GOA:A0JRK6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK6"
FT                   /protein_id="ABK01676.1"
FT                   /translation="MRARLDHLVVSALQQGAAVPAFTCYDFTTALAVVEAAEEAGRGAI
FT                   LLVAPKTAGTPNGLRLITALRGLADSAGVPIAVQLDHASDLRVIADAVAAGADSVLADG
FT                   SSLPYEENIALVREARAVLEAQGHADVVIEAELGGLAGDEDRAFGADAVGSSAQGAAGL
FT                   TDSAQVEDFVARTGAQLLAVAVGNVHGKYKGEPQLRWDVLQDIAVRTHIPLVLHGASGI
FT                   PAEELVKAAAMNVGKVNFNTELRTGVLATLESETGPHRADGENLQGLLVKWNASAREFA
FT                   AGALSTLTR"
FT   gene            290677..291069
FT                   /locus_tag="Arth_0276"
FT   CDS_pept        290677..291069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0276"
FT                   /product="protein of unknown function DUF1304"
FT                   /note="PFAM: protein of unknown function DUF1304; KEGG:
FT                   lxx:Lxx01180 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01677"
FT                   /db_xref="GOA:A0JRK7"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK7"
FT                   /protein_id="ABK01677.1"
FT                   /translation="MIPASLVFAFIAALLHVYIFTMESITWTRPATWKRFGVASQADAE
FT                   TTRPMAYNQGFYNLFLAVGALIGIGAVLWGQPPVGWTLIFASCGSMLLAAAVLALSGRK
FT                   YLRAAATQGTTPLLAVALGLLGLLAA"
FT   gene            291154..292500
FT                   /locus_tag="Arth_0277"
FT   CDS_pept        291154..292500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV3585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01678"
FT                   /db_xref="GOA:A0JRK8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK8"
FT                   /protein_id="ABK01678.1"
FT                   /translation="MGVPQQQKPQASAGQDFPAPDRDAVIDLARFFCLALVVVGHTMMV
FT                   SPVLHPDGTVTTENTLALQDWFEPIIWIFMVMPLFFVAGGITGLQSWRRLKARGGNGVE
FT                   FAQARLLRLVRPAAALLAVMFAALWAARLSGVEAQVVELIVTGAGMPLWFLAAYLAAQL
FT                   NIPWLAALHDRAPWLTLAGLTALVVAVDCFRGSLPLLAYANILFLWCAVQQLGFLLADA
FT                   PAGKPGASTLVGVIIASNLILGLVTGLGLYRGNMLVNLNPPNLCLLLLGAAQAAALQLA
FT                   RPVLGGAASAQWVQTVVGMAGRRAMTIYLWHLPLLAAMSGLILLTDFPKPPAGTAAWWW
FT                   SRPMVLLGVMALLLPALAVFGRLEERPTASAHSRRRPAAAVVLAVVAVFIPVVDAAING
FT                   LTLALLGGGAACFALAVLLLGRIPVRPGGPPDASGGPLPQGPLSANVEP"
FT   gene            292497..292853
FT                   /locus_tag="Arth_0278"
FT   CDS_pept        292497..292853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0278"
FT                   /product="acetyltransferase-like protein"
FT                   /note="KEGG: nfa:nfa50920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01679"
FT                   /db_xref="GOA:A0JRK9"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRK9"
FT                   /protein_id="ABK01679.1"
FT                   /translation="MTENTVSTEDTFSPDVTTTRNDDLHRYELRVGGKLAVQSRFVDRP
FT                   GHVDFIHTDTAEEFKGQGLAKVLAHFALDDVVSAGKRIIPHCPFIYGYLKKHDAYGQFI
FT                   DWPEQPPTDPVTAS"
FT   gene            complement(292895..293632)
FT                   /locus_tag="Arth_0279"
FT   CDS_pept        complement(292895..293632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0279"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: GAF domain protein; ANTAR domain protein;
FT                   KEGG: mpa:MAP0386c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01680"
FT                   /db_xref="GOA:A0JRL0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL0"
FT                   /protein_id="ABK01680.1"
FT                   /translation="MDKITLDTSVAGQLQDLVISSQDVSGFLAEFCELSADSLSRTLGQ
FT                   DVSCAVTLNRHHRTTTAAWSNPEARLFDEIQRNYGEGPCLHAMSTGTTVLVRDTRTDSR
FT                   WPEYGHAVASLGQLSVLGVPLTLDSGASAALNVFAPAPNVFSTAAIQKAELFAVQAEKA
FT                   LRLAVRIGVQQQLAEDLRSAMESRTAIDLAAGIIMGQNRCSQEEAMAILTKASSGRNLK
FT                   LRVVAEKLVESFTPGSPSTHFDG"
FT   gene            293762..294415
FT                   /locus_tag="Arth_0280"
FT   CDS_pept        293762..294415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01681"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL1"
FT                   /protein_id="ABK01681.1"
FT                   /translation="MNHKLRVLVRVDVDPGRVTLEVAGCLTQSNYPVLLHIMRRGRRLS
FT                   PEQDITVDLHNASHLDPEVLMYLRHIADHQAAGGADAFRLTLAEPAELPMCLEHAGLAG
FT                   GEEILDGEINALLDAEAATAFDVDGAPAAAGEQRTIDGLELSEYLEGNLDPASTVKALS
FT                   DDALGKLADALYRHLDTRSPAFGAHTWYELAAEELHQRHLTEPEGPTQEEVAAG"
FT   gene            294825..295769
FT                   /locus_tag="Arth_0281"
FT   CDS_pept        294825..295769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0281"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   cef:CE1202 putative cellulose synthase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01682"
FT                   /db_xref="GOA:A0JRL2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL2"
FT                   /protein_id="ABK01682.1"
FT                   /translation="MNPRRLRLRELTIRLIVLATAILGLNYIIWRWMVSINWEAWWIAV
FT                   PLVLAETYSLVDSLLFGVTMWRYRQRDTPPPPPPGLTVDVFITTYNEPFNLVMGTARAA
FT                   KNIEYPHRTWILDDGNRAELRAIAEAEGIGWITRSEDWTNRPRHAKAGNLNNALLATDG
FT                   EFMLILDADQVPDPKILDHTLGYFNDRKMALVQTPQVFVNVPPNDPLGSQAPLFYGPIQ
FT                   QGKDGWNAAFFCGSNAIIRREALMQLGVMRYVSETELALNKALRTADKVVAKARRQLGH
FT                   GQERLAAALTTVATDLRQVRRELSDGQSIADVT"
FT   gene            295785..296810
FT                   /locus_tag="Arth_0282"
FT   CDS_pept        295785..296810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0282"
FT                   /product="Glycosyltransferases probably involved in cell
FT                   wall biogenesis-like protein"
FT                   /note="KEGG: cef:CE1203 putative cellulose synthase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01683"
FT                   /db_xref="GOA:A0JRL3"
FT                   /db_xref="InterPro:IPR005150"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL3"
FT                   /protein_id="ABK01683.1"
FT                   /translation="MDTVARNLVAEDFAALHAELNSIEGLSRTIDADGSLAVIDDVALD
FT                   RLSQRDWSPLGAVETVRVLIESVNAEKAGEAQAVMPLATISVTEDMATCMRLHSLGWES
FT                   AYHHEKLADGLAPEDLDSMLTQRLRWAQGTMQVMFRENPLLQKGLSIAQRLMYLATMWS
FT                   YLAGFAAVAYIAAPVIYLTLGILPVQSLSNEFFLRLVPFLVVNQILFLVVGRGVKTWRG
FT                   QQYSLALFPTWIKSVTSAFGNVFLGRDLDFRVTPKTLQERNRLPWHLVRPQLIAMIVLV
FT                   LAAFVGVIRLLLGQGDVLGSSVNFVWIAFDLLIFSVVIEAVRYPGYDAWLDSNKKKEVS
FT                   Q"
FT   gene            296807..297136
FT                   /locus_tag="Arth_0283"
FT   CDS_pept        296807..297136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0283"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   cef:CE1204 putative anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01684"
FT                   /db_xref="GOA:A0JRL4"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL4"
FT                   /protein_id="ABK01684.1"
FT                   /translation="MIEFTNETLANGVGVIRPVGRLNMVSAPHLGANIDALISDGTVRL
FT                   VVDLAGTDFIDSSGLGALITGLKKTRQAGGDLRLANPTAQITAVLEMTNLNKVLQPVAT
FT                   VDGAY"
FT   gene            297136..297567
FT                   /locus_tag="Arth_0284"
FT   CDS_pept        297136..297567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0284"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: cef:CE1205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01685"
FT                   /db_xref="GOA:A0JRL5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL5"
FT                   /protein_id="ABK01685.1"
FT                   /translation="MSSQFGLRAAAVPESLELVHDLLEEVWAGEPGIEPMDRIRFETAL
FT                   IEVASNIIEHSQPSTTDPVRFVLAVECEPARLYAEFTDNARPAGIDLTAAELPDDMSGS
FT                   GRGLALAKVALDQFSYAKEGTGNRWTLLCRRRTAASATH"
FT   gene            297750..299339
FT                   /locus_tag="Arth_0285"
FT   CDS_pept        297750..299339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0285"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   sco:SCO2782 putative pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01686"
FT                   /db_xref="GOA:A0JRL6"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL6"
FT                   /protein_id="ABK01686.1"
FT                   /translation="MTLLPPVDEKPLGLPAPTAGHDFGSRVELALAATNHLFNSRNAPR
FT                   YVAQVLQGVNAVATKLERTTKPFSGVGPRELRERVAAVDLGRPLPDTAAALAELEEVYL
FT                   KDAVYFHDAKYAAHLNCPVVIPALVGESILSAVNSSMDTWDQSAGATMIERRLIDWTAE
FT                   RLSLGDTADGVFTSGGSQSNLQALLIARNHAVAGLRTLPGNESLRLPGLLDKLRVFASE
FT                   DSHFSIRKSASMLGLGYDAVVPVAYGSDHRMDHAALKTALARTADAGLVPMAVVGTAGT
FT                   TDFGAVDPLAELAALSKAYGAWFHVDAAYGGGLMVSGRYGHRLEGICLADSVTVDFHKT
FT                   FFQPVSSSALLVRDRAMLQHVAYYADYLNPESAALAEIPNQVDKSIQTTRRFDALKLWL
FT                   TLRIMGADAVGALLDEAIDLAARTGQALAADPDFELAAEPQLSTLVFRYRPVLADGTRV
FT                   EEDTADILNPAIRAAVFASGDAVVAGTTVAGRHYLKFTLLNAEATPEDINAIIDLLRST
FT                   GEALLAGQEAAA"
FT   gene            299336..300703
FT                   /locus_tag="Arth_0286"
FT   CDS_pept        299336..300703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0286"
FT                   /product="L-lysine 6-monooxygenase (NADPH)"
FT                   /EC_number="1.14.13.59"
FT                   /note="KEGG: sco:SCO2783 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01687"
FT                   /db_xref="GOA:A0JRL7"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL7"
FT                   /protein_id="ABK01687.1"
FT                   /translation="MSAASGAAGSSTSGVGTPGRIYDVAGIGVGPFNLGLAALAEPVDG
FT                   LDAVFLERRDSFDWHPGMMLEPAHLQVPFMADLVTLADPTSPYSFLNFLKQTGRLYRFY
FT                   IRENFYPLRAEYNQYCQWVAGQLESVRFGTDVREITYDDGVYTLSVDGPAGPEVLRARR
FT                   LVLGTGTSPYLPAACDGIVEAAANGGGVVLHNADYLARKSELQEQRSITIVGSGQSAAE
FT                   IYYELLQEIDAHGYGLNWVTRSGRFFPLEYTKLTLEMTSPEYVDYFHGLPEEQRDGLIK
FT                   SQKNLYKGINSELIDAIYDLLYAKSLSGVVDTRLLTHSALTGASWDPAAGTHTLQLRHE
FT                   EQGADYALDTGAVVLATGFGYREPGFLSGVQDRIARDGTGRFAVERNYSTGVEPGEIFV
FT                   QNAELHTHGFVTPDLGMAAYRNSCILREICGREIYPVEQSIAFQEFGVPAPALVPA"
FT   gene            300700..301263
FT                   /locus_tag="Arth_0287"
FT   CDS_pept        300700..301263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0287"
FT                   /product="aceytltransferase"
FT                   /note="KEGG: sma:SAV5270 aceytltranferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01688"
FT                   /db_xref="GOA:A0JRL8"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL8"
FT                   /protein_id="ABK01688.1"
FT                   /translation="MSFMFRCFDPESDAQLLHGWVTRPYAAFWGMQSASVPDVVREYSK
FT                   IQSSGHHHALLGLDGGVPAFLMEEYLPAFSPLAGLYAVQPGDIGMHLLVAPPAGPPRTG
FT                   YTAAVMEAVLDRLFAKDRVERVVVEPDARNHKIHVLNERLGFRPSGEIALPDKQALLSF
FT                   CTREAFHAARAARHPSPTHPGASL"
FT   gene            301260..303167
FT                   /locus_tag="Arth_0288"
FT   CDS_pept        301260..303167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0288"
FT                   /product="IucA/IucC family protein"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: sco:SCO2785
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01689"
FT                   /db_xref="GOA:A0JRL9"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRL9"
FT                   /protein_id="ABK01689.1"
FT                   /translation="MTIADLEAVLTTGNAATHLTPERWAAANRHLVRKALAEFSHERIL
FT                   CPEPTSAGDPAGGGRQSAARSRDYRVLSDDATVEYRFFATILPLEHWSVDAGSITCSRE
FT                   GEDAPLDALRFITEFRDTLGIRPEMLPVYLEEISSTLSSHAYKQWMGQPSSAELAAGVT
FT                   RGADAATDFQAIERSMTEGHPCFVANNGRLGFGIHDHRAFAPEAGAPVQLEWIAVHRSK
FT                   AVFTSSEGLDYAAHLDAELGAGVLAFFDAELTALGLDPARYFLMPVHPWQWENKLTVTF
FT                   AAEIAQQHVVHLGIGADSYQAQQSIRTFFNTSAPEKAYVKTAMSVLNMGFMRGLSPLYM
FT                   KATPAINDWLQELIGGDEALRGRGLAMIREVAAIGYHNGYYEAASATDSPYRKMLSALW
FT                   RESPLPLLEDGQQLATMASLLHVDSAGRPMASALIEQSGLAPAEWLRRYFEAYLVPLVH
FT                   CLYRYELAFMPHGENVILVLENGVPVRAVMKDIAEEIVVMGDRLELPDAVSRIKADIPD
FT                   GEKVLAIFTDVFDCIFRFLGALLEEDGVLGGKEFWRIAAEAIRDYQAEHPELADQFARH
FT                   DLFAPDFQFSCLNRLQLRNNQQMLDLADPSGGLQMAGRLANPLATSAREVPGEAPGARD
FT                   "
FT   gene            303177..303953
FT                   /locus_tag="Arth_0289"
FT   CDS_pept        303177..303953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0289"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: sco:SCO4764 putative
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01690"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM0"
FT                   /protein_id="ABK01690.1"
FT                   /translation="MTEQVPGTTALITGATAGLGAEFARQLAEQGHHMVLVARDAERLR
FT                   AAAHELENNYSITAEVLSADLTDDAGVAAVVERLSDPARPVEILVNNAGIGLLKPFDKN
FT                   SLDEERRHLRLHVQTPMELCHAALQGMLARGSGRIINVASVAAFANRGSYSAAKAWQVT
FT                   FSRWANLAYAGSGVKVTAVCPGFTHTEFHDRMGMDKTVAPRWLWLHADRVVREGLADND
FT                   RGRAVSIPTRRYKIVAAASRMLPARFTSGPPRRPAK"
FT   gene            complement(303963..305018)
FT                   /locus_tag="Arth_0290"
FT   CDS_pept        complement(303963..305018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dra:DR2205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01691"
FT                   /db_xref="GOA:A0JRM1"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM1"
FT                   /protein_id="ABK01691.1"
FT                   /translation="MARTLRRHLRDLHSLGPANSDHLSALRVAVSVAVPSLVLLVFGRP
FT                   ELIIYAVFGALTGMYGRSEPHQLRLRHQAQAALVLVSGVGVGIFLSVNHLHSWWLVGVE
FT                   AVLAGVGSVFSDRVNLKPNGPFFGILALGACASVPTTVPWFAALLIAAASASFSILIGF
FT                   GGWVRGRRWQPGAARAAAPLRGVRRYAAMIHAARYVLAVGTAGAIGVLSGSGHPHWAMA
FT                   AAAVPLAGADLPSSVHRGLHRMMGTFLGLVVVAVVLLPEPWAPLTLFPGAEAAVLAFLV
FT                   IIFQFTTELFMTRHYGLAMVSFTPVILLMTQLAAPADPYVLITERAVETVVGAVIGILV
FT                   IVLVRRRRRTS"
FT   gene            complement(305165..306757)
FT                   /locus_tag="Arth_0291"
FT   CDS_pept        complement(305165..306757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0291"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: cef:CE2689
FT                   proline/ectoine tranporter ProP"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01692"
FT                   /db_xref="GOA:A0JRM2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM2"
FT                   /protein_id="ABK01692.1"
FT                   /translation="MPKDRSMTDSSAGVNNARGTDNILPEGVAPQGAKKPRLLPRRRLK
FT                   VSDVNVVNKPMLKKALGGTIVGNTMEWYDVGVFGYLITTMGPVFLPESDPSTQTLFLLG
FT                   TFAATFIARPLGGVIFGWFGDKVGRQKVLAATLMLMAASTFAIGLLPGYAQIGLWAAGL
FT                   LVLLKIVQGFSTGGEYAGATTFVSEYAPDKRRGFFASFLDLGSYLGFAIGAALVSALQL
FT                   TMGQAAMEEWGWRIPFLLAGPLGLIAVYFRSKIEESPQFQATLDAQEELSKDAAKSSDA
FT                   ASKSPVGVVKANWRPIIVAMILVAAANTAGYALTSYMPTYLTDAKGYDPVHGTLLTIPV
FT                   LVVMSLCIPLTGKLSDRIGRRPVLWIGAVSTIVLATPAFLLIGVGEIWSTLAGLALIAF
FT                   PVTFYVANLASALPAQFPTASRYSAMGIAYNFSVAIFGGTTPFIVAALIKATGNDMMPA
FT                   YYLMATSAVGAVAIYFLKESANRPLPGSMPSVDTQAEAHELVATQDENPLIDLDDMPFE
FT                   DELRETEKVPARA"
FT   gene            307246..307500
FT                   /locus_tag="Arth_0292"
FT   CDS_pept        307246..307500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01693"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM3"
FT                   /protein_id="ABK01693.1"
FT                   /translation="MTDKDTTRNAEQTPGPSPDVPEAEARDAGAPDAGQGIKSRLTDAQ
FT                   REMLASKSRGGAGSQSVSHGHKPTQASGKQGPAQKKVRW"
FT   gene            307555..307830
FT                   /locus_tag="Arth_0293"
FT   CDS_pept        307555..307830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01694"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM4"
FT                   /protein_id="ABK01694.1"
FT                   /translation="MRKGRAQMGEKNPGEQLEPELASHLTESMDEVPAPETEPVAAPAS
FT                   ENGPKWPDGSGKHKHPKDRGTLHGREHETAVGAIHRTSRPQIPHHD"
FT   gene            complement(307939..310476)
FT                   /locus_tag="Arth_0294"
FT   CDS_pept        complement(307939..310476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0294"
FT                   /product="ATP-dependent DNA ligase LigD phosphoesterase
FT                   module / ATP-dependent DNA ligase LigD polymerase module /
FT                   ATP-dependent DNA ligase LigD ligase module"
FT                   /EC_number="6.5.1.1"
FT                   /note="PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: mbo:Mb0963 DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01695"
FT                   /db_xref="GOA:A0JRM5"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR033649"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM5"
FT                   /protein_id="ABK01695.1"
FT                   /translation="MAGSRERVRIQGRELVVTNLDKVMYPETGTTKADVLAYYTAVAPV
FT                   LVPAAVNRPATRKRWVNGVGTAEAPGEMFFQKNLEDSTPGWIPRASIRHKERTNQYPLV
FT                   NDAATLIWLAQMGSLEIHVPQWRVDPHGNPMNPDRLVLDLDPGEGAGLAECAEVARLAR
FT                   AILRDVGLDPIPVTSGSKGVHLYAGLDGTQSSDQISEFAHELARALESDHPDLAVSDMK
FT                   KTLRTGKVLVDWSQNNAAKTTIVPYSLRGRLRPTVAAPRTWRELASPKLKQLDYREVMR
FT                   RVKDGKDPFAPVSAGGSHVRGHPGGGGSAAGPRDSTTADGGSTDPRLEKYRSMRDPEGT
FT                   PEPFSADRHGADPNAGTIRERFVIQEHHASRLHYDFRLERDGVLVSWALPKGVPTSGTQ
FT                   NHLAVQTEDHPMDYLDFEGTIPKGQYGAGNVTIWDHGYYECDKWIAGKEVIATLTGADG
FT                   GGLGGTRKFALIRTSRDSDTSKSPEQAQWLIHLMDRKGHAPAATGTPPATGGPAEAAKQ
FT                   DEPPPDLSPAPDFLPMMASAGTPADLRGLDWQFELKWDGIRALIIGDADRIRLISRNGN
FT                   DMTASYPELTDRSCWPEQSFTADGEIVAVGPSGRPDFGLLQTRMKLTKAADVAKARAAT
FT                   PVRLMVFDLLSDAGEDLRRMPLRRRRARLEQLDWPDGCPVHLSEVLDHEVEHILESARE
FT                   LGLEGIMAKRLDGRYVSGERSRSWLKLKFERTQEVVVGGWRPGKGSRQGSVGSLLVGIP
FT                   DGAKLRYVGRVGSGFSDRELKELRLQVDTLSRKTSPFTEVPAADASDAHWVAPGLVGEV
FT                   TFGEWTGGGKLRHPVWRGWRLDKNADDVVAESG"
FT   gene            310517..311557
FT                   /locus_tag="Arth_0295"
FT   CDS_pept        310517..311557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0295"
FT                   /product="DNA end-binding protein Ku"
FT                   /note="PFAM: Ku domain protein; KEGG: lxx:Lxx15680
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01696"
FT                   /db_xref="GOA:A0JRM6"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM6"
FT                   /protein_id="ABK01696.1"
FT                   /translation="MRAIWKGAIAFGLVNVPVKVYSATEDHDIGLHQVHGADGGRIRYQ
FT                   RRCEVCGEIVDYADIDKAYEEDGRTVILTRDELKSIPAESSHEIEVVQFVPSEQLDPMM
FT                   FEKSYYLEPDSKSPKAYVLLRRALEDTDRVAVVQFALREKTRLGALRIKDDVLVLQSLL
FT                   WADEVREPAFPALETTVRISAQEREMSAALVDSMAGDFEPGQFTDDYQVQLRKLIDAKI
FT                   EQGESLDTEQTFGAEAAEAGSGEVIDLMEALKRSLEKKRGGGSADAAQADDAGKAPAKA
FT                   SRSSASGRSAASKGAGAKTTAARSTASKTTASKTTASKAPAKTAAKAAAAEPAAKEPAK
FT                   SRRKGA"
FT   sig_peptide     310517..310585
FT                   /locus_tag="Arth_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.633) with cleavage site probability 0.626 at
FT                   residue 23"
FT   gene            complement(311584..311850)
FT                   /locus_tag="Arth_0296"
FT   CDS_pept        complement(311584..311850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE2609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01697"
FT                   /db_xref="GOA:A0JRM7"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM7"
FT                   /protein_id="ABK01697.1"
FT                   /translation="MPEKKNPGLKDPELYEELREDGASKQKAARISNAAANKGRSAVGR
FT                   KGGKSGDYEDWTVAQLKARAKEIGLTGYSRKKKSELISALRNS"
FT   gene            complement(311853..312485)
FT                   /locus_tag="Arth_0297"
FT   CDS_pept        complement(311853..312485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0297"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: mfa:Mfla_0007
FT                   cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01698"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM8"
FT                   /protein_id="ABK01698.1"
FT                   /translation="MATLQETIEVDVPVSTAYNQWTQFESFPEFMRGVESVEQIDETSL
FT                   RFRTDIAGVRREYGAQITEQLPDRRISWVSTDKPRNAGEVSFEPLGPERTRVTVALEWE
FT                   PEGLLEKAGSAVGADTHQISADLKRFKQFIESRGIETGAWRSAVDNGEVEETDEEAGFA
FT                   ANAPAHHGHESAAHASHPQPPHTPAPSPQRPAGVDPFIDDAEPWDPS"
FT   gene            complement(312759..313037)
FT                   /locus_tag="Arth_0298"
FT   CDS_pept        complement(312759..313037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0298"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: pac:PPA0352
FT                   phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01699"
FT                   /db_xref="GOA:A0JRM9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRM9"
FT                   /protein_id="ABK01699.1"
FT                   /translation="MFERTATIASRVGLHARPAAIFAEAAGEYPHEITIARQGEPADEA
FT                   MDAASILSLMSLGASHGDVVVLRAEGDGADTALEHLVQILETDHDAE"
FT   gene            complement(313094..315166)
FT                   /locus_tag="Arth_0299"
FT   CDS_pept        complement(313094..315166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0299"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose subfamily, IIC subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2; phosphotransferase system, EIIC;
FT                   phosphotransferase system PTS, fructose-specific IIB
FT                   subunit; KEGG: nfa:nfa28540 putative PTS fructose-specific
FT                   enzyme IIABC"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01700"
FT                   /db_xref="GOA:A0JRN0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN0"
FT                   /protein_id="ABK01700.1"
FT                   /translation="MTQLITTDLVELDQNLGNSPEDVIRHLAGRVAATGRATEAEGLFT
FT                   DAFARESKTATGVPGGIAIPHCRSTAVTVPTLAMARLSQPVDFGAKDGPADLIFFIAAP
FT                   EGADQEHLKLLSKLARSLIKKDFTAALRAATTQADIVELVEGALADKPAAAAEPATASA
FT                   AAGASAAAAPSAGAATGSRSGGPKRLVAVTACPTGIAHTYMAADSLVAAAKEVGVDLQV
FT                   ETQGSSGAKPLDPAVIAAADAVIFAVDVDVRGKERFAGMPVINAPVKRGIDEPDKMVQE
FT                   ALAAADNPNARRVPHYGAEEQAEAEATEKGEHIGQKLKKALLTGVSYMIPFVAGGGLLI
FT                   ALGFLMGGYLITQFADAIVVDNSIFNLPTEYPENAWGPLGAYLGAVLFKIGALSLGFLV
FT                   PALAGYIAYGIADRPGIAPGFVAGAVAGFMGAGFLGGIVGGLLAGYIAHSIGKIQVARW
FT                   LRGLMPVVIIPLVASLVASGLMFLILGAPIVAITKGLNGWLSGLTGASAIALGVILGLM
FT                   MCFDLGGPVNKVAYSFAVAGLGAATLDNQAPWQIMAAVMASGMVPPLAMALASTVLDKK
FT                   RFSLAERENGKAAWLLGASFISEGAIPFAAADPLRVIPASMLGGAVTGAISMAAGVGSK
FT                   APHGGIFVFFAIDNFVMFVVSILVGTVVTALAVIALKRWAVRKSVDTVEPVPVTV"
FT   gene            complement(315169..316167)
FT                   /locus_tag="Arth_0300"
FT   CDS_pept        complement(315169..316167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0300"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: nfa:nfa28550
FT                   putative fructose-1-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01701"
FT                   /db_xref="GOA:A0JRN1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN1"
FT                   /protein_id="ABK01701.1"
FT                   /translation="MIVTLTANPSLDRTVALPSPLLRGEVQRAISVSQESGGKGVNVSR
FT                   ALVASGLETVAVLPGGDSDPVLAGLRDSGVPFAALAIHEPLRTNVALTEPDGVTTKINE
FT                   PGPVLSEEQQEALIGLLLERSRGASWVVLAGSLPPGVPADFYATVTRRLRSTHAGNGTP
FT                   QSTPRIAVDSSGAPLAAALSGGASGMPDLLKPNAEELAELAAAAGFATASTADELEADP
FT                   EAAAAAAAAVVRSGVGAVLATLGSKGAVLVTSDGAWLATHPPVKAVSTVGAGDSSLAGY
FT                   LLASSLGAAPADCLRQAVAHGAAAASLPGSTVPAVHQTTPDAVTITALRKD"
FT   gene            complement(316164..316973)
FT                   /locus_tag="Arth_0301"
FT   CDS_pept        complement(316164..316973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0301"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: nfa:nfa28560 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01702"
FT                   /db_xref="GOA:A0JRN2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN2"
FT                   /protein_id="ABK01702.1"
FT                   /translation="MFAEERQQLIAGLVAESGRASVTALAERFNITTETVRRDLAALES
FT                   AGTVRRVHGGAVAPDRISTTEESILERTIQRQPEKLRIAEAALAFIPQSPAGSILVDAG
FT                   STTEALADLIALRLADPSASPSAGSENELVVITHAIPIAAKLAGEPGIALHLLGGRVRG
FT                   LTQAAVGQSTVDAAHRIRPDIAFIGANGIHSAFGLSTPDPEEAAVKAAFVQSARRIVVL
FT                   ADSSKLDAETLVQFASLKDLDTLITDSEPSPELAAALADAGVDVVVA"
FT   gene            complement(317264..317521)
FT                   /locus_tag="Arth_0302"
FT   CDS_pept        complement(317264..317521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01703"
FT                   /db_xref="GOA:A0JRN3"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN3"
FT                   /protein_id="ABK01703.1"
FT                   /translation="MRIGSSIFLIAIGAILAWAITPGLIPNVDQTLIGYILMAVGVIGL
FT                   IASLVLASPGRTRRVSETRSVVDPNTGERIVRNESRDGGI"
FT   sig_peptide     complement(317462..317521)
FT                   /locus_tag="Arth_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.789 at
FT                   residue 20"
FT   gene            complement(317589..317870)
FT                   /locus_tag="Arth_0303"
FT   CDS_pept        complement(317589..317870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01704"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN4"
FT                   /protein_id="ABK01704.1"
FT                   /translation="MVTPDPLTLRAVHRGCIPRLARECVRNPQYAGHTAGRRCYLGATI
FT                   NRTGRHHQFEVGALRGWVHCVRRTAQNNDSDTAPARGVRFIETAGGGL"
FT   gene            317892..319112
FT                   /locus_tag="Arth_0304"
FT   CDS_pept        317892..319112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0304"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG:
FT                   fra:Francci3_2596 beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01705"
FT                   /db_xref="GOA:A0JRN5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN5"
FT                   /protein_id="ABK01705.1"
FT                   /translation="MSEPFPAVVVTGLGAVTPVGSTAGETWDALLAGRSGIVPLDEEWS
FT                   AGLPVRIAGRVTADVPSLLSTLEYKRMDRCGHLALIAAREAWSHAGRPGTDPERLAVVI
FT                   GSGYGGLDTTLEQTRTLDVKGPRRVSPHTLTRIMVNGPAAWVSIDLGARGGARTPVSAC
FT                   ASGAEAISQAADMIRSGAADVVIAGGVDSCINGLTISGFSQIRALSTRNDSPQAASRPF
FT                   DRDRDGFVMAEGAGIVVLEREDHARARGAEVLGVIAGSAVTSDAVDIVAADPAMQRRVL
FT                   QKAMAAAGLTGEDIGFVHAHATSTPVGDRLEAEAIGAVVGHSVPVTSTKSLTGHLLGGA
FT                   GALGAIVTIQALRTGAIPGTLNLDNTDPDIHLNIVSETTRGLAAKAGISNAFGFGGHSA
FT                   SLVITAG"
FT   sig_peptide     317892..317963
FT                   /locus_tag="Arth_0304"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.880 at
FT                   residue 24"
FT   gene            319144..319761
FT                   /locus_tag="Arth_0305"
FT   CDS_pept        319144..319761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0305"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   lxx:Lxx20810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01706"
FT                   /db_xref="GOA:A0JRN6"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN6"
FT                   /protein_id="ABK01706.1"
FT                   /translation="METVVWSRPENQRAGTPLLVMMHGYGTDEVRMSDLFGQLPPEFTC
FT                   AALRAPKVIGDDYGWFLLDYFLTHDFADVISVSNKVFDWINSVKAQHSSVSLLGFSQGM
FT                   AMASTLLRLRPQDFRAVVGLSGFVLDNELLAMSESFDAKPPFFWGRDKADLVINDAAVE
FT                   HTAEWLHRNTQLTARTYPGMGHTISKAEMVDVSAFLRHYVLR"
FT   gene            319920..320948
FT                   /locus_tag="Arth_0306"
FT   CDS_pept        319920..320948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0306"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   fra:Francci3_2164 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01707"
FT                   /db_xref="GOA:A0JRN7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN7"
FT                   /protein_id="ABK01707.1"
FT                   /translation="MARAPRVTIQDVAALSGLSICTVSRALRGLPNVSETAHVKVADAA
FT                   TKLGYKASSAASRLAGGTTGSVAIIAPTATAWFFAQAVEAAEEVFADSGFDTVLISLRN
FT                   TPSVHRKVFGDLDALAQRVDGVLLLNIALSDNEIDALASSGLAVASVGMHNVPWDNVGI
FT                   DNEDAAWKATNHLLGLGHWDLAILSGREPGERTVATATDRLRGFQRALAEHHLTVDPDL
FT                   VMDAGSSIEGGRRAMTELIENRRMTSAIFAGCDETAFGALMALRELGLSAPKNVSIIGI
FT                   DDHQMSWFLGLSTIAQPVADQGAFAANLLIEGLQRPGPLSAPASHVLDTKLIERKTARR
FT                   KR"
FT   gene            321111..321863
FT                   /locus_tag="Arth_0307"
FT   CDS_pept        321111..321863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0307"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   pac:PPA1107 haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01708"
FT                   /db_xref="GOA:A0JRN8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN8"
FT                   /protein_id="ABK01708.1"
FT                   /translation="MTELSNSTTGNSTTSSWSGASAILFDLDGVLTPTAIVHERAWQEL
FT                   FDGYLQDVPEADAYRESDYFDHIDGKPRFDGVRDFLASRSIVLPEGPADDDPANDTVHG
FT                   LGNRKNKVFNDIVEAGGVAPYEGSVRFLEAVLSLGLKVAVVSSSRNAPAVLQAAGLAHH
FT                   FPVVVDGVAAAAAGLPGKPSPATYEHAAQLLNLPSEECVVVEDAVSGVQAGNAGTFHSV
FT                   IGVDRGAGRQTLLDAGATLVVEDLNELL"
FT   gene            321918..324278
FT                   /locus_tag="Arth_0308"
FT   CDS_pept        321918..324278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0308"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase, family 65 domain protein;
FT                   glycoside hydrolase family 65, central catalytic; glycoside
FT                   hydrolase family 65 domain protein; KEGG: pac:PPA1108
FT                   trehalose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01709"
FT                   /db_xref="GOA:A0JRN9"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRN9"
FT                   /protein_id="ABK01709.1"
FT                   /translation="MALITSDRARFPNDPWQLVETVHLSGNAGTLETLFSLGNGHLGIR
FT                   GAHWASADADLPGSFINGFHETWDIKHAENAYGFARTGQRILYIPDVNNFTVIIDGETL
FT                   TLSESTVLDYRRSVDFATGIYECRITWQCRSGATVTTTERRAVGYQTRGALGISLEVAA
FT                   DRDVYADVTSSVINRQDQPVEDHSTHDPRRAGRHAGRVLLPVRLDGGDGSLRLSWEAAD
FT                   SRQRVGLAVDHWTSADVQPFETLVDQDDSSVRYVLAVGADQPFRLEKSASYAVARAFRE
FT                   GAVDGGSPQDPSEAAEGALQPVSAIFAESEAHYRDYWATTDIVVGGQPELQQAIRWNLF
FT                   QLAQATARADVAGIPAKGVSGSGYEGHYFWDQEVYLLPYLTYTNPDNARQVLEFRHEML
FT                   PDAKVRAKELSVDGALFPWRTINGLEASAYYAAGTAQFHIAAAIAFATNRYVWASGDAD
FT                   FKQGMGAELLIETARMWVSLGFFGKDGLFHIHGVTGPDEYTAVVNDNLYTNVMARFNLR
FT                   TAAALDHPEIDDAERELWEQAAIRMQLPYDEDLEVYSQDNDFMTLEPWDWSTPRSKYPL
FT                   LLNFHPLVIYRHQVLKQADTVLAMFLQWQDFTAEEKRRAFDFYDPITTGDSTLSACVQG
FT                   IMAAEVGYGKAALDHFTHALYIDLDDTHGNTIDGVHIASTGGVWSSLVSGFAGLRDQGE
FT                   VPFFDPRLPSEWEGLTFHLKVRGRLLFVELGQESIGLSIRDGEPLEVDVRGELLTVGND
FT                   VTRVPLAPVGAPEPTIFPSGLPTASIPIVRARS"
FT   gene            324366..324857
FT                   /locus_tag="Arth_0309"
FT   CDS_pept        324366..324857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sao:SAOUHSC_02656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01710"
FT                   /db_xref="GOA:A0JRP0"
FT                   /db_xref="InterPro:IPR021299"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP0"
FT                   /protein_id="ABK01710.1"
FT                   /translation="MLRRKTGDVKKLFHASFAYAIAGVLSGLYYREFTKAYGFTGESQL
FT                   GLVHTHWLVLGFVVLLMVLMLEKIFGLSAAAPKLSAWFFRTWNAGVVVTGGMMLVKGSL
FT                   VAAGADAGSKALAGIAGTGHILLSAGLVLLFLALRKALTAAPRTAPRSGLGTRGAGNVA
FT                   "
FT   gene            complement(324854..326185)
FT                   /locus_tag="Arth_0310"
FT   CDS_pept        complement(324854..326185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0310"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG: sma:SAV7030
FT                   transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01711"
FT                   /db_xref="GOA:A0JRP1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP1"
FT                   /protein_id="ABK01711.1"
FT                   /translation="MPTPRALRPFAHREYRVLIAALAVSIFGSGMWAVAMVYQVIHLGG
FT                   GPLQLSLVATAGSVGLVAFVLAGGIAADRVPQRLLIIAVEGTNLAVIAAISGLALAGWL
FT                   QLWHLAVGAFVLGVGAAFFFPAYSAILPRILPAEDLLAANGMEGTMRPILQQAAGPAVA
FT                   GILVAALSPSHAVTGVAACHLLAFIILNFLGQHALEAPGTEGTGGGPAGGTGGGPAAER
FT                   GKTSFFHDLREGVSYTLRTPWLLWTLVWACISVLFLIGPIEVLLPFVVRDQLGGDSRMF
FT                   GFLLAVMGVGGAAASLATASFALPRRYLTVMMVSWGAGSLPLAAVGIMDSFWMVAAALF
FT                   VFGATGGIGMVIWGTLLQRRVPPHLLGRVSSLDFFVSLALMPVSMALAGPVAEVVPTWV
FT                   IFLVAGGVCPVMAVVAMVVARMPADELAHPLDRSAGDRESADSP"
FT   sig_peptide     complement(326072..326185)
FT                   /locus_tag="Arth_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.683) with cleavage site probability 0.426 at
FT                   residue 38"
FT   gene            326270..326860
FT                   /locus_tag="Arth_0311"
FT   CDS_pept        326270..326860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01712"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP2"
FT                   /protein_id="ABK01712.1"
FT                   /translation="MGNSPAGSWRRSMAFIGSNPGLALHPVDRDGVHIPGEPASCFASF
FT                   WMAEWSRWGTGNALLVATRQGWRSYGSNGYFAETLANELTRYFPEAARFPLAEITHTQD
FT                   DFDVELDLERGFRAVGGKAELEISGVLDRRQFLAPEFQLGGNSAALSNVYLPCSTGRLS
FT                   EFGVEWPGAPSVYPGPRGPSSSAYIAVAESWVM"
FT   gene            326989..327855
FT                   /locus_tag="Arth_0312"
FT   CDS_pept        326989..327855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx13700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01713"
FT                   /db_xref="GOA:A0JRP3"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP3"
FT                   /protein_id="ABK01713.1"
FT                   /translation="MRIAQKTAHKAVFDSEGKPKPGLHSMMLRAVEVQRPLVLANLRRL
FT                   QRRHPRATAAQLADKLERDYLLAVTGGGALVGGSAVIPGVGTVAALGLSAAATVGFLEA
FT                   TALYATSLAELHGIRMIDPEKAGLMVMAIMLGEEGTALLGSLSGQAAGRSKGPTDAWGS
FT                   VFARKTSFPGFGSVRDRIQRAFLRNLLQRQGTALLGRALPFGVGAVVGGVGNRVMGRAV
FT                   VASAKEAFGPMPDTIPGEVAAGTPASGGTTGRTSAPAALNAGTSDPGANTPGGDPTLKG
FT                   GFIGSER"
FT   gene            327839..328588
FT                   /locus_tag="Arth_0313"
FT   CDS_pept        327839..328588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0313"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: pst:PSPTO5378
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01714"
FT                   /db_xref="GOA:A0JRP4"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP4"
FT                   /protein_id="ABK01714.1"
FT                   /translation="MDLNADLGESFGSWTMGDDAAMFPLITSASVACGLHAGDPVTMLD
FT                   TCRAAYELDVRVGAHVGYPDLPGFGLRSIDMTFDDLFGAVLYQLGALDGVAHAVGASVD
FT                   FVKAHGALYDRTVHDAEQASAVIAAVQAYDPGLPILGQQGSALLSVAAEAGHPVFHEAF
FT                   ADRAYFPDGTLVPRSQDGALLEDAGEIAGRAVRLALHGEVEALDGTVIRLQPHSLCLHG
FT                   DTPGSVETAAAVRKALEAAGVEIEPFA"
FT   gene            328638..332348
FT                   /locus_tag="Arth_0314"
FT   CDS_pept        328638..332348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0314"
FT                   /product="respiratory nitrate reductase alpha subunit
FT                   apoprotein"
FT                   /note="KEGG: sco:SCO6535 putative nitrate reductase alpha
FT                   chain NarG; TIGRFAM: nitrate reductase, alpha subunit;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01715"
FT                   /db_xref="GOA:A0JRP5"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP5"
FT                   /protein_id="ABK01715.1"
FT                   /translation="MASGPHAGLDGPASDAMLKLGRFFTKWDQTDDGRAVFREGGRKGD
FT                   IFYRDRWSHDKVVRSTHGVNCTGSCSWKVYVKDGIITWESQQTDYPSVGPDSPEYEPRG
FT                   CPRGAAFSWYTYSPTRVRFPYARGVLVEMYREAKARLGDPVLAFAEIASDPDRRRRYQQ
FT                   ARGKGGLVRVSWQEAIEIAAAAHVNTIKTYGPDRCAGFSPIPAMSMVSHAVGTRFIQLI
FT                   GGVMTSFYDWYADLPVASPQVFGDQTDVPESGDWWDARYLMMWGSNVPVTRTPDAHWMA
FT                   EVRYRGTKVVTVSPDYADNTKFADEWLPAQAGTDAALAMAMGHVMLKEFFVDRDVPFFS
FT                   DYVRQYTDLPFLVRLERHDDGGLTPSKFLTAMDLPAEAGAEDAAFRTVLFDKKTGRTAV
FT                   PNGSMGFRYSGSGEGKWNLDLEGIEPALSLREVSGDSAEVLLPCFEDAGGEGSVLRRGV
FT                   PVIEVEGQLVTTVFDLMLAQYGVGRDGLPGEWAAGYDDAATPYTPAWQEEITSVPAQAC
FT                   IRVAREFARNAEQSKGRSMIIMGAGICQWFHGDTTYRAVLALVMLTGCMGRNGGGWAHY
FT                   VGQEKTRPATGWVSLANALDWSRPPRTMIGTGYWYMHTDQWRQDGYSTDALKSPLSTGA
FT                   LDGMHTADALAQSARLGWMPFYPQFDRNPLDLADEAEAAVAAGTAKDTPGYIADALKNR
FT                   TLNPAIEDVDAPENWPRTLVLWRSNLFGSSAKGNEYFLRNLLGTHNNVLGKDHAEGLKP
FT                   RDVKWHEQAPEGKLDLLVSADFRMTSTTLLSDVVFPAATWYEKHDLSSTDMHPFVHAFT
FT                   PAIDPPWETKTDFEMFHLLAREFSRMAKTHLGIRRDLVSVPLQHDTPGQLAQPGGIVRD
FT                   WRNTDIPAVPGQNMPVFSVVERDYTAIADKLAAVGPLADKLGFTVKNVTYKLAGPLERL
FT                   SRSNGVMLGGAADGRPAIDTDAKMAEAILAFSGTTNGALSVQGFKDLEVRTGRKLADLS
FT                   KGSEEKVITFAQTQAGPVPVITSPEWSGSETGGRRYAPFTINVERLKPWHTLTGRMHFF
FT                   LDHDWMIDIGEALPIYRPPLDMHQLFGEPKLGRDGAMEVVVRYLTPHSKWSIHSEYQDN
FT                   LLMLSLSRGGPTVWMSPADAEAIQVKDNDWVECLNINGVLVARAIVSHRMPAGVVYVHH
FT                   AQERTIDVPKSEATGRRGGIHNSVTRLLVKPSHLIGGYAQLAYAFNYLGPTGNQRDMVA
FT                   TVRRRSQEVQY"
FT   gene            332348..334021
FT                   /locus_tag="Arth_0315"
FT   CDS_pept        332348..334021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0315"
FT                   /product="respiratory nitrate reductase beta subunit"
FT                   /note="TIGRFAM: nitrate reductase, beta subunit; KEGG:
FT                   mpa:MAP2619c nitrate reductase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01716"
FT                   /db_xref="GOA:A0JRP6"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP6"
FT                   /protein_id="ABK01716.1"
FT                   /translation="MRVMAQMGMVMNLDKCIGCHTCSVTCKQAWTNRAGTEYVWFNNVE
FT                   TRPGQGYPRRYEDQERWHGGWVLNKRGKLVLKAGGRVKKLLGIFASPVQPELKDYYEPW
FT                   TYDYKTLVDAPLGDDFPVARPKSLITGKDTKITWSANWDDDLGGSVENGHLDPIVEKVR
FT                   RESEDKIKFAYEQTFMFYLPRICEHCLNPSCMASCPSGAIYKRVEDGIVLVDQDKCRGW
FT                   RQCVTGCPYKKIYFNHKTGKAEKCTFCYPRVEVGLPTVCSETCVGRLRYLGLFLYDADA
FT                   VTAAAAVTDPKELYDAQMDVLLDPNDPAVQAEARTQGIPEDWIDAARRSPVYALAKVYK
FT                   VALPLHPEYRTMPMVWYVPPLSPVVDLLRDQGHDGEDTGNLFGAIDALRIPVEYLAELF
FT                   TAGDADRVTAVLKKLAAMRSFMRGISLGNDPDDSIPESVGMDGQTMYEMYRLMAIAKYE
FT                   ERYVIPKAHVEQAHDLEEMGCSLDFDGGPGMQDSSPFGEASGRPVPVAVETFNALKDRQ
FT                   TSGEAPGETTLRGRVNLLNWDGTGAPPGLFPERHTPGEEP"
FT   gene            334018..334638
FT                   /locus_tag="Arth_0316"
FT   CDS_pept        334018..334638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0316"
FT                   /product="respiratory nitrate reductase chaperone NarJ"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase, delta subunit;
FT                   KEGG: sco:SCO4949 nitrate reductase delta chain NarJ3"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01717"
FT                   /db_xref="GOA:A0JRP7"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP7"
FT                   /protein_id="ABK01717.1"
FT                   /translation="MSRRQQVVYLAAAWCLSYPDEELIGRAPLMRDALGEFPGAVADFA
FT                   GVLDLLESTPLMEVQAHYVREFDLGKRHALHLSYWTDGDTRRRGEVLGNFKKTYRQSDI
FT                   LVDTRGELPDYLPMVLEFAAVVDLAAGRELLTRFRASLEMLRFGLLRDELPHARILQAV
FT                   CATLPGKSPADEQAVMRMAGYGPPTEAVGLDPYDPRLLPVKGT"
FT   gene            334641..335423
FT                   /locus_tag="Arth_0317"
FT   CDS_pept        334641..335423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0317"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /note="TIGRFAM: respiratory nitrate reductase, gamma
FT                   subunit; PFAM: Nitrate reductase, gamma subunit; KEGG:
FT                   mbo:Mb1765c probable nitrate reductase NarX"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01718"
FT                   /db_xref="GOA:A0JRP8"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP8"
FT                   /protein_id="ABK01718.1"
FT                   /translation="MPAFEAGPGSAVEISALDTVLWGVLPYIMVVVLVGGLVWRYKYDQ
FT                   FGWTTRSSQLYESRLLRIASPLFHFGLLAVIAGHFFGLVIPMAWTQAVGMSQDFYHFNA
FT                   LFVGGIAGVGTLGGIILLIYRRRTTGPVFMATTTNDKAMYVVLTAAIVFGLWTTLASVF
FT                   EGEHGHNYRETVAPWFRSLFVLQPDVAAMAGAPFSFHLHTLVGMALFVIWPFTRLVHAF
FT                   TAPLHYLFRPYIVYRSRDVAVRRGWSPVGTRDRDTRNR"
FT   gene            335470..336693
FT                   /locus_tag="Arth_0318"
FT   CDS_pept        335470..336693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0318"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mbo:Mb1766c possible nitrate/nitrite transporter Nark2"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01719"
FT                   /db_xref="GOA:A0JRP9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRP9"
FT                   /protein_id="ABK01719.1"
FT                   /translation="MAGTAPPPTSAPAGQTRNLILATAASVAGFWAWNSVATLGAFYTQ
FT                   NLQLNPATTGVLVAMPVFVGSLGRIVVGTLTDKYGGRAMFTFVLLASILPILLVSAGGT
FT                   LRSFPLVLGAGLLLGVAGTVFAVGIPFVSGWYEPSRRGFATGVFGAGMGGTALAAFLNP
FT                   RLVAAIGYFPTHLLIAGVLAVMAALVWFLMKESPGWTRSNAPVLPKLLDAAKTPITWKM
FT                   CFLYAVVFGGFVSFATYLPTYLRDVYSFDPSGAGARTAGFALAAVLARPVGGVLADKLG
FT                   PKPVVITSLTAVAVLAWVVNLQPDGEVPAGLTFVAMAAALGLGTGGVFAWVGVLAPHGK
FT                   VGSISGVVSAAGGLGGYFPPLVMGATYDAATHSYSIGLLLLVVTAIVALVFTIFGVRGR
FT                   IKASVVAA"
FT   gene            complement(336696..338036)
FT                   /locus_tag="Arth_0319"
FT   CDS_pept        complement(336696..338036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0319"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   nfa:nfa52100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01720"
FT                   /db_xref="GOA:A0JRQ0"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ0"
FT                   /protein_id="ABK01720.1"
FT                   /translation="MQVNSEQTTRPAAARPPHAGSPAAGAAVAPPRPGSDAEKAAALRK
FT                   MKLLALGLLIVMAVIFVVAFALQKQYPWLEYVRAAAEGGMVGALADWFAVTALFKYPMG
FT                   IKIPHTAIIPRRKDQIGASLGEFVETNFLSEQVVQEKLASVDIARKAGAWLSGPGGAER
FT                   VAKEGAAVIRGAFKVLNDDDVQAVIESMVRKHLLTPPWGPPVGRLAERIFADGHHHTLV
FT                   DLLVDRTVDWVRDNHETVSRLVSDRSPQWVPQFVDGLVGDKVYVEILKFTKAVQADPQH
FT                   QVRQSIDTYLASLAQDLQHDPVMIARAEGIKAQVLGDPEVRELASRTWGTIKAALLGAV
FT                   DDPHSELTVKFKAAVHDFGTRLVVDPELAGKVNAWIGDAAGYLVKTYRSDIAGVITDTV
FT                   ARWDAEETSQKIELQVGKDLQFIRINGTVVGALAGLAIFTLAHLAFG"
FT   gene            338087..338986
FT                   /locus_tag="Arth_0320"
FT   CDS_pept        338087..338986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0320"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sma:SAV4224 putative phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01721"
FT                   /db_xref="GOA:A0JRQ1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ1"
FT                   /protein_id="ABK01721.1"
FT                   /translation="MTTDESVSARPLVYAHRGASAAFAEHTRAAYLQAIADGADGVECD
FT                   VHLSRDQHVVLLHDANLDRTSDGTGPVADRTLEELRLLDFSSWKGARIPLEYGGKFDQL
FT                   LTLPELLDILRAAGRDIGLAIELKHPSPYLLALEDRVLEVLAAEGWDPGTSKVDNVSVS
FT                   FMSFSPDSVKHLLKSVPAEFVCQLVDDVNAEEIREELGLGVITGGALANVMRAAQAEGE
FT                   RILNDCEVRLAGPGIDYVREHARTVKRWMDSGRRFRVWTVDSDQDVALCRELGIHEITT
FT                   NRPAQVLARLSERRHPVS"
FT   gene            complement(339073..340710)
FT                   /locus_tag="Arth_0321"
FT   CDS_pept        complement(339073..340710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0321"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /note="KEGG: mpa:MAP2561 putative ABC-2 type transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01722"
FT                   /db_xref="GOA:A0JRQ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ2"
FT                   /protein_id="ABK01722.1"
FT                   /translation="MTRTAEARTATTRASTNGTLAGTGVMLRLALRRDRWMLPLWILGF
FT                   AIIAYSTAAAGAGLYPDEPSRVAAATALNATASMVALFGRIYDPASLGALSLIKYTAFM
FT                   TAILAVLMVILTIRHTRGDEESGRLELLGGGRLGRDAPLVSALAISFATSILTGLLSAA
FT                   ALAVGGLPGTGSLAFGLGWAATGMAYSTVAAVAAQVTASARAATGFSIGVIAVTYGLRA
FT                   VGDLAEPGPSVWSWLSPIGWNQQIRAYAGDHWWVLSLPVALCAALVPVAFLLRARRDLG
FT                   AGLRDERPGPARGRLSGVLGLAVRLQYRVLVAWGVAFALFGVVIGSLVGNVADFLTSPG
FT                   AQDLMRALGGPQALTDAFLAAEISIMGVLAAAYGISAANHLRSEESAGHTEALLGTATT
FT                   RIRWAGSHYAVALAGVGLLQLLTGVSIGIGAAAAVDNAELVGRSTVAALAQIPAAWVLT
FT                   SAALAVFGWLPRMTGAVWVLLLGLIALGEFGVLWNAPEWLMDLSPFRHSPLLPVDADAI
FT                   PALVALTAAAALLGALGFAGWRRRDLAA"
FT   gene            complement(340707..341615)
FT                   /locus_tag="Arth_0322"
FT   CDS_pept        complement(340707..341615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0322"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sma:SAV4541 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01723"
FT                   /db_xref="GOA:A0JRQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ3"
FT                   /protein_id="ABK01723.1"
FT                   /translation="MSSVVEMTGVVKRFGTVTALDGLDFNVAAGEVHGFLGPNGSGKST
FT                   TLRLLLGMLRANSGSIRVLGMDPWHDVAALHRRLAYVPGDVALWPNLTGGEVIDLLGRL
FT                   QGGQDRARRDRLLRTFDLDPTKKSRTYSKGNRQKVALVAALATDAELFLLDEPTSGLDP
FT                   LMEDAFRGCVRELRSQGRTVLLSSHILSEAEALSDRVSIIRAGRVVESGPLEQLRHLTR
FT                   TSVTADVARVPAGLDLLPGVHDVVVSDHRVSAQVDPVALGPFLQALTAAGLHALTSQPP
FT                   TLEDLFLRHYGPAGSLESARR"
FT   gene            341704..342198
FT                   /locus_tag="Arth_0323"
FT   CDS_pept        341704..342198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV1073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01724"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ4"
FT                   /protein_id="ABK01724.1"
FT                   /translation="MPFTWSARATQTLSAAAMSALLLTSAMKHFRDPAFFHQVVPDFLC
FT                   RDDSGARPNGPCAVMTRDEWVALSGLLEAGAAVGLLIPATRKAAAGGVAAMLAVFLAGH
FT                   VDALRRAYGPAGSPGQRKVHTARLPLQVPLILWAWSLRKTAVGKPAPGTPAGRPVAGRP
FT                   A"
FT   sig_peptide     341704..341790
FT                   /locus_tag="Arth_0323"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.591 at
FT                   residue 29"
FT   gene            342195..342971
FT                   /locus_tag="Arth_0324"
FT   CDS_pept        342195..342971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0324"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: tfu:Tfu_1138
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01725"
FT                   /db_xref="GOA:A0JRQ5"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ5"
FT                   /protein_id="ABK01725.1"
FT                   /translation="MKLLQSPAVRVGLSISIATGLYGISFGALGVTSGLDFWQTMALSL
FT                   LLFSGGSQFAFIGVVAGGGSGVAAMGAATLLGMRNGIYGMQLNALLQPRGWRKYAAAHV
FT                   TIDESTATSTGQTDPGEQKRGFWTAGIGIFVLWNVFTAVGALAGGALGDPKQWGLDGAA
FT                   VAAFLGLLWPRLKGREPVAIAVVCALATVLAVPFVPAGVPILIAAFVAAAIGWFSHGRS
FT                   DEGLEPDVDPYAEHHHGPSDEGAQLRPRPDAGGAAK"
FT   sig_peptide     342195..342287
FT                   /locus_tag="Arth_0324"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.738) with cleavage site probability 0.672 at
FT                   residue 31"
FT   gene            342968..343279
FT                   /locus_tag="Arth_0325"
FT   CDS_pept        342968..343279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO5764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01726"
FT                   /db_xref="GOA:A0JRQ6"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ6"
FT                   /protein_id="ABK01726.1"
FT                   /translation="MNLWLWLLLACLFGYAWKLLGYLVPASLLRNPRMSRIAGTMTIGL
FT                   LASLTVVNAVASGQALAFDARAGALAAAGIALWFRAPFLVVVLAGAGAAAGLRMLGWS"
FT   sig_peptide     342968..343033
FT                   /locus_tag="Arth_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.687) with cleavage site probability 0.228 at
FT                   residue 22"
FT   gene            343311..343637
FT                   /locus_tag="Arth_0326"
FT   CDS_pept        343311..343637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01727"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ7"
FT                   /protein_id="ABK01727.1"
FT                   /translation="MLWKDATMSEEQAPAVPAAERDPKSRPYVPSPGSESTREMREMSR
FT                   RRRDAEEKLQQHLQEADHLHEEHMKAHQRETQLAQDGEAPPSGEAATGGEARDEGQAGN
FT                   KPAE"
FT   gene            complement(343645..344082)
FT                   /locus_tag="Arth_0327"
FT   CDS_pept        complement(343645..344082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01728"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ8"
FT                   /protein_id="ABK01728.1"
FT                   /translation="MLFPSGWPEGGSPCERQGRRRAAILWLAPRDPRIMEVTQSATPPL
FT                   RGVRHGLRTTYSLPFGAAMTRQQLALLMNGDADPLRIISAASTSELQALTDALFRDLDT
FT                   SHPVFGAQVWYDLALEELENRINGASPEADGFTGTDSFGAA"
FT   gene            344095..344832
FT                   /locus_tag="Arth_0328"
FT   CDS_pept        344095..344832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0328"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: sco:SCO4029
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01729"
FT                   /db_xref="GOA:A0JRQ9"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRQ9"
FT                   /protein_id="ABK01729.1"
FT                   /translation="MTGTRLGQYLAERLQDLVLESTDVQNFLTELSVFSAGFIGKTTGL
FT                   PVLCAVTLVRSRRSEASAGSGPGARLLGEIQRATGLSPSLAALEAGATVSVPDARADSR
FT                   WPRYNRAVVKAGQLSVLALPLQLDPGAAASVAFFAPEAGAFDDEAIVICEAFAARASKA
FT                   VRLAVRIGASKDLNDDLLEALKSRTSINLASGIVMGQSRCSQAEAFTILSKVSNNRNVK
FT                   LRVVAEELLRNFNTTPGATHFHG"
FT   gene            344911..345630
FT                   /locus_tag="Arth_0329"
FT   CDS_pept        344911..345630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0329"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: GAF domain protein; ANTAR domain protein;
FT                   KEGG: nfa:nfa2980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01730"
FT                   /db_xref="GOA:A0JRR0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR0"
FT                   /protein_id="ABK01730.1"
FT                   /translation="MAVKLPLADELAAIFARASELLLTDETVSKALELITAAAELAVPG
FT                   AAGAGVTLIDSDGRKHTASASHPMVQVADERQYELGQGPCLLAWASGEPVLVSDALHDR
FT                   RWPEWARAAAELGLRSSVSAPLLAGESALGAVKVYARSENSFDHTTVRLLELFAAQATI
FT                   FLINVQARESARTLSEDLRDALAHREIIAVAKGILMARHGLDEDTAMQDLLMESRRAKR
FT                   SLRDVSAELVSSTQLPR"
FT   gene            345644..345982
FT                   /locus_tag="Arth_0330"
FT   CDS_pept        345644..345982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01731"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR1"
FT                   /protein_id="ABK01731.1"
FT                   /translation="MALGKDEDEQRLRFEEMLRNADLTVEELWLRYFSIGGIAGQFEIE
FT                   AYTHGAIALPALQRDILAHALNERLDEINAPEGRAPYSRGSEDAGRLHDDRTHDDPERP
FT                   EDESGQDD"
FT   gene            complement(345965..346600)
FT                   /locus_tag="Arth_0331"
FT   CDS_pept        complement(345965..346600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0331"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP1783
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01732"
FT                   /db_xref="GOA:A0JRR2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR2"
FT                   /protein_id="ABK01732.1"
FT                   /translation="MNLAVERKPLRADAARNVDKIITAARKCFREYGPEVPLQTIAVTA
FT                   GVGPATLFRNFADKEQLVLAALNRQLRLMVDPVIDDALVGPDAAAGLFRVIDSLMAAAS
FT                   EDANLLGAVAGRRGLLTGITGSLFESVAVLLGRGQAQGTLRTDISMTDVIRLLAMLIGV
FT                   VDTMEPGSDAWRRPVALVEDAIRTERPRRPLPPQSPLPGTAFDSVVLA"
FT   gene            346704..347066
FT                   /locus_tag="Arth_0332"
FT   CDS_pept        346704..347066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0332"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   lxx:Lxx19070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01733"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR3"
FT                   /protein_id="ABK01733.1"
FT                   /translation="MLAFSVAPSGRPARIAGDSSADSTADSTALADADASVHDAVAAAV
FT                   KVVRDSGLPNHTDSMFTTIEGEWDEVFAVVKEATEAVGRFGSRVSLVIKADIRPGYSGE
FT                   LTAKVERLETAIADAG"
FT   gene            347150..347827
FT                   /locus_tag="Arth_0333"
FT   CDS_pept        347150..347827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0333"
FT                   /product="O-methyltransferase, family 3"
FT                   /note="PFAM: O-methyltransferase, family 3; KEGG:
FT                   mlo:mlr0279 O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01734"
FT                   /db_xref="GOA:A0JRR4"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR4"
FT                   /protein_id="ABK01734.1"
FT                   /translation="MVEHRPEPRWVAVEEYLTDVVVRPGSPLKRAVTSAADAGMPPIEV
FT                   APNAGKLLKLLVQLSGARRVLEIGTLAGFSTIWMAQGLPDDGDLVTCEYLPKHARVARA
FT                   NVDAAGLGHKVDIRIGAALDILPGLKDDGRGPFDFVFIDADKENNPKYLDWAIRLGRPG
FT                   TAIVMDNVVWEGALLDPSMDGVNAPGIISALEMMGEDPRLDGTVVQTVGSKGWDGFALA
FT                   VVR"
FT   gene            347949..348428
FT                   /locus_tag="Arth_0334"
FT   CDS_pept        347949..348428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0334"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   pac:PPA2134 starvation-inducible DNA-binding protein or
FT                   fine tangled pili major subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01735"
FT                   /db_xref="GOA:A0JRR5"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR5"
FT                   /protein_id="ABK01735.1"
FT                   /translation="MKASPTLASNLQMVLTDLIELHVQGKQAHWNIVGTNFRDLHLQLD
FT                   EIVTSVRLFADETAERMRALHALPDGRSATVSADTRLDPFPEGLTATKDAVKLITARLE
FT                   RTAKTMRDVHDEVDEEDPTSADLLHAGISRLEQLAWMVNAETMTAKAPVTVPDED"
FT   gene            348563..349588
FT                   /locus_tag="Arth_0335"
FT   CDS_pept        348563..349588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01736"
FT                   /db_xref="GOA:A0JRR6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR6"
FT                   /protein_id="ABK01736.1"
FT                   /translation="MLEAVSHAAGDVPALLALARQIGRTAPRPGEGSTAELWELLASVT
FT                   AVDVAAGRVLEPHLDAVAILAQAGSQAGEADPAASRTVDGTADGAWGVFAAEGPGLRLE
FT                   ATADGTGGYVLNGSKPWCSLAARLDGAVLTAHLEGGRAAFAVDLHSPGVSCETPQWTSR
FT                   GLREIPSGTVHFDGVSAVPVGGPGWYFQRPGFAWGGMGVAACWFGGAVAVARDFRSALA
FT                   AAADKGREPDQIALAHLGETDRIIASLAGYLARTAARIDAGELSGSGAWSEALRIRGTV
FT                   AAAVERVQTVVAQNLGPGPLAFNETYGKRMADLSLYIRQHHAMRDDAQLGALTLKGDRS
FT                   W"
FT   gene            349582..350997
FT                   /locus_tag="Arth_0336"
FT   CDS_pept        349582..350997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0336"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; NodS family protein;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   pfl:PFL_2879 methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01737"
FT                   /db_xref="GOA:A0JRR7"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR008715"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR7"
FT                   /protein_id="ABK01737.1"
FT                   /translation="MVTFSHADTGTAESEWEASGLSVLPELPLDPGELAAMTFIVLAAH
FT                   PDDETLGAGGFLSRLHAAGAAVDVLLCTAGEASHPDSPTTTPDQLAAVRLHEFRAAVSG
FT                   LAPAASRQFLHFRDGHLDADRDRIAAAVRETIDASGRPANQVVIVAPYRSDGHTDHDVL
FT                   GAVAAEVAAQGGHGLLEYPVWYWLWASPEDRAWQSWVRVPLTPDEQRAKAAALLAHSSQ
FT                   TQPLSDQPGDEALLAGSFLDHFSRAWETFAWHRPAGGTNSAGDAEQIFDAVHSRSADPW
FT                   RYTTSWYERRKRALTLAILPEANYGSGLEIGCSIGTLSVELASRCREFVAVDASSTALA
FT                   QAAERLSGYPSARTLHLTVPQHWPEGRFDLVVVSETGYYLTAEELAELFAQVEGSLNPG
FT                   GTLVLCHWRHPVSGWELDGDTVHALARQQLRWPTEGLYREKDFVLEVLVAPDGARAGAA
FT                   VPEPHPASGPDAP"
FT   gene            351016..351837
FT                   /locus_tag="Arth_0337"
FT   CDS_pept        351016..351837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0337"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pfl:PFL_2878 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01738"
FT                   /db_xref="GOA:A0JRR8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR8"
FT                   /protein_id="ABK01738.1"
FT                   /translation="MTSEMTERAGDYPAGEVRSGQGIERVVVVMPAHNEDQHLDRALAA
FT                   LRAAADTLQCERPGVDLAITVVLDSCTDRSADIASGYVAADPRFEAVQVRLGSTGASRA
FT                   AGVLASGITAGLRAGRVWLANTDADSAVPRNWLVRQVELADAGADAVLGSVEPDPAGTE
FT                   PAILRRWLERHPFREDHPHIYGANFGVRASAYLAAGGFPRMRVHEDRILVENLRRQAYT
FT                   VQATDTIRVLTSGRTHARAPQGFGAYLRALAMDLPVRDVPSLELHRDSGDL"
FT   gene            351892..354693
FT                   /locus_tag="Arth_0338"
FT   CDS_pept        351892..354693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0338"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein domain protein; Haloacid dehalogenase domain
FT                   protein hydrolase; cation transporting ATPase domain
FT                   protein; E1-E2 ATPase-associated domain protein; KEGG:
FT                   tfu:Tfu_2821 cation-transporting P-ATPase PacL"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01739"
FT                   /db_xref="GOA:A0JRR9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRR9"
FT                   /protein_id="ABK01739.1"
FT                   /translation="MPWFRVSGAARDWQAAAVIPGAASGAGALPLTAGLSSEEAALRLR
FT                   KVGPNRLPQARAVPGWRRLLAEMTHFFAIMLWCAALLAYIAGMPQLAVAIVVVVVVNGV
FT                   FAYIQQERAQHAASKLRELLPAMVSVRRDNRIVKVHTTELVPDDAVVLVAGDRVPADLR
FT                   LALAAGCSVDESMLTGESEPLAKAPGDTVFGGTFLVNGEAEGIVTVTGGGTRLAEIAAL
FT                   TGKVKAPPSPLARELQRIVRIIAAVALGIGGLFFVLSLLVGISWRDAFLFAIGVAVALV
FT                   PEGLLPTVTLSLAVGAQRMAQRNALVRNLEAVETLGSTTFICTDKTGTLTQNRMNAVEV
FT                   WTPEGVLSVIGAGYGPEAEVTGSGAGEARHLSTAALAASVGRAVLHEGKWIAEGDPMEA
FT                   AIHALASRLAGPGHDPGEPEVSHRFAFDPRRLRESAIVGTTLYVKGAPESVIPLCGLEG
FT                   ADRARQMVDRMASHGLRVLAVAERPLPGLPGASFKLESVEQDLTLLGLIGLHDPPRAEV
FT                   RLALEAARDAGIKVAMVTGDHAFTAAAIARETGLIGSPELVLEGHTLPEDDAVLTALLD
FT                   RDGVVVSRVTPEQKLRVARLLQRKGHVVAMTGDGVNDGPALQQADIGVAMGLSGTDVAR
FT                   EAADLVLLDDDFATIIAAVEQGRATYANIRRFLTYHLTDNVAELTPFVIWALSGGRFPL
FT                   ALSVLQILALDIGTDLLPALALGSEAPSKGALKRPPERRHLMDRALMFRVFGLLGPVEA
FT                   LFEMTAYTAVLLGAGWRPGAELPASDVLMAASGAAFTTVVLAQLANAFACRSASAPPWR
FT                   LGWFSNRLLLWAVLAELGLLAVFLFIGPVATLLGHAPPSPGGLAVALAAMPAVIIADWI
FT                   YKMVRGRRPGPAAPAPPLVPPAGRPAGLPAVQRQVRSKASDLREPGKRGSIHGGASGGS
FT                   SHG"
FT   gene            354686..357067
FT                   /locus_tag="Arth_0339"
FT   CDS_pept        354686..357067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0339"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="TIGRFAM: phosphoenolpyruvate synthase; PFAM:
FT                   PEP-utilizing enzyme; pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding; PEP-utilising enzyme, mobile region;
FT                   KEGG: noc:Noc_1446 phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01740"
FT                   /db_xref="GOA:A0JRS0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS0"
FT                   /protein_id="ABK01740.1"
FT                   /translation="MAESHVVWFDEIGMEHVPQVGGKNASLGEMTRSLKSRGVRVPDGF
FT                   ATTAAAYRTFIGANGIDAAMRARIAEYRAGKTTLRATGEAIRELFLASEFPEDIAESIR
FT                   SHYRTLAERAGLDRLSVAVRSSATAEDLPDASFAGQQETFLNISGERELLDACRRCYAS
FT                   LFTDRAISYREVKGFEHLDVALSIGVQRMVRSDVGASGVMFSIDTDSGFPRAAVISAAW
FT                   GLGETVVQGSINPDKYVVFKPLLADKGLAPIIEKTLGSKARKMVYSRGGHARTRTVDTS
FT                   AEERSSFVLDDAEILDLARWAVTVEDHYGRPMDMEWARDGVTGELFMVQARPETVQALK
FT                   SGTRFTIHHLRGTGKVLASGAAIGDSIAQGTACVIRSTRDIDTFRDGAILVTEMTDPDW
FT                   VPVMKRASGIVTDHGGTTSHAAIVSRELGVPAVVGTGNGTSVLGEDQAVTLSCAEGDQG
FT                   RVYEGTVPFDTEDVDLGALPATRTAVMVNIASPGASFQWWRLPAAGVGLARMEFIISNL
FT                   IRVHPMALVHPERVTDADETRQIKELTSGYADPREYFVEALALGIAKIAAPYHPHPVIV
FT                   RLSDFKTNEYAHLIGGSSFEQPEENPMLGFRGASRYYDERYREGFALECAALKRVRETI
FT                   GFANVIVMIPFCRTPDEADRVLAVMAANGLVRGENGLQVYMMCEIPSNVVLAEKFAPKF
FT                   DGFSIGSNDLTQLVLGVDRDSEQLAALFDERDEAVTAMISEAIRKAHAAGIKIGICGQG
FT                   PSNHPDFASFLVGEGIDSISLNPDSYLKTVRVIADVEASA"
FT   gene            complement(357019..359004)
FT                   /locus_tag="Arth_0340"
FT   CDS_pept        complement(357019..359004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0340"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: lpl:lp_3327
FT                   cadmium-/zinc-/cobalt-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01741"
FT                   /db_xref="GOA:A0JRS1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS1"
FT                   /protein_id="ABK01741.1"
FT                   /translation="MCPGRSALACQPTRQRRDLAVKLVLRYPLVAGTVLALLAVAVLLA
FT                   SGQPVIARFAASGYALAVAAYLSVGMLRRLRQGHWGIDILAVTAIVSTVLVGEFIASMI
FT                   IVLMMAGGTALEDYAAGRAKSELSALLARVPQTAHRERNGAASNGTATNGGAENGAHED
FT                   VAATDVRVGDILLVKPGEVVPLDGVLLSDAGTFDESSLTGESMPVERAAGEGIMSGSVN
FT                   GEAAVRMRVTAVMEDSQYSRIVELVKEASESRAPMVRLADRYAIPFTAFAYALGAIAWI
FT                   VSGSPTRFAEVLVVATPCPLLIAAPVAFLGGMSQAAKSGIIVKYAGVLEQLGKVRTAAF
FT                   DKTGTLTYGRPSLVAIVTADSMDQDELLRLAGSAEQYSSHVLAASVMEAATSRDLRFET
FT                   ASEALEQATHGVRAVFDGREVVVGKPSFVAEYAPGVVETELVSGQLAIYVGIGGVYVGA
FT                   LVMSDPLRAEARRTLAELSALGVTETVMLTGDALATAQHIAAEVGLTDVRAECLPPDKV
FT                   DAVKSLPLRPVMMVGDGVNDAPVLAVADVGIAMGARGSTAAGESADVVIILDDLSKAAQ
FT                   AVRIGQRTVRVAMESIWIGIVLSVGLMVAAAAGYVPAIAGALSQELVDLATILNALRAL
FT                   SPGRHGAPPKDQADASTSAITRTVLR"
FT   gene            359133..360140
FT                   /locus_tag="Arth_0341"
FT   CDS_pept        359133..360140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0341"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: chy:CHY_1591
FT                   polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01742"
FT                   /db_xref="GOA:A0JRS2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS2"
FT                   /protein_id="ABK01742.1"
FT                   /translation="MAGQPPLEPPLDPRRRRLAAGVLVAAAVIAAVVLAVILAGAPRGT
FT                   DPQSGSPSESGASSSSATAPPSTPATAVPGVPASSEPPPSPAPETPGESTAPAPVAPGP
FT                   TPPPETLPVPQPPPPAAPFPAGLAGQDVELVPGAGPSVALTFDAGANSAGLPSILQTLE
FT                   SAGVRGTFFLTGAWAAANPAGVAAIVAGGHRVGNHSQTHPDFTGLPDAGIVDQVRAAEQ
FT                   SIVAAGADPRPLFRFPFGARDTRTIAAVNNLGYVPVRWSVDTLGWKGTSGGITAQLVAD
FT                   RAVSALQPGEIVLMHIGSNPDDGSTLDADALPQMIERMRQAGYGFVTLDSLLAG"
FT   sig_peptide     359133..359240
FT                   /locus_tag="Arth_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.823 at
FT                   residue 36"
FT   gene            360239..363400
FT                   /locus_tag="Arth_0342"
FT   CDS_pept        360239..363400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0342"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   glycoside hydrolase, family 65 domain protein; glycoside
FT                   hydrolase family 65, central catalytic; glycoside hydrolase
FT                   family 65 domain protein; Haloacid dehalogenase domain
FT                   protein hydrolase; KEGG: nfa:nfa27660 putative glycosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01743"
FT                   /db_xref="GOA:A0JRS3"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS3"
FT                   /protein_id="ABK01743.1"
FT                   /translation="MTESPTAAAALAPVDAVVFDLDGVVTDTADLHAAAWKELFDDVLQ
FT                   DPRIPPTARRDPFTDADYLRYVDGRTREDGAASFLHSRGVDLPAGGPADGPAEWTAVGL
FT                   GARKNGIFERLLRLRSVPVFPGTLALLERLKAGKVPVALATASRNARAVLASAGLEDGF
FT                   DVVVDGNTAAQLGLAGKPDPALFLHAIGELGVAPERAVVIEDAVAGVAAGRRGGFGLVV
FT                   GIDRAGQRAELEAAGADFVLDDVSELDLGLVIADPWQLVYEGFDPAHEGHREALTTLGN
FT                   GYMATRGAAPEHRKDDVHYPGTYLAGVYNRLTSVIQGQETEDEHMVNMPDWLPLDLCVE
FT                   GGKWWSEGGLRLRSERRTLDLKRALLTREAVLEDDAGRQLDVVQRRLVSMAEPHLAALE
FT                   MTVTAVGWGGQVSIRSGCDTDITNSNVAVEALLSNRHLTDVTVSGADDGPGAATQVVLV
FT                   QTTQSRIGVAVAIRTDVPASLHPARPEELGGLFVHRFDVELRDGEPATATKTVAVATSR
FT                   DHAISSPRTAAVDVLNRSGGGFEVLLASHEAAWRGLLTPFIIEVDDSTESQLILNLHVF
FT                   HLLQTISAHTAELDAGVPARGLHGEGYRGHIFWDELFVLPLLTSRLPAVTRALLDYRWR
FT                   RLGTARDAARAAGFAGAMIPWQSGSDGREETPRLLFNSRSGRWVPDYSHLQRHSGLTVA
FT                   YNAWQYFEATQDRAWLTHHGAEIIVEVARLFASMAEYDPAADRFHIRAVVGPDEYHTGY
FT                   PDNPGGGLDDNAYTNVMAAWVCDQAVWIMSSVRGFDMDDFRERLRVTDNEIDGWARLGR
FT                   RVFVPFHADGIISQFAGYENLKELDWEHYRRTYRNVQRLDLILEAEGSSTNHYRLAKQA
FT                   DALMLLYVLGEDQLTTFLDRLGYTVTAEQIARTVDFYLARTAHGSTLSRVAHASVLAQL
FT                   DPERAWDTFREALDADLDDTQGGTTRAGIHLGAMAGSIDVIQRSFAGLRITRDALDFSP
FT                   RLPAELGRVTFNVRYRDQLLAVHLEKGRLLVSADPGDASPVLVRLGTQHVLLHAGQDHE
FT                   FRLAT"
FT   gene            complement(363441..364442)
FT                   /locus_tag="Arth_0343"
FT   CDS_pept        complement(363441..364442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0343"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   fra:Francci3_0264 alcohol dehydrogenase GroES-like"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01744"
FT                   /db_xref="GOA:A0JRS4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS4"
FT                   /protein_id="ABK01744.1"
FT                   /translation="MRAWWVGKPGPVAGHPLVFGDRPDPSPGPGEVLLSVRVCGVCRTD
FT                   LHLAEGDLPPRRTGVIPGHEVVGEVVDLGEGATRFRIGERVGVAWLGGTCGHCRFCLRD
FT                   QENLCLSPTFTGWDRDGGYADRVTVNEDYAYRIPDVFPDEQAAPLLCAGIIGYRALARA
FT                   QVPDGGRLGIYGFGGSAHLAAQVAMHRGASVYVMTRSEEARRLALELGAAFAGDADDEP
FT                   PVPLDAAILFAPVGWLVPQALRALDRGGTLAVAGIHLSDIPPLHYGSELFQERQLRSVT
FT                   ANTRADGEDFLRVAAEIPLRPTTVPYRMEDAARALQDLAADRITGAAVLHMD"
FT   gene            complement(364478..365332)
FT                   /locus_tag="Arth_0344"
FT   CDS_pept        complement(364478..365332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0344"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: cef:CE2791
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01745"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS5"
FT                   /protein_id="ABK01745.1"
FT                   /translation="MPAPARNPGGPVAVGYDGSEPSQLAVRWAAGHAAATNRTLKIVHA
FT                   WVWPVFTKNLGPVKGVEGSGLRHAAEATLQEGLDLARSVTAGLKATVVIDGVIEPGLPA
FT                   QVLRFAAEGAGVLAVGHRGMGRFLGQLVGSACLDLAVHSPCPLMVVRYPGRPGQPIAAG
FT                   IDEKPRHTKVVAEAARMAAGLNVPLQLIHVAGDQHQAQHGRHAPLHGKELLDQAVELAR
FT                   SLAPDVPVEGILLESHPVAKELLAAAAQADVLVLGAHHREGHPGSTVSSALERALCNVL
FT                   ITR"
FT   gene            complement(365417..366550)
FT                   /locus_tag="Arth_0345"
FT   CDS_pept        complement(365417..366550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0345"
FT                   /product="putative ribonuclease BN"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: lxx:Lxx00730 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01746"
FT                   /db_xref="GOA:A0JRS6"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS6"
FT                   /protein_id="ABK01746.1"
FT                   /translation="MAKNPATENGTAARPDAETQESSTAKARTAPAPDDSRKPDSPADV
FT                   SKPSWKYIAKKTFREFTKDQCPDLAAALTYYSVLSIFPALLALVSLLGIFGDAQKTTSG
FT                   LLDIVQGIAPGDTVNTIRPVVEDLSSSPAAGFTLVIGLLTALWSASGYVGAFGRAMNRV
FT                   YEVDEGRPFLKLRGTMLGVTVVNLLIVVVLAAMLVLSGPVAESVGNVIGLGDAFLAVWN
FT                   IAKWPVMLVLVIAAIAVLFYATPNVKQPKFRWMSMGSAIALVVFLLASLAFGFYVANFN
FT                   SYNKTYGAIGGVIIALLWLWILNMSLLFGAEFDAEMERGRQLQAGIEAEETIQLPPRDT
FT                   KQSDKLQVREEEDIRRGRDLRERHERERRDREQDQSP"
FT   gene            complement(366632..367228)
FT                   /locus_tag="Arth_0346"
FT   CDS_pept        complement(366632..367228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE2890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01747"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS7"
FT                   /protein_id="ABK01747.1"
FT                   /translation="MSENPDAIRADIEATRARLGTNVDAVADKVTPSNIVHRQTDKVKD
FT                   AVFGVKEKVMGTAEHATDRVHSGTGSAGAHLSDAGTAIGDTPRQVRAKTQGNPLAAGLI
FT                   AFGAGMLFSSLIPASEKEREAADALKTKAEPLTTELTEAAKDVAQGLKAPAQDAMENVK
FT                   ATAMEATDHVKAEGQGAVDDVKYRAADAKDNVQQV"
FT   gene            complement(367262..367684)
FT                   /locus_tag="Arth_0347"
FT   CDS_pept        complement(367262..367684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0347"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   cef:CE2889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01748"
FT                   /db_xref="GOA:A0JRS8"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS8"
FT                   /protein_id="ABK01748.1"
FT                   /translation="MSSQFPETTPEAAHVKADNTSLGDLLGDVTRDISTLMRQEVELAK
FT                   AELKQSASRAGKGGGMLAGAGVAGHFVLLFLSLALWWALGTVMGLGWSAVVLAVIWGIV
FT                   AAVLASVGRKQLNAIKGMPQTAETLQEIPPTLKPSH"
FT   gene            complement(367681..368640)
FT                   /locus_tag="Arth_0348"
FT   CDS_pept        complement(367681..368640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE2888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01749"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRS9"
FT                   /protein_id="ABK01749.1"
FT                   /translation="MTENRWPQDGSYGTPGVAEQTAVPATPETDAAYDTSYAAPQGTSK
FT                   TETAKHEAGDVAHQATDSAQHVAETAKAEAANVAGEVKANAKDLFHQARTDLTDQAGTQ
FT                   QQKVAKGLHSISGELRTMADASDQPGVATDLIRQAADRSASVASWLEGRDPGSLLDEVK
FT                   TFARQRPGTFLMLAAGAGILAGRLTRSLSAGAPDSTGATLSGGTSRAPISSVPGYVPDT
FT                   GTAVPPPPVQMPAPDANTAGLSVAGAGAGSYAGTSAYTDERTGADSYSEDTYPPNPLAD
FT                   EGTGQDQWAADPLAKDPLATDPLADDPYRDDPLRGGQR"
FT   gene            complement(368794..369828)
FT                   /locus_tag="Arth_0349"
FT   CDS_pept        complement(368794..369828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0349"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: cef:CE0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01750"
FT                   /db_xref="GOA:A0JRT0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT0"
FT                   /protein_id="ABK01750.1"
FT                   /translation="MRIAITGASGNVGTALLRRLQRARAERPDTLEIVGIGRRPPNHAA
FT                   PPYGGVEWHALDIADDDGAPLRAALARADAVVHLAWLLQPNHNLAALHRTNVTGTANVL
FT                   RAAREAGVGHVVCASSVGAYARSGKETRRAEDWPATGIRESHYGRHKAEQEVLLDRFAA
FT                   ENPAITVARLRPALTFQAEAGSEIGRYFLGRALPRLLPQKLRLPIIPLPRGLAFQAVHA
FT                   DDVADAYWRVLDRRAAGAFNIAAEPVITPVELARIFQAVRWLPIPFGLVRAAVDLSWRL
FT                   RLQPTDAGWIAMAEGAPVMDTHRARGVLGWEPRTSSVDAIREVLEGLTAGRGTEGSPPL
FT                   TPRS"
FT   gene            370006..370833
FT                   /locus_tag="Arth_0350"
FT   CDS_pept        370006..370833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0350"
FT                   /product="RNA polymerase, sigma 28 subunit"
FT                   /note="PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2; KEGG: fra:Francci3_3755 sigma 28
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01751"
FT                   /db_xref="GOA:A0JRT1"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT1"
FT                   /protein_id="ABK01751.1"
FT                   /translation="MAESQQSPQILKPEQPHSHPGRIQQTFENHLVLDYLDLAEALAAR
FT                   FQARGRDRADLNQVAYLGLVKAARGFDEARGASFPAYAAPTITGELKRYLRDRCWMVRP
FT                   PRHVQDLRSELLRAEPALAQSLGRPPSAAELARELAVSPEAVNEATAAAASLHPDSLDA
FT                   VDANTDTAPLAETLSSGEDPLARLEELICLNQAIHELTAEDQELLYRRYFCEESQAELG
FT                   RRFGVSQMQVSRRLSRVLVQLQRLLQDGDSPDWGSKEGTDQSSPSPRRAASTS"
FT   gene            complement(370791..371777)
FT                   /locus_tag="Arth_0351"
FT   CDS_pept        complement(370791..371777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0351"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   nfa:nfa32610 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01752"
FT                   /db_xref="GOA:A0JRT2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT2"
FT                   /protein_id="ABK01752.1"
FT                   /translation="MGSTASGSTTTDSTAASCVQPALLVLRALKLGDLLVSVPALHALR
FT                   RAFPGHRLVYAGPAWLEDIVELVGGFELLPAALDTPLAVKPGTVDIAVNLHGRGPESTA
FT                   LLQAIRPRRLIAHSPAVGGPPWVEQMHERERWTRLLRWHGIEADPLDLRLDRPRVSGQR
FT                   AAGPGAAEAVVHVGAAYGCRLWPEGRFAEVASALNAAGHNVVFTGSADERERALRVARE
FT                   AGLPDEAVVAGRQRLSEFAAVIADAGVVVSADTGAAHLAAAYARPSVILFGPAPPERWG
FT                   PPAAGPHVVLTRADLRRGDVFADEPDPALLGVGVQDVLAALRGLGLL"
FT   gene            371889..372443
FT                   /locus_tag="Arth_0352"
FT   CDS_pept        371889..372443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0352"
FT                   /product="hydrolase, HAD-superfamily, subfamily IIIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; histidinol-phosphate phosphatase family protein;
FT                   hydrolase, HAD-superfamily, subfamily IIIA; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: sco:SCO6182
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01753"
FT                   /db_xref="GOA:A0JRT3"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT3"
FT                   /protein_id="ABK01753.1"
FT                   /translation="MASSSIPPPKAVLFDRDGTLVRDVPYNGDPRLVAPMPRAREVLAG
FT                   LRGRGIATGVLSNQSGIARGLLSRGQVDSVNSRIEALLGPFDVWEICPHGTEDGCGCRK
FT                   PAPGMILSACRRLGIRAAEAAYIGDIGSDMEAAEAAGLRGILVPTPLTRPQEVEAAPEV
FT                   AADLSAAVALLLGPAAGGNRR"
FT   gene            372440..373513
FT                   /locus_tag="Arth_0353"
FT   CDS_pept        372440..373513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0353"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   sco:SCO6183 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01754"
FT                   /db_xref="GOA:A0JRT4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT4"
FT                   /protein_id="ABK01754.1"
FT                   /translation="MNRVLVARLDSVGDVLLAGPAVRAVANGRRADGGAPNDVVLLCGP
FT                   QGEAAGLLLPGVSEVHSWACPWIIHPAPAVAGEDVDRLVTFVRDSRIAEAVILTSFHQS
FT                   PLPLALLLRLAGVSRITGASVDYAGALLDVRLRPGEDFSEDQPEVERALGIARAAGFVL
FT                   PPGDDGRLRVADPPDAGELVGEGPYIVVHPGSSAQSRAWPPLHHAAAVELLEGAGHRVV
FT                   VTGGPGETELTATVAGPSGLDLGGRTDLRALSGVIAGARAVVTGNTGPAHIAAAVGTPV
FT                   ACLFSPVVPAVRWAPYGVPLELLGDQNAPCRLSRARDCPVPGHPCLASVSPEDVVDAVE
FT                   RLISGVSSLSTRRKVRQ"
FT   gene            373510..374526
FT                   /locus_tag="Arth_0354"
FT   CDS_pept        373510..374526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0354"
FT                   /product="transferase"
FT                   /note="KEGG: sco:SCO6184 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01755"
FT                   /db_xref="GOA:A0JRT5"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT5"
FT                   /protein_id="ABK01755.1"
FT                   /translation="MRILLWHVHGAWTDSFVRGPHEYLLPVLPGGGPWGLGRAGRNWPE
FT                   SVREVALESLDAGSIDAVVLQRPEEIAEVGRALGRQPGKELPAVYLEHNTPRGNVPSTV
FT                   HALADQHAIPLVHVTHFNALFWDSGSAATTVIEHGVPDPGYLYTGEFPELAVVVNEPVR
FT                   RGRVTGTDLLPRFAGAAPLQVFGMGGDELPGHTGLPPSRLTVRGDLATAELHRELARCR
FT                   VYVHPLRWTSLGLALLEAMHLGLPVVVLATTEAARAVPPEAGAISTDVGELVRQARVLV
FT                   SDPGEARARGLAARQAALERYSLGPFLDAWDALLDDLVSPRFRKSRILVPAHERKLP"
FT   gene            374523..375770
FT                   /locus_tag="Arth_0355"
FT   CDS_pept        374523..375770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0355"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mpa:MAP3246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01756"
FT                   /db_xref="GOA:A0JRT6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT6"
FT                   /protein_id="ABK01756.1"
FT                   /translation="MRISMVSEHASPLAALGGVDAGGQNVHVAALSTALARQGHHVTVY
FT                   TRKDDAGLPPRVRILPRLEVVHVAAGPARHVPKDGLLPYMDRLAVGIAEDWDGGQPDIV
FT                   HAHFWMSGLAALDAVRRSGANVPVVQTFHALGTVKRRHQGADDTSPQQRRWLEPAVGRS
FT                   ADRIIATCSDEVFELKAMGIDTAKISIAPCGVDLELFREAGPAEPRPRSHRILSVGRLV
FT                   PRKGVDLVIRALPLLRDAGFDDVELLVVGGGGEAAMGADPEARRLGELARELGVENQVT
FT                   LRGQVPREEMPGILRSADAVVCTPWYEPFGIVPLEAMACGVPVVAAAVGGLTDTVVDGA
FT                   TGLHVPPRDPAAIARAAARLLASPELRLELGRAGLQRARSRYSWDRVADETEKAYQQAL
FT                   AAIAAPQLEPMEGAAL"
FT   gene            375767..376492
FT                   /locus_tag="Arth_0356"
FT   CDS_pept        375767..376492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0356"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="KEGG: sco:SCO6186 putative phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01757"
FT                   /db_xref="GOA:A0JRT7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT7"
FT                   /protein_id="ABK01757.1"
FT                   /translation="MTTEWTLREEELPVLPPHIVRPHVFAPDPGADGRRGGNTRPDSVL
FT                   AVQEHLDNVIPALESLRGQAYHLAAWGEELARRLLRGQRLLAAGNGGSAAEAQHLTAEL
FT                   VGRFDGERVPFSAISLHAETSAVTAIANDYGFEELYARQVRAHGRSGDVLILLSTSGKS
FT                   PNLLRAADVATRLNITTWALTGPAPNPLASRCDEAVTIQALSANAQEGHLIALHAMCRA
FT                   FDAEVARRGRNAACTGSLP"
FT   gene            376489..377874
FT                   /locus_tag="Arth_0357"
FT   CDS_pept        376489..377874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0357"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; PfkB domain protein; KEGG:
FT                   sco:SCO6187 bifunctional synthase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01758"
FT                   /db_xref="GOA:A0JRT8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT8"
FT                   /protein_id="ABK01758.1"
FT                   /translation="MKIVVVGDVLLDVDIDGEATRLCPDAPVPVVDVENVRRRAGGAGL
FT                   VARMLAGDGHSVTLLTVLADDEAARHLERALEGITVVAGASGAPTPVKTRVRAEGHPVV
FT                   RFDEGCAPPPDPAVTPAMLHALERAAVIIVADYGRGLTSNVELRSVLATLAGRISIVWD
FT                   PHRAGAHPVPGVAVVTPNLTEAQTFARNFARAAGSAEAVNDDPAALARDLRLRWQSKAV
FT                   MVTMGSQGAMLVHGTAQPALPIPAPKTTVTDPCGAGDRLAASLAVHLMDGHTLDVAAVL
FT                   AVREAASFLRHGGVAGLAGEPKPVNLQGRDTDALALARSVREAGGIVVATGGCFDLLHA
FT                   GHTRALAAARSLGDCLIVCLNSDESVRRIKGPGRPILNQEDRAELLLALEFVDAVMVFD
FT                   EDTPEACLAALQPDLWVKGGDYDVTQLPETALVESWGGRCTTVPYHPSRSTTDLADALA
FT                   RVS"
FT   gene            377914..378648
FT                   /locus_tag="Arth_0358"
FT   CDS_pept        377914..378648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0358"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Insect alcohol
FT                   dehydrogenase family; KEGG: mpa:MAP3253 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01759"
FT                   /db_xref="GOA:A0JRT9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRT9"
FT                   /protein_id="ABK01759.1"
FT                   /translation="MTDETFRDPSRGSFRAPSPGRVLVTGGASGLGAAVVEAVLDAGGT
FT                   PVVLDRDIRNVAAAKAFEVDVADRLAVSAAVREAAETLGGLDAVVTAAGIDRCGKLEDV
FT                   PAEDWEQVVFVNLFGTVSVVRAALPYLKASGGRVVTVASTLGKRALPEASAYCASKFGV
FT                   VGFSHALAAESGGEIGVTTMIPGGMKTRFFDDRAEKYKPQDDSRLNDPANVAQAILFAL
FT                   SQPRGCEVREMLICHEDEGSWP"
FT   gene            complement(378602..379810)
FT                   /locus_tag="Arth_0359"
FT   CDS_pept        complement(378602..379810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0359"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   nfa:nfa23990 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01760"
FT                   /db_xref="GOA:A0JRU0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU0"
FT                   /protein_id="ABK01760.1"
FT                   /translation="MRGTTADDRPRRGVGPVLGTFQDVARIAVLRGGGLGDLLFAFPAV
FT                   SALKAAYPGSTVTVLGTPLHAALVQGTAGPVDAVRILPYADGVRPGEEDPAALDSFFAD
FT                   MQREQFDLALQLHGGGRYSNPFLLRLGARHTVGTQTPDAAPLERNLPYAYYQHEPLRAL
FT                   EVAGLAGAPPVELEASLRPLPQFAARAGELLDADLPDADLPDGVPSRRAGSAGRTTRPV
FT                   VVIHPGATDPRRRWPAGRFAELAAACVADGCRVLVAGDRSERQLAAEIVDRAGSALVRP
FT                   IAGEADLGTLAALLARCDVMVANDSGPRHLAQALGTPTVGIYWAGNLINAGPLGRTLHR
FT                   VHLSWLTHCPECGADVTQVGWTAPRCAHDSSLVAGVRAEDVYADVRLLMATSPHLRGRS
FT                   ASP"
FT   gene            380076..381491
FT                   /locus_tag="Arth_0360"
FT   CDS_pept        380076..381491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0360"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: nfa:nfa45120
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01761"
FT                   /db_xref="GOA:A0JRU1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU1"
FT                   /protein_id="ABK01761.1"
FT                   /translation="MSAIVQRIHNGAKDLIVIRDPRTGEEVGSLAEAEPLHVRRAVNAS
FT                   RAALHDWARTPPAERGSCLRAAARALAEAAPALARMNNRETGRPVDEALAGIEAGIATL
FT                   EQYAELGPVHRGHSLRGNPLASDYTVAEPRGVAVLLTPWNDPVAVACGLIGAALVTGNT
FT                   VVHKPSERCPHLGAMLGDVLATAVPAGVLISLTGGSGVGALLAEQSGVDVVAHVGSSAA
FT                   GARIAKASNVTGAHVIRENGGNDPLLVDDDVDPVWAAEQAAVGAFSNSGQICTAVERIY
FT                   VHRAVAGPFCEALEQAARRRNRKGSLAPLVDVRLRDAVHRQVENALQAGARAVEGGSVL
FT                   AGPGAYYPATVLLDCTADMDIMAEETFGPVAPVQVVDSFDDGLRLAAKGRYGLAATVLT
FT                   GRIAHAQEAIAALPVGTVKVNAVFGGAPGGAAQPRGDSGHGFGYGPELLDEFTRVKVVH
FT                   VAAPPSGGENGRP"
FT   gene            381509..383059
FT                   /locus_tag="Arth_0361"
FT   CDS_pept        381509..383059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0361"
FT                   /product="D-beta-D-heptose 1-phosphate adenylyltransferase
FT                   / D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.7.-"
FT                   /EC_number="2.7.1.-"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; rfaE
FT                   bifunctional protein; PFAM: cytidylyltransferase; PfkB
FT                   domain protein; KEGG: nfa:nfa24110 ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01762"
FT                   /db_xref="GOA:A0JRU2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU2"
FT                   /protein_id="ABK01762.1"
FT                   /translation="MAGEPPAAEGGPAGLDGQRALADWLPGRLADMGASVTVVGDVMLD
FT                   GWWNGSIARLCREAPAPVVDISRRAFAPGGAANTAMNLAALGARVRMAGVVGCDDAGLE
FT                   LRRRLRAAGVNVSHLQEHPGMVTTTKTRISSAGQVLLRFDDAAQRVPQDALAALALTLP
FT                   SALQGQDAVVVCDYGLGALAGPVRAALVAALRGRTGPPLTVVDAHDPRPWAVLQPDVAT
FT                   PNALEAAGMLGMTLPGGADRADSLAARRDELAEAAGARAVVVTLDRDGTLLLPAAGDSH
FT                   RTWARPAKEKQASGAGDTFVAALTLARASGLPLTTSVDFAQAAADVVVHHPGTSVCSSE
FT                   DLTRYLASFADTALSADELARHVEGDRAEGRRIVLTNGCFDVLHRGHTRYLNQAKQLGD
FT                   ILVVALNTDESVRQLKGPDRPINSVADRAAVIAALSCVDYVTVFDTPTPIPLIEKIRPE
FT                   IYAKGGDYTPEMLAETEAVERFGGVVTILDYVPDQSTTGVVQRIRNGEGAAVGEAPVN"
FT   gene            383093..384025
FT                   /locus_tag="Arth_0362"
FT   CDS_pept        383093..384025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0362"
FT                   /product="putative spermidine synthase"
FT                   /note="KEGG: cgb:cg1394 putative spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01763"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU3"
FT                   /protein_id="ABK01763.1"
FT                   /translation="MARKGRSAGRNAERSTPGVVEVPKGTRPNGPVEGVYYIDTGDCEL
FT                   IADQDNSNGWLLRINGVMSSHIDLADPLFLDFEYMRWMSALVESRWPREGRPKLRALHL
FT                   GGGACSLARYFHAAYPEARQVVVELDGKLAEYVRGWFDLPKAPLLRLRVGEAREVTESL
FT                   TPQTRDVVIRDVFAGALTPRPLTTAEFNEHARRVLAPGGIYVVNSGDAPDLKNAREDAA
FT                   TIAAVFEHTLIIADPAMLKGRRYGNMVMAGSDQPFDDDPRLARRLLGGGVPAHIWDDAK
FT                   VRAFAAGAAVRHDPAPHSPGAPDQQPGSH"
FT   gene            complement(384238..384984)
FT                   /locus_tag="Arth_0363"
FT   CDS_pept        complement(384238..384984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0363"
FT                   /product="ANTAR domain protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: sco:SCO4029
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01764"
FT                   /db_xref="GOA:A0JRU4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU4"
FT                   /protein_id="ABK01764.1"
FT                   /translation="MAPGTGDAPSPEQLQDLLLESPGFAEFLLGLTTISASRLGGLNPM
FT                   LCAITVERDGSPATVASSDNEALRMDEKQYAYDDGPCLTALRQQHTVLVPDLGNDSRWE
FT                   NYARAVSGEGIRSVLAVPIRTDPGAAAALNCYARSTDAFDAATIASVEEHTDSISRILR
FT                   LALRVHPAEIYPEHLRSALKSRAVIDAAVSLIMVQNRSSRDQAMELLHLAAQASDSKLH
FT                   TIAADILSGAELPGGGTTPGGGIRQE"
FT   gene            complement(385161..386096)
FT                   /locus_tag="Arth_0364"
FT   CDS_pept        complement(385161..386096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0364"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: nfa:nfa28680 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01765"
FT                   /db_xref="GOA:A0JRU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU5"
FT                   /protein_id="ABK01765.1"
FT                   /translation="MAKPALVVCRIADMEANPDDLLVLLAVSRSAKFTTAAQALGLNHT
FT                   TVSRRIAALEKTLGGRVLSRAAGAWELTELGAEAVMVAEQVEKAVRSLGKPGQAPDPIT
FT                   GVVRMTATDGFSAYVAAPAVAKLRRKHPGLSVEIVTVTRRALQQRSGLDIEVVVGEPQV
FT                   HRAEAFKLGEYVLGMYASRAYLAENGTPATVEELTEHPLVYFVDSMLQVDDLDAPRRLV
FT                   PAMKDGLSSTNVFVHVEATRAGAGIGFLPCFMGDLHPDLVRLLPDAFSERLPYWMVLRP
FT                   DSMRRPAVAAVVQALRDQTVEHREHLLGRS"
FT   gene            386190..387569
FT                   /locus_tag="Arth_0365"
FT   CDS_pept        386190..387569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0365"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: nfa:nfa28670 putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01766"
FT                   /db_xref="GOA:A0JRU6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU6"
FT                   /protein_id="ABK01766.1"
FT                   /translation="MSVEQRSATPAASAPKGAGLKKIVAASMVGTVVEWYEFFLYATAA
FT                   TLVFGKYFFPATGNELDGIIQAFITYAVGFVARPLGGIVFGQIGDKLGRKPTLQLTIVI
FT                   IGVSTFLMGCLPGFAEIGYLAPALLVFLRFIQGFALGGEWGGAVLLVAEHSPNESRGFW
FT                   SSWPQSAVPVGNLLATLVLFIMSNVLSSADFLSWGWRVAFWLSAVIVFVGYYIRTNVSE
FT                   SPIFLEAKARLEQEQAVSFGVGEVIRKYPKGILQAMGLRFAENIMYYLVVSFAIVYLKS
FT                   VHKYDTSSLLLALLIAHLIHFLVIPQVGRLVDSWGRKPVYLVGAITGATWPFFAFPMFD
FT                   TKNAVVIVLAVTIGLCLHAFMYAGQPALMAELFPTRMRYAGVSLGSQVTSIFAGSLAPL
FT                   LATQWLKDTGSWVPTAIYLVVACAITTVAVLSLRETKGIALEEVDRADAEREGLAVAAA
FT                   R"
FT   gene            387646..388395
FT                   /locus_tag="Arth_0366"
FT   CDS_pept        387646..388395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0366"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /note="TIGRFAM: 3-hydroxybutyrate dehydrogenase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: nfa:nfa28660 putative
FT                   short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01767"
FT                   /db_xref="GOA:A0JRU7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU7"
FT                   /protein_id="ABK01767.1"
FT                   /translation="MEHTLNGRKALVTGGAGGIGAASVRALAARGAKVVIADVDEAAAA
FT                   ALADEVGGTVWAVDLLDVDALATTSLDCDILVNNAGIQRISPIEDFDPADFRRLITLML
FT                   EAPFLLIRAALPHMYANNFGRIINLSSVHGLRASPFKSAYVSAKHGLEGLSKVTALEGG
FT                   AHGVTSNCINPGYVRTPLVESQIADQAKVHGIPESEVLAKIMLTESAIKRLVEPEEVAS
FT                   LVAWLASNDAGMVTGASYTMDGGWSAR"
FT   sig_peptide     387646..387732
FT                   /locus_tag="Arth_0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.915 at
FT                   residue 29"
FT   gene            complement(388516..389151)
FT                   /locus_tag="Arth_0367"
FT   CDS_pept        complement(388516..389151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0367"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   nfa:nfa34180 putative translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01768"
FT                   /db_xref="GOA:A0JRU8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU8"
FT                   /protein_id="ABK01768.1"
FT                   /translation="MVPLSNLLTFAVAASVLIAVPGPSVLFVIGRSLALGRKGGLLSVL
FT                   GNALGMVPQIAAVALGVGVALAQSVLLFTIVKFAGAAYLVFLGIQAIRHQGRSTTAADP
FT                   SRSASTFRVLRQGFIVGATNPKSLVFFVAVLPQFVEYSAGGIPLQLASLGAVFLLIALV
FT                   SDSIWALAAGTARQWFARSPKRISTLSTTGGAMMIALGGTLALTGTKH"
FT   sig_peptide     complement(389092..389151)
FT                   /locus_tag="Arth_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.592 at
FT                   residue 20"
FT   gene            complement(389231..389509)
FT                   /locus_tag="Arth_0368"
FT   CDS_pept        complement(389231..389509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01769"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRU9"
FT                   /protein_id="ABK01769.1"
FT                   /translation="MKDLPASRPTLPRDRRRLISWLSDAAEKVRTATVPFKIGDVVLGD
FT                   DPFNGRRLGVVAVIRGSSLGLRTAADAHPDLVPEVIYYDYRQVRTPE"
FT   gene            complement(389688..391202)
FT                   /locus_tag="Arth_0369"
FT   CDS_pept        complement(389688..391202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0369"
FT                   /product="histidine:proton symporter, AAT family"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pae:PA5097 putative glycine betaine/proline transport
FT                   system permease protein; TC 2.A.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01770"
FT                   /db_xref="GOA:A0JRV0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV0"
FT                   /protein_id="ABK01770.1"
FT                   /translation="MQQAPTAAKAAAPENTTTAPGTAGGTVRAAAGTAVDAVLNRGLNV
FT                   RHIRFMALGSAIGTGLFYGSASAIQKAGPAVLLAYMIGGAAVFMVMRALGEMAVRHPVS
FT                   GSFGQYASRYLGPLAGFVTGWTYVFEMAIVAIADVTAFSIYMGFWFPDVERWIWVLAII
FT                   FFLAALNLLSVKVFGELEFWFSLIKVVAIIAMIAGGAAIIIFGFQAGGATVAPGIGNLV
FT                   EHGGLFPNGFEGLLASFAVVMFAFGGIETIGVTAGEAADPKNVIPKAVNTVPVRVLLFY
FT                   VLTLAVLMSLFPWNEVGTNGSPFVQIFSGLGIPAAPHILNAVVITAALSAINSDIFGAG
FT                   RILFGLARQGHAPASFGKVSRNGVPWMTVVMMAVVLLVGVVLNAVMPEDVFLLIASIAT
FT                   FATVWVWVMILASHVAMKREIARKGLPASEFPSPWWPAASVLTIAFMAVVIAILGAFED
FT                   SRVALYVGAVWLGVLVLAYRVWVRGHGRARAELVDETAPSHAEPGK"
FT   gene            391445..393115
FT                   /locus_tag="Arth_0370"
FT   CDS_pept        391445..393115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0370"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: fra:Francci3_0800 HNH
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01771"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV1"
FT                   /protein_id="ABK01771.1"
FT                   /translation="MESSAAVETMEAVEASIAVLAACVGRGAGNPGSTGDDPLREQADA
FT                   CLDGLAAAARVEAGMAALKVHLAAGYARAARAMAPPALSPQEHTVQDMAVTAEVACVLT
FT                   VSERTAGALLAEAHALTTTLPLTLSALQSGSISWQHARVMVDETDNLDEAGAAGLEAHF
FT                   LDPDAPSAARGCPVGGLVPARFRAKARTWRERHHPVSIEKRHSRSAADRRVQYTPDRDG
FT                   MAWLSAYLPASQAAGVWDRITTAARSLQGADEARTLTQLRADVAATWLLTSGLETAANS
FT                   AAGELPSPAAQVLITVPALSLLGLTEEPAMLDGYGPVPPSMGRALVAEGASSFLRVLTD
FT                   PRDGAPLEIGRTSYRIPKALRQWLRLRDGKCPFPGCNNQSLDNDADHLLAWDEGGPTGI
FT                   SNLGQPCRKHHRLKHGTAWTPAGAGTHEPPGWTSPMGRHYASEQPDWEPPLWLAEILAM
FT                   ATSRDPGDPDPGRPDPGTLEPGALCSGMPDYLDEPPPEVDLTDHLLAEDPFKDWELFLA
FT                   YDSCAAAQESAAPGSAAWESAAGLLCLEERWAMDSYAAP"
FT   gene            complement(393396..394313)
FT                   /locus_tag="Arth_0371"
FT   CDS_pept        complement(393396..394313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0371"
FT                   /product="short chain dehydrogenase"
FT                   /note="KEGG: bha:BH0410 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01772"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV2"
FT                   /protein_id="ABK01772.1"
FT                   /translation="MTKPLAGKVALVAGATRGAGRGTAVALGETGATVYCTGRSAGGRR
FT                   SDYNRPETLEETAVQVNAAGGVGIPVAVDHLDPAAVQSLVQRIDDEHGRLDILVNDIWG
FT                   GEKLIEWDAPVWAHHLNSGLLMLHTAVDTHLITSHFALPLLIRNPGGLVVEMTDGTREY
FT                   NAGHYRVSTFYDLAKNAVLRLAFSQAEELKQFGCTAVALTPGWMRSEMMLEHFGVTEEN
FT                   WRDAAAVQPHFAAISESPRFVGRAVAALAADPNVHGRTGGSFSSGGLALEYGFTDIDGS
FT                   RPDCWRYLVEVQEAGRPADASGYR"
FT   sig_peptide     complement(394233..394313)
FT                   /locus_tag="Arth_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.481 at
FT                   residue 27"
FT   gene            complement(394324..394722)
FT                   /locus_tag="Arth_0372"
FT   CDS_pept        complement(394324..394722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01773"
FT                   /db_xref="GOA:A0JRV3"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV3"
FT                   /protein_id="ABK01773.1"
FT                   /translation="MPLLPPGASMESTHCCEEATMVWIAGLFLVAHGLIHLAIWLPKAD
FT                   PKAPFDAGHSPFAGNVRHTAAAMAVAAAVVLAAGGLGLIGGASWWPPATITGAALSTAR
FT                   LLLTFNKWWLIALGINAAIIVLSVQQNA"
FT   gene            394901..395728
FT                   /locus_tag="Arth_0373"
FT   CDS_pept        394901..395728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0373"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein, ArsR; regulatory proteins,
FT                   IclR; KEGG: lxx:Lxx22150 transcriptional regulator, IclR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01774"
FT                   /db_xref="GOA:A0JRV4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV4"
FT                   /protein_id="ABK01774.1"
FT                   /translation="MADGEAPARTAAKAPAKVSSKVPAAENTLRILKLLASKRGPMAAS
FT                   NIATALGLPRSSVYHLLGVMEANGFVMHLHEEQRYGLGISAFELSSAYSRQEPLSRIGR
FT                   PMLASLVDVVGESAHLAVLHGRDVLYIVEERAKNRPSLVTDVGVRLPSHLTASGRAILA
FT                   ALPKSQVRALYPNAAAFTARHDVEGAIMKYSALSSHLDQVRQRGYATEHGEVTPGFGSI
FT                   AAAVTDHVGWPTAAVAVTFLEDKLPADQWPALAARVRKVADELSVRIHGRPAS"
FT   gene            395948..397642
FT                   /locus_tag="Arth_0374"
FT   CDS_pept        395948..397642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0374"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: nfa:nfa12270 putative urocanate hydratase;
FT                   TIGRFAM: urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01775"
FT                   /db_xref="GOA:A0JRV5"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV5"
FT                   /protein_id="ABK01775.1"
FT                   /translation="MAPADFTTGARPVKAARGTELTAKSWQTEAPLRMLMNNLDPEVAE
FT                   RPDDLVVYGGTGRAVRSWAAFDAITRTLETMEKDETLLVQSGKPVGVFRTNEWAPRVLL
FT                   ANSNLVGDWANWPEFRRLEAEGLMMYGQMTAGSWIYIGTQGILQGTFETFAAIARKLTG
FT                   DENGTLAGTLTLTGGCGGMGGAQPLAVTLNEGACLIVDVDETRLRRRAGKRYLDEVETD
FT                   LDAAIAKVLKAKEERRGWSVGYVGNAAEVFPEILRRHNAGELTVDIVTDQTSAHDPLSY
FT                   LPEGITVEEWHREAAADPEGFTKKAQASMAKHVQAMVEFQDAGAEVFDYGNSIRDEARK
FT                   GGYNRAFEFPGFVPAYIRPLFCEGLGPFRWVALSGDPEDIRVTDEAIKELFPENKHLHR
FT                   WIDAAQERVEFEGLPARICWLGYGERAKAGLLFNQLVKEGKVKAPIVIGRDHLDSGSVA
FT                   SPYRETEAMADGSDAIADWPLLNALLNTASGATWVSIHHGGGVGIGRSIHAGQVSVADG
FT                   TDLAAEKLERLLTNDPGMGVIRHADAGYDRAVEVAKERGVRIPMNEK"
FT   gene            397652..399244
FT                   /locus_tag="Arth_0375"
FT   CDS_pept        397652..399244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0375"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: sma:SAV3325 putative histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01776"
FT                   /db_xref="GOA:A0JRV6"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV6"
FT                   /protein_id="ABK01776.1"
FT                   /translation="MTLTTHEPLTVTLGSSGVTPEDVVAVARHDAKVTISQEALDTVAK
FT                   VRAHIDDLAHSEVPAYGISTGFGALANRHIPNELRTQLQKSLIRSHAAGMGPAVEREVV
FT                   RCIMFLRAKTLASGRTGVRPVVLQTMVDVLNAGITPVVREFGSLGCSGDLAPLSHCALV
FT                   LMGEGEAEGPDGTLYGNKGQKPVAELLAEHGIEPVVLAEKEGLALVNGTEGMLGMLLMA
FT                   IADIRQLLTTADITAALSVEALLGTDQVFLPELHAALRPHPGQAASADNMLRVLSNSPI
FT                   VASHRINDTKVQDAYSLRCAPQVAGAVRDTVDHAALVASRELAAAIDNPVVLPDGRVSS
FT                   NGNFHGAPVAYVLDFLAITVADLSSIAERRTDRMLDPARSHGLPAFLAADPGVDSGLMI
FT                   AQYTQAGLVSDNKRLAVPASVDSIPSSAMQEDHVSMGWHAARKLRKAVENLRRVLAIEL
FT                   VTSARAIDMRTQLSGGKLTPGPAGTAVIAALRNVVGGPGTDRFLSPELEAADRLVASGE
FT                   VRAAAESAVGILA"
FT   gene            399410..399646
FT                   /locus_tag="Arth_0376"
FT   CDS_pept        399410..399646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01777"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV7"
FT                   /protein_id="ABK01777.1"
FT                   /translation="MKARGTVLSRRAAFAATVSDWRTLKAGERVEILKHAHVVAAGEVE
FT                   EISVSGNVLWLVPSGPPETQLFMKSDGVQVRRT"
FT   gene            complement(399682..399918)
FT                   /locus_tag="Arth_0377"
FT   CDS_pept        complement(399682..399918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01778"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV8"
FT                   /protein_id="ABK01778.1"
FT                   /translation="MSSATMESQTTDIRSIHLTFATAEEVHDGLDNAVKELIEAAVEDG
FT                   NCGIRVTRHEPGAFTVALDESVPFGETYEDIAA"
FT   gene            400386..402347
FT                   /locus_tag="Arth_0378"
FT   CDS_pept        400386..402347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll7009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01779"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRV9"
FT                   /protein_id="ABK01779.1"
FT                   /translation="MSTEHSATLSAPAVSDRRPALEQRLDPQIRKLAVGVWTAELIGDE
FT                   LANISYGGRPVLRAIKAVVRDHEWRTFAPSVRDVEELKDDDGTSLRIHVDYAAPGSAAP
FT                   GTTAPGTVPAYEGMLTLRITPATVEVSFSGRAKTAFRRNRIGLVVLHPTSEAGRDVNVV
FT                   SPDGTVTSGAFPTDIRPDLVFKDISSLEWADAGTAFDLGFSGDVFETEDQRNWSDGSFK
FT                   TYSTPSALPIPVDVAAEDTVNQSVSIEALSIETPDNPLSESHEPAAFTVGEPSGTVPPL
FT                   AISVDTVETAAGGFGNAGGGPQLSGLDAVLVELFEPRELWPGKLAAATREADRHGAALD
FT                   VRVVSESAEGVAEVLSTALGGSLSRVVRLSLFHPGTQCTDPAAFGALKASLDDAGFNGQ
FT                   LLAGTRSHFTELNRWIAGSSNGSPVPQDADALTFSLAPQVHSTEVPHIVETVPVQRLAA
FT                   ANALKLGDGRPVHVGPVTLKPRFHAPDQEAEGDELQDHSFTAAWALASLAALTVDGVAS
FT                   VTYFEAGPPRGITAADGTLNPAGELLQRLAASKADPVLAATPVPSQRPAGKSPLTVYPV
FT                   QSAAGLQLFVGNLSPREATAHLALPHGAASGAAEVTVIGAASGARAQAAPAEASSPENG
FT                   VLAVTLGPWATAVVTFRD"
FT   gene            complement(402363..403334)
FT                   /locus_tag="Arth_0379"
FT   CDS_pept        complement(402363..403334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0379"
FT                   /product="formiminoglutamase"
FT                   /EC_number="3.5.3.8"
FT                   /note="TIGRFAM: formiminoglutamase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: nfa:nfa12350
FT                   putative arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01780"
FT                   /db_xref="GOA:A0JRW0"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW0"
FT                   /protein_id="ABK01780.1"
FT                   /translation="MPHRALTVDIPPLTWRGRFDGDGAEHRRWWQAVAPYRHETAALQP
FT                   ESHAPGHRPAVILGFSSDAGVLRNKGRVGAAAAPGAIRAALGPLAFHLPRDVFDAGDVT
FT                   VKDNALEAGQARAGLAVSEMLDAGNLTVLLGGGHETAFASYLGVAGSEAVRGGKRLGVL
FT                   NLDAHFDLREAPEPSSGTPFLQMARAEEAAERTLNYAVVGISEPNNTPVLFKTAERLGV
FT                   KYLLDEDCTAEATRKFVADFLDTVDVLYLTIDLDVLPAAVAPGVSAPAAFGVPLPVISS
FT                   VCRQVAASGKLLHLDVAELNPKFDIDQHTAKVAARLVNTLLG"
FT   gene            complement(403492..404934)
FT                   /locus_tag="Arth_0380"
FT   CDS_pept        complement(403492..404934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0380"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   cgb:cg0944 xanthine/uracil permeases family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01781"
FT                   /db_xref="GOA:A0JRW1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW1"
FT                   /protein_id="ABK01781.1"
FT                   /translation="MLKQGSALDRYFKISERGSNYSREIRGGFATFFAMSYIVVLNPLI
FT                   LSGPDSSGATLGFPAVAAVTAFAAGILTILMGAWARHPFAMATGLGVNAFVAVTVATNP
FT                   GLTWPDMMGLVVLSGVTMLILVLTGFRTAVFKAVPDGLKTAIVVGIGLFIALIGLVNAG
FT                   FVRRIPDAAGTTVPVGLGFDGKLLGWPTLVFVFGLILTIGLLVRKVKGAILIGIIASTI
FT                   LSVILEFTLHIGPSFDGKNFNPQGWSLVAPKFTEWAAPDLSLIGKANPIGAFEHLGFVA
FT                   ATLLAFVILLSIFFDAMGTMVGLANEAGTVDKDGNIPDVDRVLQVDALGAIVGGGASVS
FT                   SNQIYVESGAGIGEGARTGLASIVTGLLFLVAMFFTPLINLVPFEAVAPALVVVGFMMV
FT                   SQVGKIDWQDWGIAIPAFLTFTLMPFTYSIANGLGAGFIAYVLIRTFQGRVRDIHPLMW
FT                   AVAAAFLLFFGIGPIEQALGIH"
FT   gene            405048..405683
FT                   /locus_tag="Arth_0381"
FT   CDS_pept        405048..405683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0381"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   tfu:Tfu_0298 similar to Cu resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01782"
FT                   /db_xref="GOA:A0JRW2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW2"
FT                   /protein_id="ABK01782.1"
FT                   /translation="MRSIRHLLSALIGALFFTAAVLAAAAPASAHDAAESSSPAQGSTV
FT                   ATPPEKVSVTFNRDPLALGSQFQVKDAAGTNWAEGPVEIVDNVASQKLRPGAPAGEFTV
FT                   VWRVVSSDSHPIEGTFTFTATAAAPGSGATASTPGSSTTAGEVPTAGTAQPGTTTAPEP
FT                   APDASAPFPWSLVLFAGTALGILVALGVLAKRNLKSTDNGADDAAGEQ"
FT   sig_peptide     405048..405140
FT                   /locus_tag="Arth_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.741 at
FT                   residue 31"
FT   gene            complement(405742..406392)
FT                   /locus_tag="Arth_0382"
FT   CDS_pept        complement(405742..406392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01783"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW3"
FT                   /protein_id="ABK01783.1"
FT                   /translation="MSSMPIYGGTEQTTTVIIGSGLPGLAIASELRRRGVDSITVDALE
FT                   TLGGIQSANTVSLPRCDAPNSATLQERNEILRHLRNYASSHKLDIRNNTRAVQLNLLGT
FT                   GLSEPPVHQWAVHTPDGILLAHHIVLTRGAHSQLRRMLADLGLALGQNLVAAMRAIGMY
FT                   LVGVGELITPTPKEVLRQAKVVGQAISAKVYPESVPSVLTGSFAALPAPALLN"
FT   gene            406856..407887
FT                   /locus_tag="Arth_0383"
FT   CDS_pept        406856..407887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0383"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: blo:BL1664 widely
FT                   conserved protein in universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01784"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW4"
FT                   /protein_id="ABK01784.1"
FT                   /translation="MDRDQVHPSRDDDGGSAAPEGIVVGVDGSDHSQCALVWAAREAER
FT                   RHRPLHIVTAYSVPIFAASGLDGGYATVDDSVIREGAEAILKQALDKVAPYDIDVDASV
FT                   ENGDASGVLLEMSETAELLVFGTRGRGGFVGRLLGSVSSALPAHAKCPTVTVPLICADR
FT                   LGETTDDKHVKAEQAKSGHQPVEHVVVVGVDGSEQARIAVLEAADQALRLGAPLRVVCA
FT                   VPQYSGSLAWVPAPMDREALFADIRVQLDAGVAWLKSHYPKLTVETRIVDGSPIDVLVE
FT                   ASRHVELVVVGTRGRGGFTGMLLGSTSDGILHHAKGPVLVVPDRDDPRLADRPSFGPML
FT                   GAA"
FT   gene            407942..410665
FT                   /locus_tag="Arth_0384"
FT   CDS_pept        407942..410665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0384"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="PFAM: pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding; PEP-utilising enzyme, mobile region;
FT                   KEGG: dsy:DSY4219 phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01785"
FT                   /db_xref="GOA:A0JRW5"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW5"
FT                   /protein_id="ABK01785.1"
FT                   /translation="MNQANTPDASADGLVLNLANIDAGMLLRVGGKAANLGETTRAGLP
FT                   VPPGFCLTTDAYRRAVGPAGLEDVHGALAATGPHELAALAGLAARARELILRADIPPEI
FT                   ASAVRKSYAAMGTDVPVAVRSSATAEDLPFASFAGQQDTYLNVVGADAVLSAVRQCWAS
FT                   LWTDRAVAYRATHGINPSTVALAVVVQRMVAATVAGVLFTANPVTGRRHEAVIDASPGL
FT                   GEAVVSGAVNPDHFVVDSATSEILLRQPGDKGIAIRPLHGGGTERIILAPDSAPSLSDA
FT                   QLRELSALGARAERHYEAPQDIEWAVDAADKLWLVQSRPITTLYPLPDARPDLPEPEGT
FT                   RVFLCFSLAQGLTRPLTPMGLAGFRLIASSVARAAGFDVPEPRNGPAPYRQAGQRLFVD
FT                   LTPVVRSSAGRVIVPRVFDIMEARSATVLRRLFADPQFSVTIRSPWRLLRHVLPVAARA
FT                   KVPESLLRALLRPEAALRRVDAFGARHRAALVVPATATPAERLNHAERILSEGLFPIVP
FT                   AVLPLPALGFALLAVAGKLAGQSGESGALQAVLRGLPNNVTTEMDLALWQLATDIRAHP
FT                   GAAAIFEEASPPELARRYSDGGLPAVVQSGLAGFLGRYGHRAVAEIDLGMPRWSDDPAH
FT                   ILGVLANYLKLDDPALAPDRQFAKAAREADAQMERLVAVAGSKGGPAGRLRARMVQGAL
FT                   KRTRLFAGLRELPKYHIVEGLASVRKQLMAVGAELAASGSIADADDIFFLNFAEAHRGL
FT                   AGASLREAVAERREAYDAELSRRRIPRVLLSDGTEPEALQVAATGAQDGFLSGTPASAG
FT                   TVTAKARVILDPQGAALEPGEILVAPSTDPGWTPLFLTAGGLVMEMGGPNSHGAVVARE
FT                   YGIPAVVGVPDATSTISTGQVITLDGGAGTVAPAAG"
FT   gene            410772..411926
FT                   /locus_tag="Arth_0385"
FT   CDS_pept        410772..411926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01786"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW6"
FT                   /protein_id="ABK01786.1"
FT                   /translation="MTRKWLRWMPAAAVPAVIAAAALAGSLPASAGDPLPAKTTEEVLA
FT                   MVAHHAAPSLSGTLEQTSQIGLPELPKTGPSAGSGAASALELLSGPHTARVFMDGPSNV
FT                   RVQVLDRLAERNAVRSGDQVWLYSSKDNTATHLTLPTDAGKHNDFSQFKHPGSGTDGVM
FT                   PTPEDLAARLLAAADPTTEIAVLPEVTVAGRAAYNLMITPRTEGTLIGSIAIAVDGQSG
FT                   LPLSVELKARGQEEPAFKLAFTTLSLQAPDASLFAFSPPPGATVKEIEVPAHGTESWPG
FT                   HAKEGGAVPDAAVPGSRDPGTGHPRPTVTGTGWESVVEFPASPGSAEAGAMVSSDPLLQ
FT                   QAAVAVPGGRLFSTAVVNVLLTDDGRVFVGSVPAERLLTAAAAR"
FT   sig_peptide     410772..410867
FT                   /locus_tag="Arth_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 32"
FT   gene            411923..412891
FT                   /locus_tag="Arth_0386"
FT   CDS_pept        411923..412891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0386"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO4585 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01787"
FT                   /db_xref="GOA:A0JRW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW7"
FT                   /protein_id="ABK01787.1"
FT                   /translation="MTAAGRGVELAIETRGLSKRFGHQLAVDGVNLAVPKGSVFGFLGP
FT                   NGSGKTTTIRMMLGLAAATEGSVSVLGLAMPDRFHEVLPRVGALVEGPAFYPFLSGAAN
FT                   LRRLDAADPYAATSTRRARVEAALERVGLTHAAGKKVRAYSLGMKQRLGIANALLSPRE
FT                   LLVLDEPTNGLDPQGTREVRSLVRSLAADGATVFVSSHLLAEVEQICTHAAVMSAGRLV
FT                   AQGTLAELRDAGKTRIRLLTPDAGLAEGVFATLGMSPAGGRSNGALVYGDGGKSGEVVE
FT                   PEAVVAALVAAGVRVRGFAVEQGSLEDRFVALTGEGFDIAQ"
FT   gene            412881..413771
FT                   /locus_tag="Arth_0387"
FT   CDS_pept        412881..413771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0387"
FT                   /product="putative ABC transporter integral membrane
FT                   protein"
FT                   /note="KEGG: sco:SCO4586 putative ABC transporter integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01788"
FT                   /db_xref="GOA:A0JRW8"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW8"
FT                   /protein_id="ABK01788.1"
FT                   /translation="MPNRDAAAGAVTASDTALGPAPAKASSGWPLLASELSVLFRRRRT
FT                   WAMLLALAAVPVLMAVAVRVSSAVPPGRGPAFLDRISQNGLFVGVTALLVCVPLFLPLT
FT                   VGVVAGDTIAGEAGLGTLRYLLVAPAGRVRLLLVKYAGTAAFCIVAPLVVALTGAGIGA
FT                   ALFPVGPVTLLSGDVITAQEAVLRLALVAAYLTVSLLGLSAVGLFLSTLTDVPVGAMAA
FT                   TIVASVVSQVMGELPQLEWLHPWLFSHYWFGFADLLRQPIAWDSFAGNALLQAGYIAVF
FT                   GALAYGRFITKDVLS"
FT   gene            complement(413819..415261)
FT                   /locus_tag="Arth_0388"
FT   CDS_pept        complement(413819..415261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0388"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: lxx:Lxx21540
FT                   peptidoglycan lytic protein P45"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01789"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRW9"
FT                   /protein_id="ABK01789.1"
FT                   /translation="MGLTGSGRKAAVLCTAVVLLGSLALPAGAAPLPRTAVAALSVPAS
FT                   PEIPSPEEIAAAKASESATADQVTRIDRILADAAAAQEASFAAAMQANNAYGDALVTLA
FT                   IRRDSATLASARAASAEAEQAKTRKQVGQLAGDLYRNGGLNPALSTFVSGNGEVLKQAA
FT                   TLEAISASRSRAFEAAENAASAAKSLTAAADDANRAADDAARTAEDRKVEAERANAAQA
FT                   KAVSEAKAQRTVLVDQLANLKNTTVALESARVDALDRQRAQERLAAVTAAAAAQAATQD
FT                   SAAQTRPAAPAPAAPAAPAPAPPAPAAPAPANPAPPAPAPPAPPAPAPAPAAPEPVTPA
FT                   PVVPAPAPAPVPAPSPGGSNQTAISVALSKVGSPYFYKYGGSGPLGFDCSGLVQNAFAA
FT                   AGKYLPRTAAQQYAQAPVHVPLSQALPGDLLVWGSAPDFYHVGIYLGGGRVVQALNPED
FT                   GITVTDLAWMAGMQLHPTVARY"
FT   sig_peptide     complement(415172..415261)
FT                   /locus_tag="Arth_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 30"
FT   gene            complement(415617..416543)
FT                   /locus_tag="Arth_0389"
FT   CDS_pept        complement(415617..416543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0389"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: sco:SCO6751
FT                   putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01790"
FT                   /db_xref="GOA:A0JRX0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX0"
FT                   /protein_id="ABK01790.1"
FT                   /translation="MGHDHSHAHGISATGTGKHRKRLIAVLGITLAVVLIQIIGAVISG
FT                   SLALLADAGHMLSDAAGVFIALLAAWIATRPASDQRTYGYQRAEVLAALANALVLIVIS
FT                   VLIFTEAVRRIGSAPEVQTDVMLYAAVLGAVANLVSLLILRSAQKESLNVRGAYLEVLG
FT                   DLLGSFAVIAAAVVIMVTGFQAADTIASMVIAVMILPRAWHLLRDVVDVLLEATPKGVE
FT                   VQMIREHILSVHGVVSVHDIHIWTITSGVPVFSAHVVVEDAVLSARGADQVLDKLATCL
FT                   GSHFDTEHCTFQLEPESHSEHESHQHA"
FT   gene            complement(416558..416986)
FT                   /locus_tag="Arth_0390"
FT   CDS_pept        complement(416558..416986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0390"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   sco:SCO4094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01791"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX1"
FT                   /protein_id="ABK01791.1"
FT                   /translation="MPANLPPGLPIVPDGTDNDAPFPMTGADFESAVSDALERIPPEVA
FT                   KAMDNVAVFIEDDYVPQPGEDPETVLLGLYEGVPLTERDAWWGAGSLPDRITIYRQPIL
FT                   EICSSREEVIQEVAVTVTHEIAHHFGISDERLHELGWD"
FT   gene            complement(416996..417991)
FT                   /locus_tag="Arth_0391"
FT   CDS_pept        complement(416996..417991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0391"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: sco:SCO1704 integral membrane
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01792"
FT                   /db_xref="GOA:A0JRX2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX2"
FT                   /protein_id="ABK01792.1"
FT                   /translation="MATTAESGPTPSAGPHEGSPHAAPAPQPPSHGNTSVPLPSPGKTP
FT                   VNRLGVAAVLVTVVLWASAFVGIRAVGPSFSPGSLTLGRLAIAAVVLGLVVLPKLRILP
FT                   KGREWWPILAYGVMWFGGYNVALNAAEHLLDAGTAALLINVNPILVAVMAGLLLKEGFP
FT                   RWLIIGSLIAFAGVAVIALSSGQRSTADVAGVLLCLLAAVLAAVSVIIQKPVLRKFPAA
FT                   QATWFGIMVGAVCCLPFSGQLVAELQQAPPPATLGLVYLGIFPTAIAFTTWAYALSLID
FT                   AGKLAATTYLVPGTTILISWLVLGEVPTVWGLVGGVICLVGVGLTRRKSR"
FT   gene            418176..418523
FT                   /locus_tag="Arth_0392"
FT   CDS_pept        418176..418523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0392"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bcl:ABC0842 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01793"
FT                   /db_xref="GOA:A0JRX3"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX3"
FT                   /protein_id="ABK01793.1"
FT                   /translation="MNPITPRIGTVFVPVSDVEAARDWYCRLLGVPADGEILFGHLYVL
FT                   PVEGTGLVLDSRIYSQDVVFKVPAFHLDTPDVQAAHTFAVELGADPADIQHGQWFNFRD
FT                   PDGNALMVCQC"
FT   gene            complement(418564..419445)
FT                   /locus_tag="Arth_0393"
FT   CDS_pept        complement(418564..419445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0393"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: sma:SAV1121
FT                   chromosome replication initiation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01794"
FT                   /db_xref="GOA:A0JRX4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX4"
FT                   /protein_id="ABK01794.1"
FT                   /translation="MIDIHPDQARTLAAIVSQGSFDAAASHLSVTASAVSQRIRALEVA
FT                   VGRPVLRRTRPIELTDSGQAVVRFARQLEMLSADLADELQPGNPHPDTRLTLVINSDSL
FT                   HTWALAGLAAVAGTVQLEILREDQDYSLELLRSGAAAAAITATAKPAPGCTSRRLGIMR
FT                   YLPVCTPAFAGTWFDGGATAESLATAPVIIFDRKDDLQDRYLRRFSRKPVQPPRHYVPA
FT                   AHEFGEAIRLGMGWGLLPELEIGDDLGQGTLQLMASRSFVDVPLHWQQWRYGSAVLDGV
FT                   AAAIQGAARVLR"
FT   gene            419527..420117
FT                   /locus_tag="Arth_0394"
FT   CDS_pept        419527..420117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0394"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   xcb:XC_1154 membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01795"
FT                   /db_xref="GOA:A0JRX5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX5"
FT                   /protein_id="ABK01795.1"
FT                   /translation="MLSGLASGLSLIVAIGAQNAFVLRQGIQRTHVALVIAVCAVSDLV
FT                   LIVLGVAGIGVVIERAPAVIEVVRWAGAAFLAGYGALAAWRAIRGQVLGQLEPARAVSW
FT                   VAVLGTGLAFTWLNPHVYLDTVLLLGSLANTHGPDGRWWFAAGAGLASIAWFTALGVGA
FT                   RFLAPVFRRRKAWRILDAVIAAVMLTMAALLVS"
FT   sig_peptide     419527..419589
FT                   /locus_tag="Arth_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.563 at
FT                   residue 21"
FT   gene            complement(420158..421177)
FT                   /locus_tag="Arth_0395"
FT   CDS_pept        complement(420158..421177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0395"
FT                   /product="PHP C-terminal domain protein"
FT                   /note="PFAM: PHP C-terminal domain protein; SMART:
FT                   phosphoesterase PHP domain protein; KEGG: sco:SCO0789
FT                   putative histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01796"
FT                   /db_xref="GOA:A0JRX6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR017078"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX6"
FT                   /protein_id="ABK01796.1"
FT                   /translation="MDAVDALNEIAFWLERELAPTFKVQAFRKAAGIIGALDPGEVAAR
FT                   ARNGRLKSMKGIGDRTFEVIRQAVDGGVPDYLEGLRQRGQQPLAEGGTELHAALRGDLH
FT                   SHSDWSDGGSPIELMADAARTLGREYLALTDHSPSLKIANGLSADRLREQLDVVADVNA
FT                   DGGGFRLLAGIEVDILEDGTLDQSPDMLDRLDVVVASVHSKLRSDRRTMTARMMGAIND
FT                   PHMNVLGHCTGRLLQGSRGTRPQSEFDAERVFAACAEQGVAVEINSRPERQDPPDELIR
FT                   LALDAGCLFSIDSDAHAPGQLDFLQYGAARAASNGVPAERIVNTWPLDRLLEWSGGGT"
FT   gene            421350..421422
FT                   /locus_tag="Arth_R0006"
FT                   /note="tRNA-Glu1"
FT   tRNA            421350..421422
FT                   /locus_tag="Arth_R0006"
FT                   /product="tRNA-Glu"
FT   gene            421519..421592
FT                   /locus_tag="Arth_R0007"
FT                   /note="tRNA-Asp1"
FT   tRNA            421519..421592
FT                   /locus_tag="Arth_R0007"
FT                   /product="tRNA-Asp"
FT   gene            421641..421716
FT                   /locus_tag="Arth_R0008"
FT                   /note="tRNA-Phe1"
FT   tRNA            421641..421716
FT                   /locus_tag="Arth_R0008"
FT                   /product="tRNA-Phe"
FT   gene            421830..422297
FT                   /locus_tag="Arth_0396"
FT   CDS_pept        421830..422297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0396"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: lxx:Lxx22480
FT                   stress-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01797"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX7"
FT                   /protein_id="ABK01797.1"
FT                   /translation="MGPSQSQEKPRIVVGVDGSAMSVAALRWAARIAPALDATITAVAA
FT                   WHFPVDTGFGWSTPSDWDPEAGAREVLKEALSAAFGDKPPQGLTQRTVMGHAAYVLIEE
FT                   SRSARMLVVGSRGHGGFAGLLLGSVSSACAEHAQCPVMVVHGADPQDGAPS"
FT   gene            422504..423619
FT                   /locus_tag="Arth_0397"
FT   CDS_pept        422504..423619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0397"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: mlo:mll4964
FT                   transcriptional regulator, LacI (ribose operon repressor)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01798"
FT                   /db_xref="GOA:A0JRX8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX8"
FT                   /protein_id="ABK01798.1"
FT                   /translation="MAKSTQAAASGPAAPARSAPAVPKAAPAHRGVTMADVAKAAGVSR
FT                   TAVSFVLSNRENASISEETKHRILEAVQTLGYRPNAGARALASQRSDWYGIVTEIVTAP
FT                   FAVDIIKGAQDQAWLSRRFLLIAPSDQADATGPNQGMEDAAVEKLLEQRVEGLLYAATY
FT                   HRAVHVPKSANEVPTVLINCFDADGKLPSVVPDERAGGRVAVERLLQAGHTRIGVINLD
FT                   PDIPAAVGRLEGCREALAEAGLELDPELVVSGHATADGGYEAACEILDKYQAGAGRPTA
FT                   LFCLNDRMAMGAYDAIKERGLAIPQDIAVIGFDNQELIAAYLRPKLTTVALPFEEMGAL
FT                   GVQTLASLTAGQPITAHQQMVDCPLLERYSV"
FT   sig_peptide     422504..422560
FT                   /locus_tag="Arth_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.621 at
FT                   residue 19"
FT   gene            423698..425377
FT                   /locus_tag="Arth_0398"
FT   CDS_pept        423698..425377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0398"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: ret:RHE_PE00332 putative peptide ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01799"
FT                   /db_xref="GOA:A0JRX9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRX9"
FT                   /protein_id="ABK01799.1"
FT                   /translation="MTQARFLRSARIAAAGLAMGAMVLTGCSANAGNTGSAKADASAQT
FT                   ALLTIPREDMGTFVRNFNPFAPTVAPMTQQAIYESLLIYNPANGDTTPWLASEWKAAED
FT                   GKSITFTLRDGVKWSDGQPLVPADVVTTFALQKKIKGGYDYLDTVTAEGTNQVKFSFKT
FT                   AWSPALFDLGQLSILPDHVWSKIADPEKDANEKPVGTGPYTEVDTFQAQSFVLKKNPNY
FT                   WQPEKQKIAGIKMLAFAGNDGANLAAANGDVDWAPQYMPNIEKTFISKDPDHRKYWFPP
FT                   TGSMINWQLNTTKAPFNDTDVRKALSMAVDRDQVTKIGMSGYTKPADCTGLSGNYETWK
FT                   NKAVQDDCEWTKLNVDEANKLLDKAGYAKGADGKRTLKDGKPFEFKISVGAASSDWLSV
FT                   ANVIAQNLAEVGVTAKVDSPDWAAVVAGYETGDFDSGIVWSANDPSPYKYFAGIMGTST
FT                   VKPVGEKAFENYHRFGDPKADALLTEFAAAADEDTQHEIADKLQEEYSAVAPTVPLFAG
FT                   PEWGAYNNTRFTGWPTEENPYATLSVRAPTTVLVLTSLEPAK"
FT   sig_peptide     423698..423793
FT                   /locus_tag="Arth_0398"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 32"
FT   gene            425535..426512
FT                   /locus_tag="Arth_0399"
FT   CDS_pept        425535..426512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0399"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vvy:VV2735 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01800"
FT                   /db_xref="GOA:A0JRY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY0"
FT                   /protein_id="ABK01800.1"
FT                   /translation="MRFILRRLGFYLIAFWVSITLNFLLPRFMPGDPVSRMFARTQDRM
FT                   QPEQIEALRKLLGVDDRPIWEQYVDYLHNMVTGQMGVSISRFPTPVTEVIASQVGWTLL
FT                   LGGTALVIAAVVGNLLGILAAWRRGGAIDSALPPILIFIGSFPYFWLAMGALYLFGVTL
FT                   GWFPIRHAFSDTIEPSFSWEFMSDVGMHLVLPALTIVLVSVGGWMLGMRNTMIATNAED
FT                   YITMAEAKGLRPGRIMFRYAARNAMLPSVTSFGMSLGFVVGGALLTEVVFAYPGVGYQL
FT                   LNAVQGLDYPLMQGLFLTITAAVLLANFLVDILYVRLDPRVRAN"
FT   gene            426525..427571
FT                   /locus_tag="Arth_0400"
FT   CDS_pept        426525..427571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0400"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vvy:VVA0134 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01801"
FT                   /db_xref="GOA:A0JRY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY1"
FT                   /protein_id="ABK01801.1"
FT                   /translation="MTTSIATTASTVPGESLAGGAGGNTAGMPDGGTGLPPGASVRRPN
FT                   RTLLHGLLTNKKAMTGAAILFIFIALALLAPVLYPDNPSKITGMASQEPDAEFWLGTTA
FT                   KGQDVLALTIHGARSSLLVGLTVGFASTFIGILVGLASAYFGKFIDEALSLTTNIFLLL
FT                   PGLPLLVILAAFLPPGLGTVILVLVVTGWAGSARVLRSQALSIRSKDFVAAAVVTGERP
FT                   LRIMFREILPNMASIVMGTLLACIIYGIGAQAGLEFLGLGDVSTVSWGNNLYWAGNEGA
FT                   LLTGSWWVFVPSGLCIALVAFSLSLINYAVDEVTNPRLRKIQLRKIQKPGAAKPARKPA
FT                   QSGKRASA"
FT   gene            427568..428503
FT                   /locus_tag="Arth_0401"
FT   CDS_pept        427568..428503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0401"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: vfi:VF2142
FT                   oligosaccharide transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01802"
FT                   /db_xref="GOA:A0JRY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY2"
FT                   /protein_id="ABK01802.1"
FT                   /translation="MTVSQTSFGSHEPVLEIKDLTVKYRGDTRSTTAVDRVSFSIGTGE
FT                   IFGLAGESGCGKSTIANAIMRLLRDPAEIAAGSIRFGGKDVLAMGPEELRRFRWQDVAM
FT                   VFQSAMNSLNPVMTIGDQIIDIYTTHAGYTRKESLRRAAELLELVRIDPARLKSYPHQL
FT                   SGGMRQRAVIAMAVALKPSLLILDEPTTALDVVVQQEIMAQIKELQRELGFSVLFITHD
FT                   MSLMVELSHRMAVMYGGRIVETAKAKDIHAAPLHPYTQALMGAFPPLTGPRVPLAGLAD
FT                   GVKFSNIADLREASPGHFVSPVPALQGAQP"
FT   gene            428500..429624
FT                   /locus_tag="Arth_0402"
FT   CDS_pept        428500..429624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0402"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: vvu:VV21177 ABC-type
FT                   oligopeptide transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01803"
FT                   /db_xref="GOA:A0JRY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY3"
FT                   /protein_id="ABK01803.1"
FT                   /translation="MSTPVSARPAPAPKSQDRGHGDTPALAVKGLVKDFHSGGLFSRAS
FT                   VRALGGVDLAIRKSEIVALVGESGSGKSTLARCIARLEKPTAGQILLNGTDVLKRDRFQ
FT                   ASREYRSQLQMVFQDPFGSLNPVHRIEHFLTRSLTLHGKAGTPAQLRTRLDGLMTTVGL
FT                   TPDMLNSYPHELSGGQRQRVAIARALAVEPEVILADEPTSMLDVSVRIGILNLMRQLRD
FT                   KQGISMLYITHDLASARYLADRIAVMFAGELVEEGESLDLLANPGHPYTRLLVSAVPDP
FT                   ARTGSYDPRERAALRAAVMESASCAFDGDPEQRCSATEPVRHRVGDPANEHWVRCHLYR
FT                   PPATAASHALSAEPLETPETPPTDGSRTENKASS"
FT   gene            429621..431192
FT                   /locus_tag="Arth_0403"
FT   CDS_pept        429621..431192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0403"
FT                   /product="Glycosyl hydrolase family 32, N terminal domain
FT                   protein"
FT                   /note="PFAM: Glycosyl hydrolase family 32, N terminal
FT                   domain protein; Glycosyl hydrolase family 32, C-terminal
FT                   domain protein; SMART: glycoside hydrolase, family 32;
FT                   KEGG: hma:rrnAC1479 sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01804"
FT                   /db_xref="GOA:A0JRY4"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY4"
FT                   /protein_id="ABK01804.1"
FT                   /translation="MTEMTHPLATVPRNELVARAEADPLRPRFHFVSPAGWLNDPNGVA
FT                   QWSGTYHLFYQYNPEGAFHHRILWGHATSPDLVHWTDQPVALEPSGGPDADGCWSGVLV
FT                   NDGGTPTLVYSGRHGGSELPCVAVGSPDLVNWTKAPENPVIPAPPAGVDITAYRDHCVW
FT                   REGTRWRQLVGSGIRGRGGTAFLYESADLRRWDYIGPLVIGDASSGDPAATNWQGTMWE
FT                   CVDLFRAGDGILGDRALESQTPGTDVLVFSAWHDGDTRHPLYWTGSYAGDSYTPRELHR
FT                   LDYGGRYFYAPQSFADESGRRVMFGWLQEGRTDGAMVEAGWSGVMSLPRVASLDAHGGL
FT                   AFAPVPEVELLRRDHVRTGPRTVGTGEVLAGVSGNQLDLELDLELEPGSVFRLGVLGSG
FT                   PGGPDGVPAGAEETVIEVGYTVGSGGSEQSYVLLDRVNSSLDRTVDAEEKSGPVQLPGG
FT                   KLHLRVLVDRSALEIFANGKPLTARAYPTLGGENVRLSAAGTVRLLQLDAWRMEGVFGA
FT                   PRPLFP"
FT   gene            431280..435083
FT                   /locus_tag="Arth_0404"
FT   CDS_pept        431280..435083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0404"
FT                   /product="Levanase"
FT                   /EC_number="3.2.1.65"
FT                   /note="KEGG: bld:BLi02827 levanase; RBL00188; PFAM:
FT                   Glycosyl hydrolase family 32, N terminal domain protein;
FT                   Glycosyl hydrolase family 32, C-terminal domain protein;
FT                   SMART: glycoside hydrolase, family 32"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01805"
FT                   /db_xref="GOA:A0JRY5"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY5"
FT                   /protein_id="ABK01805.1"
FT                   /translation="MSKRLVAGITTAALGLGALGAGSLLAPAMLAAPAQAAPGGPFPAG
FT                   PITLGSSNSPMPDVVGISGNWTRQSDGGQSAVASPDQNAAAISEQRISSTARYTAGVTV
FT                   DPGSPYAVGALVFRSAADASSGYAATIDPNLDRVRLFDLATGQDVAPAATVPLDTGRSY
FT                   SVDVHVDGPRIYVAVDGVPRIDATDQRYQDGHVGLHAYNGSVNFSEPRVRTIDANVSGW
FT                   QAADGAGWTASATGLRGTAPGGTNIRAVATDQAPQVTDFTADVQVTSPYAVGAVLFRTN
FT                   TAGTTGYGAEADANAGRLRLYRIEDNATLGTFATTITVNAVYRLRVTADGGQLAVHWQT
FT                   DLLDPNGYAPAITATDTAHGSGHIGLLAFNGSTVFQGMTLKGLDTSLQGWRTASGSWEP
FT                   DVRGLRGATDGLAAGADAARFVPAVASDVVASLDLDVAAPATAAVVVRSAPDGTGGTEL
FT                   RVDPGAGTVQLKDRTTGTVLAGGAVPPDSFAAGQLNRIQLTVRGGQATALINGVQSVAG
FT                   PAGPATGSGFGLRVSGGGAYFQNVRADDVASYMNGLYQPGYHYSQNSGNSSDPNGLVYF
FT                   DGEYHLFHQDRGRWAHAVSTDLLHWKQLPIALPHLAAGESWSGSAVVDANDSSGLFDGG
FT                   QGLVAFYTSFNHDAANGNQSVRAAYSKDHGRTWSIVQAQPVVENPGGPAGSWDFRDPKV
FT                   TWDAATGTWIMVVAGGDHLRFHTSTDLVHWTFTSAFGYGDWVRGGVWECPDFFELPVEG
FT                   QPGARRWVLWWSTGAVRPTNGSAAQYVTGTWNGTSFTPDTGPDEVLQADSGRDYYAAMS
FT                   FFGAPDGRRIMLGWMSNWDYAFSPPTGRWNGQLSVPRQLSLKDIPGVGPRLAQEPITEL
FT                   AGLRTSTWQASDVTVTPTSANPLSAASGRSFELEAEVAIPSSGGASGFTFGLRKGTAGG
FT                   AAGGEAQETLLRYAAGTGTASATGAGTGTGTGTGTMTVDRGQSGRADFTRYFAGAAADN
FT                   ASTAWSSETVALAGGGSERRVKLRALVDSSSVELFGGDGTAAITSLVFPDPSSTGLSFS
FT                   TTGGSARLVSAKVHQLADTSRLTAAVPSAVLGPVSGAARHNLDSYSVVPGGRWESTGAG
FT                   LAGTFDKDSTALSAATYSDVRVAATVRFGSGPYAGAMLNSDRVPERGYGGAGSVLLRAS
FT                   ADGATAYYVNLDPNLRLARIFKLQDGVFDSAASVLASVPVLLSHGVSYSVEAAAAGERL
FT                   TVKLDGVEILAVDDASLSAGKVGLNVFDGRAAYQDVLVTGSG"
FT   sig_peptide     431280..431390
FT                   /locus_tag="Arth_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 37"
FT   gene            435509..437077
FT                   /locus_tag="Arth_0405"
FT   CDS_pept        435509..437077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0405"
FT                   /product="Levansucrase"
FT                   /EC_number="2.4.1.10"
FT                   /note="PFAM: glycoside hydrolase, family 68; KEGG:
FT                   bte:BTH_II1872 levansucrase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01806"
FT                   /db_xref="GOA:A0JRY6"
FT                   /db_xref="InterPro:IPR003469"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY6"
FT                   /protein_id="ABK01806.1"
FT                   /translation="MLRWRPAAAALAAAVAASAFLAVPSAQANEPSDPPATQQMPAPTP
FT                   GFPLPTDHSQKAYDPAADFTSKWTRADAKQIMAQSDSTVAPGQNSMSPDVTMPEIPEDF
FT                   PAMNDDVWVWDTWSLTDENANQISYKGWDVIFSLVADRHAGYGFDQRHWNARIGYFFRK
FT                   TNADPAKDKWNYGGHVFADGASIGNTEWSGSTRLMQGNQVNVFYTATTFYDVAERNAGG
FT                   GGIAPDAAIAKALGKIHADQNGVTFDGFKHTKLLEPDGKMYQNKAQNPGFAFRDPYTFA
FT                   DPAHPGKTFMVFEGNTGGTRGEYECKPEDLGYKAGDPNAENLNEVNSSGAYYQTANVGL
FT                   AVADNKDLTKWSFLPPILSANCVNDQTERPQIFIQNEGGKNKYYLFTISHQFTYAAGMR
FT                   GPDGVYGFVGDGVRSDYQPMNNSGLALGSPTDLNLPSESPEAPTPNQNGRQFQAYSHYV
FT                   QPGGLVQSFIDNVNGVRGGSLSPTVKINFRDGVSQVDRTFGKNGLGPFGYLPTNLKVGG
FT                   EGLYK"
FT   sig_peptide     435509..435595
FT                   /locus_tag="Arth_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            437332..437781
FT                   /locus_tag="Arth_0406"
FT   CDS_pept        437332..437781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01807"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY7"
FT                   /protein_id="ABK01807.1"
FT                   /translation="MKNIARPLTAAALFAALALTACSAPEAGGAPSSSAPGPATATATP
FT                   SPSKSSGPFGDFPSAAEACTTISQQATGASLFPLSAAQGKTAELEQLKAELSETAERVP
FT                   DGLKADFANLNAVAVAGLSDQTVYSSGKFDAAMAPVTAWLAANCK"
FT   sig_peptide     437332..437415
FT                   /locus_tag="Arth_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.385 at
FT                   residue 28"
FT   gene            437870..438331
FT                   /locus_tag="Arth_0407"
FT   CDS_pept        437870..438331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0407"
FT                   /product="protein of unknown function DUF322"
FT                   /note="PFAM: protein of unknown function DUF322; KEGG:
FT                   nfa:nfa23390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01808"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY8"
FT                   /protein_id="ABK01808.1"
FT                   /translation="MEYQNPHPAPGAHADPVVALPAGTGRTVISETAVAKVAGIAARAV
FT                   PGVYSLGTGPSRALGAIRDAVGSSDHAAGVHAEVGETQVAVDINLVAVYGTPLHSLADQ
FT                   VRAAVYAAVEELVGLQVIEVNVEINDVYVAAPAKPGLPVEARTEREAIQ"
FT   gene            438328..438519
FT                   /locus_tag="Arth_0408"
FT   CDS_pept        438328..438519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01809"
FT                   /db_xref="GOA:A0JRY9"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRY9"
FT                   /protein_id="ABK01809.1"
FT                   /translation="MNLTVVGIAVGAFVAFMSFQFGIWGFLVSLLFMGIGALLGRAAEG
FT                   KLDLRSVFDAITGRRSSS"
FT   sig_peptide     438328..438456
FT                   /locus_tag="Arth_0408"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.377 at
FT                   residue 43"
FT   gene            438555..438899
FT                   /locus_tag="Arth_0409"
FT   CDS_pept        438555..438899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01810"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ0"
FT                   /protein_id="ABK01810.1"
FT                   /translation="MAGHNRISTQALTSLARAAAAEALGVPAHDVRADWSDDDGLLALS
FT                   LVLPIRIPPLTTVLRDPGRVAAFGGSIRERAIAARPVILHRVAELSGAQLSRVDIRISG
FT                   AAISEGGRVQ"
FT   sig_peptide     438555..438620
FT                   /locus_tag="Arth_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.580 at
FT                   residue 22"
FT   gene            438896..439573
FT                   /locus_tag="Arth_0410"
FT   CDS_pept        438896..439573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01811"
FT                   /db_xref="GOA:A0JRZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ1"
FT                   /protein_id="ABK01811.1"
FT                   /translation="MNNATDVRSKGSHAAGNGASGTSTGVSAAGEPDPRGAGMRRILDR
FT                   ETRSSRAAVSGVAAVLVIVLCGYGLLEAAVRAVGQPPWLIDPQTAAERIIALPQGMPPL
FT                   LLGAIGAVTAMAGLFFLLNAVLPGRRARHLLPDPRAGVVVDDEVIASALARRARLAANV
FT                   TQEQVMVVVAQRQVTVNVRPTSGVPVSENAVLAAVLAELREMALEPMPEVRVNVAASGV
FT                   IGA"
FT   sig_peptide     438896..438982
FT                   /locus_tag="Arth_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.482 at
FT                   residue 29"
FT   gene            439570..440181
FT                   /locus_tag="Arth_0411"
FT   CDS_pept        439570..440181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV6434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01812"
FT                   /db_xref="GOA:A0JRZ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ2"
FT                   /protein_id="ABK01812.1"
FT                   /translation="MNNTPRTLNRILIGILGVKLLVIGLLLVLLATVPAVASWWQQWSA
FT                   GVWSGMSQLLQRTGIPGREESWLWAVIALVLAAVIALMVAWVAQQGKGRANLIVAEDDA
FT                   AGFPGNVRIGGGVAEQALRAALAGRQDLAGATVATYEIRGEPALKIRLQPRQGVAPHLL
FT                   AADVSALVEALDAVVGKRIPVLIHIGSGARSRFGRAERVR"
FT   sig_peptide     439570..439683
FT                   /locus_tag="Arth_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 38"
FT   gene            complement(440178..442100)
FT                   /locus_tag="Arth_0412"
FT   CDS_pept        complement(440178..442100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0412"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: sma:SAV5980 putative
FT                   alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01813"
FT                   /db_xref="GOA:A0JRZ3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ3"
FT                   /protein_id="ABK01813.1"
FT                   /translation="MAHSPVPTDGSSIPAWWASAVVYQVYPRSFADANGDGMGDLRGVT
FT                   AHLDHLHRLGVDAVWLSPFYKSPQADAGYDVADYREVDPLFGTLADFDEMLQKAHGLGL
FT                   KVIVDLVPNHTSDEHAWFREALAAPPGSRERDRYMFRPGKDSVPGSGSGDLAPNNWKSI
FT                   FGGPAWTRVTEADGAPGEWYLHLFDTKQPDLNWDNAEVKEEMRSVLRFWLDRGVDGFRV
FT                   DVAHGMVKEAGLPDWEGSAAMVEGATELPGDAHGGHTEAEEPHRAHPAAATDAAAATAA
FT                   DDDEHQAVSPLYPPSPFFDQDGVHEIYRDWHRVLAEYDGDRMMVAEAWVEPAERLARYV
FT                   RPDEMQQAFNFDFLLAGWDAGRTAVAIEDSLRAAATVGATTTWVLSNHDTVRHSTRFGL
FT                   KDPTTFPKGIAAEDEQPDAALGLARARAASMVSLALPGSAYLYQGEELGLPEHTTVPAE
FT                   ARQDPTFFRTNGIERGRDGCRVPLPWKAAEPGYGFASAFPGEAPAAPWLPQPESFGELA
FT                   ADRQDGVDGSTLELYRAALALRKEHRLGAGSFRWADVHAPADGVLAFHNGDVLVIANMG
FT                   LAAATLPEGYRVALASADEAVTGGPAESGTAETGPAETGTAGSGTRPDGARKLAPDSAV
FT                   YLVAV"
FT   gene            442226..443512
FT                   /locus_tag="Arth_0413"
FT   CDS_pept        442226..443512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0413"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: nfa:nfa55460 putative transporter
FT                   substrate-binding protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01814"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ4"
FT                   /protein_id="ABK01814.1"
FT                   /translation="MKSPNFLLPAATAGVLALTLSACGGGGGTTGGGGGGDAEQGLDGR
FT                   GPITYVQGKDNSNVVRPLIEKWNAAHPNEKVTFKEQTDSADQQHDDLVQNYQAKNPNYD
FT                   VASVDVVWTAEFAAKGWLQPLKDKMAVDTKGMLEPTIEAGSYKGTLYAAPVSSDGGILY
FT                   YRKDLVPTPPKTWDEMMQMCSIAKANNIGCYAGQFKKYEGLTVNASEAINSFGGSVLDK
FT                   DGKPSLNTPEAKVGLENLAKAYADGNIPKEAITYQEEEGRQAFQDGKLLFHRNWPYVYN
FT                   LATTEASSKVKDVLGMTALPGKDGPGASSLGGHSAAVSVYSKNKATALDFVKFLTDAEQ
FT                   QKFFATKGSLAPVLGDLYEDKELVAKLPYLPVLKTSIENAVPRPVTPFYPAVTKAIQEN
FT                   AYPAIKGEKSVESALSDMQKSIESASAGQ"
FT   sig_peptide     442226..442300
FT                   /locus_tag="Arth_0413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.636 at
FT                   residue 25"
FT   gene            443519..444556
FT                   /locus_tag="Arth_0414"
FT   CDS_pept        443519..444556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0414"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nfa:nfa55470 putative
FT                   transporter; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01815"
FT                   /db_xref="GOA:A0JRZ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ5"
FT                   /protein_id="ABK01815.1"
FT                   /translation="MATELGPTPVKKPASGSPEIHHAPKGVGEDNRIASQGRWASWLLA
FT                   PTIIALAVVIVYPIISALVMSFQKDAGLDPVTGLFTAGGPAGVQNYVNWLAQQCSAPGG
FT                   GTVACPPGTLGAQFWSATATTFFFTVVTVTLETVLGFWMALIMARTFRGRSLVRAAVLV
FT                   PWAIPTAVTAKLWLFIFAFEGIANKLFNTTILWTGSEWPAKWAVIIADVWKTTPFMALL
FT                   ILAGLQMIPAEVYEAAKVDGASTWQRFRLITLPLVKPALMVAVLFRTLDALRMFDLPYI
FT                   LTGGANNTTTLSILVINQIRQGFNAAAALSTITFIIIFIVAFIFVRFLGANVVEQSGTT
FT                   GKGKK"
FT   gene            444553..445449
FT                   /locus_tag="Arth_0415"
FT   CDS_pept        444553..445449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0415"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nfa:nfa55480 putative
FT                   transporter; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01816"
FT                   /db_xref="GOA:A0JRZ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ6"
FT                   /protein_id="ABK01816.1"
FT                   /translation="MSAGTAATALRAKQDKGRKTAQNREKVAQGRTYISAAVILIWCLA
FT                   PAYWMVVTAFRDVDFTYDTSILPTHITLDNFNTAFDTSFGNRFGDALRNSVFIGVVVTV
FT                   VSLLIGVFAAYALARLNFRFKYLVLGFILGASMFPGVALITPLFQLFTNIGWMGTYQAL
FT                   IIPNISFVLPLTVYTMTSFFREMPWELEESARVDGCTQGQAFRKVILPLAAPAIFTTAI
FT                   LAFISSWNEFLIASQLSSDATQPVTVAIASFAGAQPNQIPYTAIMAAGTIVTIPLVILV
FT                   LVFQRKIVAGLTAGAVK"
FT   gene            445446..445715
FT                   /locus_tag="Arth_0416"
FT   CDS_pept        445446..445715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01817"
FT                   /db_xref="GOA:A0JRZ7"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ7"
FT                   /protein_id="ABK01817.1"
FT                   /translation="MTGSAVDGKQNHGRVRSEHRRARSGEDFDIIIGFLGFWAVVLVVV
FT                   TVWMEVTAQPAVGWALGLLGVLLALYGMVRLRRRLPARTATRKK"
FT   gene            445816..446880
FT                   /locus_tag="Arth_0417"
FT   CDS_pept        445816..446880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0417"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   fra:Francci3_2164 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01818"
FT                   /db_xref="GOA:A0JRZ8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ8"
FT                   /protein_id="ABK01818.1"
FT                   /translation="MARTTDRAQRGGHSGVSIEDVAAAAGVSTATVSRAVRGLPRVSPA
FT                   TREKILEVAGALGYVASSSASGLATGRTKTIGVLAPFVSRWFFSKAIEGADRELHARQY
FT                   NLSLFNLGGHGSNRERLFSKTMVYKQIDALLVLCMALTHEEIEHLQKIDIPLVVVGGHV
FT                   EECPYIGIDDYAAASTAVRHLISLGHKDIALLHGDDETDLNFDVPRVRIKAFQDVMAGS
FT                   GLPVRPEWDEWGDFTVRSGQDAFTRMWARPGPKPTAIFCASDEMAMGVIFEASKMGVRV
FT                   PEDLSVIGIDDHDFSDAMGLTTVRQRPDEQAELGTKMLLDELDGAVGAVHSEVAPHQLI
FT                   VRRTTAPPPSHGQA"
FT   gene            complement(446888..447841)
FT                   /locus_tag="Arth_0418"
FT   CDS_pept        complement(446888..447841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4090 conserved hypothetical protein
FT                   SCD25.26"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01819"
FT                   /db_xref="UniProtKB/TrEMBL:A0JRZ9"
FT                   /protein_id="ABK01819.1"
FT                   /translation="MTGNIYRGQAGLPFSSALRIYEPLSAFPEEQRAALRAAGARSASR
FT                   AAVENAELQASLGRITRPGGDPFPTGRTDLVRVIPAPPEPEQPRTQKPAVGPDESGTSD
FT                   AGGPGDAVDGADSADQALLYCPSQLVLRAGLAANALMEGIHGPLAQLLIPEEQRDKHQE
FT                   RIDLVKAREGTSRVHTRASTWGIPFSWFSLFKESDPQDVVESGGRIITVRVWAPIGEAL
FT                   ERVRYAVANLALAAPDLDMLDDMTQLTEWLELFHPGSVVELDYGAVADKVYPDDSPMDV
FT                   RLGIECLAEGDMTGAAAAYRRLASRWIPIRQLARAS"
FT   gene            complement(447852..448736)
FT                   /locus_tag="Arth_0419"
FT   CDS_pept        complement(447852..448736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0419"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: nfa:nfa53030
FT                   putative exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01820"
FT                   /db_xref="GOA:A0JS00"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS00"
FT                   /protein_id="ABK01820.1"
FT                   /translation="MVAGRACRRTPAGPLSPAPKFGKLGTVKIATWNVNSLRARADRVE
FT                   AWLERSDCDVLAIQETKCKDDNFPWELFERMGYEVAHFGVSQWNGVAIVSRVGLEDVER
FT                   SFVDQPVFGKNGKDAIQEARAIGATCGGVRVWSLYVPNGRALDDEHMPYKLSWLDMLKT
FT                   HAQAWVTENPEAQIALMGDWNIAPQDDDVWDIDFFRANAMTHVSEPERAAFRAFEDAGF
FT                   QDVVRPHTPGPGVYTYWDYTQLRFPKKEGMRIDFVLASPALAARVTGASIDREERKGKG
FT                   ASDHAPVIVELAD"
FT   gene            448971..450470
FT                   /locus_tag="Arth_0420"
FT   CDS_pept        448971..450470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0420"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: nfa:nfa10370 putative
FT                   methylmalonic acid semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01821"
FT                   /db_xref="GOA:A0JS01"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS01"
FT                   /protein_id="ABK01821.1"
FT                   /translation="MVRELSHYIDGQRVHGTSGRFGDVYDPCTGEVQARLPLASADEVR
FT                   NAIASAEKAQVEWGAMNPQRRGRILLKFVDLVNEHLDELAALLSSEHGKTLPDAKGDIQ
FT                   RGIEVVEFAAGAPHLLKGEFSDNAGTGIDVHSLRQPLGVVAGITPFNFPAMIPLWKSGP
FT                   ALAAGNAFILKPSERDPSVPLRLAELFTEAGVPDGVFNVINGDKEAVDALLEDERVKAI
FT                   GFVGSTPIAQYIYATAAAHGKRAQCFGGAKNHMVIMPDADLDMAVDALMGAGYGSAGER
FT                   CMAISVAVPVGKETADALVSKLEERVKHLKVGHSLDKDSDFGPVVAASAKERIEGYIQS
FT                   GVDQGATLVADGRGLTVDGYGGGFWVGPTLFDNVTKDMKIYKEEIFGPVLSVLRAADYD
FT                   EALRLCSEHEFGNGVAIFTRDGDAARDFASRVQVGMVGINVPIPVPIAYYTFGGWKASG
FT                   FGDLNQHGADAFRFYTKTKTVTTRWPSGIRQGASYVMPEGS"
FT   gene            450470..451582
FT                   /locus_tag="Arth_0421"
FT   CDS_pept        450470..451582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0421"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   nfa:nfa10390 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01822"
FT                   /db_xref="GOA:A0JS02"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS02"
FT                   /protein_id="ABK01822.1"
FT                   /translation="MSAGPTAGTNTDRPDETPTEDMLFERRGRLGVITLNRPRAVNALT
FT                   AGMAAAMLGQLTAWADDDGVATVLVHGAGDRGLCAGGDIVAIYEDMLAGGEATADFWRT
FT                   EYRLNALIAGYPKPYVAFMDGLVLGGGVGISAHGSVRIVTERTRTGMPETTIGFVPDVG
FT                   GTLLLSRSPGETGTHAALTGAHLSGADALFLGLADHFVASGNLPALAAALETEPAEDAV
FT                   ERFAEKPPVSVLAGQQDWIDACYASDDAEDILRRLRTFDGDAAGEASEAAATIEAKSPT
FT                   AVKVALKSLRRARTLTLEEALAQEYRVGLRFLAGADFREGIRAQVVDKDRNPQWKPASL
FT                   HEVSTADVERFFEPLGDRELNLQSKEARNV"
FT   gene            451575..452516
FT                   /locus_tag="Arth_0422"
FT   CDS_pept        451575..452516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0422"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: nfa:nfa10400 putative 3-hydroxyisobutyrate
FT                   dehydrogenase; TIGRFAM: 3-hydroxyisobutyrate dehydrogenase;
FT                   PFAM: 6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01823"
FT                   /db_xref="GOA:A0JS03"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS03"
FT                   /protein_id="ABK01823.1"
FT                   /translation="MSETPESGKPGAKEHVAFLGLGHMGGPMAVNLVKAGYTVAGFDVV
FT                   PAALDAAREHGVPTVATPADAVAGADVVLTMFPSGQHVLDAYRGTDGQPGLLDVAGPDT
FT                   MFLDCSTINVDEAREASALAVAAGHRAVDAPVSGGVVGAEAGTLTFMVGALPEDFEYVR
FT                   PLLEVMGKRVVHCGGHGAGQAAKVCNNLILGVSMIAVSEAFVLGEKLGLTHEALFDVAS
FT                   AASGQCWALTTNCPVPGPVPTSPANRDYQPGFAGALMAKDLKLALNALQSTGVAARMGP
FT                   LASEIYDTFAAEGGAGRDFSGIITDIRDKSAH"
FT   gene            452552..453331
FT                   /locus_tag="Arth_0423"
FT   CDS_pept        452552..453331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0423"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mlo:mll5584 enoyl CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01824"
FT                   /db_xref="GOA:A0JS04"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS04"
FT                   /protein_id="ABK01824.1"
FT                   /translation="MTEEYGNILVEQRGRVGLVTLNRPEALNALNKATMDELVAAVTAM
FT                   DSDPGVGAVVVTGSGKAFAAGADIKEMAAQGYMDMYAADWFRGWEDFTRLRIPVVAAVS
FT                   GFALGGGCELAMMCDFIIAGDNAKFGQPEINLGVLPGMGGSQRLTRAVGKAKAMDLILT
FT                   GRFMDAEEAERAGLVSRVVPAADVVDEAVKVAEVIASKSKSAAMVAKESVNAAFETGLA
FT                   QGVLFERRLFHSLFATDDQKEGMAAFTEKRQPEFKHR"
FT   gene            complement(453318..454319)
FT                   /locus_tag="Arth_0424"
FT   CDS_pept        complement(453318..454319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0424"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mpa:MAP0876c
FT                   putative fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01825"
FT                   /db_xref="GOA:A0JS05"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS05"
FT                   /protein_id="ABK01825.1"
FT                   /translation="MTAHPEDYPAASGPDVLVVGESLVDIVSTTNGTTEHPGGSPANVA
FT                   YGLGCLGVDTSLLTSIGGDRRGSVVENHLARAGVRVLPGSRHPGRTATATATLTAEGSA
FT                   RYDFDISWELPTAAPIVIPRIIHTGSIATFLAPGATAVRALLEQPRPECMITYDPNIRP
FT                   ELLGTQAEARSMFEDLVPLTNVVKLSNEDAMWLYPGHSFDDVASRILKLGAEMVAMTLG
FT                   PGGSLLATRTAKLFIPAIKCVVEDTIGAGDSYMAALIYGLLTGGTDGLAPSQLTTIGHT
FT                   AAMAAAITVGRAGASPPTAEELDAALTAHASSAGIAGMALPFGAGDGAPNGA"
FT   gene            complement(454316..455809)
FT                   /locus_tag="Arth_0425"
FT   CDS_pept        complement(454316..455809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0425"
FT                   /product="Levanase"
FT                   /EC_number="3.2.1.65"
FT                   /note="KEGG: bte:BTH_II1873 levanase; PFAM: Glycosyl
FT                   hydrolase family 32, N terminal domain protein; Glycosyl
FT                   hydrolase family 32, C-terminal domain protein; SMART:
FT                   glycoside hydrolase, family 32"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01826"
FT                   /db_xref="GOA:A0JS06"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS06"
FT                   /protein_id="ABK01826.1"
FT                   /translation="MNTATPTLGAYRPAMHYACKDTWLNDPNGLVFHDGIYHLYYQNNP
FT                   FGNVHSNMSWGHATSTDLVNWDEQPVAIPCDETEEIFSGSIVVDQDNTAGFGLSGTTPL
FT                   VAVYTSAYKAGSAHEGMQAQSIAWSTDGGYTWTKYSGNPVLTRNSPEFRDPKVFRYDGP
FT                   AGSYWVMAAVEAHDYAVLLYRSGDLKNWEYLSTFGPANGTGGIWECPDLFELPVDGDAG
FT                   NTRWVLTVNMNPGGPNGGSAGQYFVGDFDGVTFTSETTVTDGMQDPERVVDYQWLDWGR
FT                   DYYAAVSFSNVPGGRRLMIGWMNNWQYANHIPTSPWRSPMSLVREVALASIDGEPRLVQ
FT                   QPVPACTEGSVSGPTQRLSLNGGVTVDGGKAVQLIEATFTPGTASEFGLVVCGSGSGSS
FT                   GTRISIRPGSGQLMLDRTNSGDTGFHEAFPSISTAPLQADAGTYSLRIFVDHCSVEVFA
FT                   QGGLVTLTELIFPDPVHTGITVFSTGGTAEASLQLTDLA"
FT   gene            complement(455919..457529)
FT                   /locus_tag="Arth_0426"
FT   CDS_pept        complement(455919..457529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0426"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bcl:ABC3117 sugar ABC transporter
FT                   substrate-binding protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01827"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS07"
FT                   /protein_id="ABK01827.1"
FT                   /translation="MATSRKLAVLGALMAGTMLFTACSGSSNGSAAIKDSSAEFGFQET
FT                   GFPIVKDTLTLKFSGTKSALAPDYNTMSLVQQWEKDTNIHIDWENLPETVFKEKKNLIL
FT                   ASGDLPDAFFNSGLTDAEIATYSASGTLIPLEDLIQKNAPNLSKLLADRPDIKAAITSS
FT                   DGHIYSLPSIEELGLVQFPNEMAINTAWLNKLGLPMPKTVDELHDALLAFKTKDASGTG
FT                   KTIPLSFMPGSWCGDIVDLIAALGGVPDNMDHRIVQDGKVIYTATQDGYKKALQTLHTW
FT                   YQEGLIDPESFSQDDKAYLAKGKASTENLGSFVWWEVKEMVGADRAGDYKLLPVLEGVD
FT                   GKRLASQSNNQEIARGAFAVTRTNKYPAATIRWADNLYDPIQSAQANWGPIGETLQKDP
FT                   ATGLLTQIPAAAGTSEGERRQKVAPGGPKANTAENFEKVVAPEPRAAERQKTVEENYKP
FT                   FAANDGYPPVALSNEEVQQISTIETDVAAIVKQTTAKWIVSGGIEAEWDGYVSQLKNIG
FT                   LDKMVDVYQQAYDRYQKNS"
FT   sig_peptide     complement(457434..457529)
FT                   /locus_tag="Arth_0426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.630 at
FT                   residue 32"
FT   gene            complement(457612..458574)
FT                   /locus_tag="Arth_0427"
FT   CDS_pept        complement(457612..458574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0427"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3118 sugar ABC
FT                   transporter permease; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01828"
FT                   /db_xref="GOA:A0JS08"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS08"
FT                   /protein_id="ABK01828.1"
FT                   /translation="MTLNTKPVAVPAPATRPQPAKRMQTFRDRWADSAFNIAAVTILSL
FT                   SIIAVVYPLYFIVIASISDPNAVYEGKVWLFPSGVTLEGYQRIFADSRIWNGLANTVIY
FT                   TLLGSAISVTTILFGAYALSRKDMPGRKILMLLFVVTMFFDGGLITKYLVVRDLGMLDT
FT                   VWAVVLPGAVGVWNLIIARSFFENTIPGELREAAQMDGANDFTFFFKMVLPLSKPLIML
FT                   MIMVHVVAHWNSFFDALIFLNDDTKYPLQLVLRNILIQSDVSSAGTTGGDIESYAAAQR
FT                   IGELTKYAMIVVSSLPLMIALPFMQKHFTKGTMIGAVKS"
FT   gene            complement(458582..459562)
FT                   /locus_tag="Arth_0428"
FT   CDS_pept        complement(458582..459562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0428"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3119 sugar ABC
FT                   transporter permease; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01829"
FT                   /db_xref="GOA:A0JS09"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS09"
FT                   /protein_id="ABK01829.1"
FT                   /translation="MSRTLARSTPAPPLAPTPRPTSRKPLPLRLKRVGRAWQLYVLLVP
FT                   ALIYIAVFKYWPMYGVQIAFRNYNPVDGFTGSPWVGLQHFIRFINSYQFSQVVGNTLWI
FT                   AVLGLLVAFPIPIILALLVNQLQSERFKKFTQTVLYSPAFISTVVVVGIMFVLLSPRSG
FT                   LVNNAIQLAGGEPVFFMGSAEWFRPIYVISDVWQNAGFAMIVYLAALSGIDPALHDAAK
FT                   VDGASKLQRIRHIDLPGIMPVITVLFILAIGNLLNVGFEKALLMQTNLNLPTSEIIQTY
FT                   VYHAGLQQAQFSYSAAIGLFNSILNLVLLLTFNWVARRANQATLW"
FT   gene            complement(459559..460569)
FT                   /locus_tag="Arth_0429"
FT   CDS_pept        complement(459559..460569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0429"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bur:Bcep18194_B2373 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01830"
FT                   /db_xref="GOA:A0JS10"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS10"
FT                   /protein_id="ABK01830.1"
FT                   /translation="MHDVAAAAGVSQATVSLVLNSASGSRFSDETRKRVMDAVQQLGYR
FT                   TNAHAKTLRDGISGIIGFLGDAVATAPFAGKIIEGAQERAWEDGLLLLTMNTGGDKALE
FT                   AASLDSMLSYKVAGVVYAGMYHRRLDVPEALSTVPSVVLNSQDRKLRLPSVAPNEELGG
FT                   YTATRRLLDAGHERVAMINIETLESELPAAVGRYNGYTKAMAEAGLSIRPELVRFGSGN
FT                   ELDGFTHTMDLMTDDNPPSAIFCANDRTAWGAYQAATELHLSIPRDVSIIGFDNQETLA
FT                   PHLRPGLTTLELPFVEMGRRAVDLILQGAEPDGRVEFMTCPLIERNSVTHPKEKP"
FT   gene            complement(460733..461365)
FT                   /locus_tag="Arth_0430"
FT   CDS_pept        complement(460733..461365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0430"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   nfa:nfa53200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01831"
FT                   /db_xref="GOA:A0JS11"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS11"
FT                   /protein_id="ABK01831.1"
FT                   /translation="MKFDESFWDERYRQHGSVWSPNPNPHLLAEAAGLRPGSVLDVGSG
FT                   EGADSLWLARQGWRVTAVDISSVALARAAERAAQDAEAAARITWVHHDLTSSPPPSGTF
FT                   DLVSAQFMHLPLAERTELYHRLAASVAPGGTLLVVGHHPSDLEVGIRRPSEPGLLFTPE
FT                   EIAAGLDPDEWEIDVCEARRRFVEDADGNSVAVTDSVLRAHRRAPRP"
FT   gene            complement(461509..461937)
FT                   /locus_tag="Arth_0431"
FT   CDS_pept        complement(461509..461937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr4231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01832"
FT                   /db_xref="GOA:A0JS12"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS12"
FT                   /protein_id="ABK01832.1"
FT                   /translation="MIPEINIWAVVLATLSSMVVGSVWYTPKVFGNYWMKLAKVTPSGD
FT                   AKDAVKPILITLVVSFVSALVLAGSAAISQHFYGGNFLANTLITAVILWAGFTASRFIT
FT                   HDAFDGRPAALTVLNCAHELVTLVVMGLIIGLFGISAA"
FT   sig_peptide     complement(461872..461937)
FT                   /locus_tag="Arth_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.327 at
FT                   residue 22"
FT   gene            complement(461948..462469)
FT                   /locus_tag="Arth_0432"
FT   CDS_pept        complement(461948..462469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0432"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: nfa:nfa10440
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01833"
FT                   /db_xref="GOA:A0JS13"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS13"
FT                   /protein_id="ABK01833.1"
FT                   /translation="MSGGAMGNPLPRDPIADAQRNWERHGWGDVAAPMAAITAIMRTQQ
FT                   ILLARIEGVLKPFGLTFARYELLALLSFARSGALPMNKASALLQVHPTSVTNAVDRLQD
FT                   AGLVVRSPHPTDGRTTLIELTAEGRTLAKSATAALNSEVFGQSGFAGQDVEQLIRILGN
FT                   FRRNAGDFAD"
FT   gene            complement(462485..464227)
FT                   /locus_tag="Arth_0433"
FT   CDS_pept        complement(462485..464227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0433"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sco:SCO6195 putative acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01834"
FT                   /db_xref="GOA:A0JS14"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS14"
FT                   /protein_id="ABK01834.1"
FT                   /translation="MTVTDDFRAARDRLLALHEDYDQARDEFQWPRFEEFNFALDWFDQ
FT                   IAADPATGAKPALVIVEQDGSATRRSFAELAARSNQVANWLRSQGVRRGDRMIIMLGNQ
FT                   VELWELMLAGIKLGIVLIPTTTLMGPADLADRVERGEAGWAAVGSSNIGKFSGVPGNYK
FT                   LIEIADGGNAAEAAAETTAGVARYADADGAPTDFTPDAPTKADETLLLYFTSGTTSKAK
FT                   LVEHTHTSYPVGHLSTMFWIGMGPGDVHLNVASPGWAKHAWSNVFTPWIAEACVFIYNY
FT                   SRFDAKALMEQMDREKVTSFCAPPTVWRMLIQADLTLLKNPPTKVVSAGEPLNAEVIDQ
FT                   VHRAWGQTIRDGFGQTESTVQIANTPGQPIKIGAMGKPLPGYDVVLVDPATGEEADDGE
FT                   LCLRLDPRPVGLMKAYYGDPEKTADAFRDGYYHTGDMASRDERGIITYVGRGDDVFKSS
FT                   DYRLSPFELESVLIEHPAVAEAAVVPSPDALKLSVPKAFVVLAAGHQPGPELAEDILRY
FT                   CRDHLAPFKRIRRLEFAELPKTISGKIRRVELRHSEELRHGGGPLPEGLGVEYSESDFP
FT                   GLKS"
FT   gene            464307..465521
FT                   /locus_tag="Arth_0434"
FT   CDS_pept        464307..465521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0434"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   sma:SAV719 putative glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01835"
FT                   /db_xref="GOA:A0JS15"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS15"
FT                   /protein_id="ABK01835.1"
FT                   /translation="MPVQPQRRDDGETTTVPEQPPFPEADLMYIVDLLPAGERSRYLEV
FT                   REFLQSRIRAASIEYWNREEFPFGLLAEMGKFGLGGLQTDGTSALFKGLMYVEVARADV
FT                   SLSALVGIHNELIVGMIDELGSEAQKQRWLPGLKAFTQLGAFALTEPDHGSDIAGGLET
FT                   SARLERGEWVINGAKRWIGAGTIADFALVWARDEADRQIKGFIVETDRPGYSATKISNK
FT                   IGLRIMQNADIVLDEVRIPESNLLPGATDFSKANDLLRDSRAWVGWQCAGIQLAAFDVA
FT                   RAYALERKQFGKELARFQLIQQQLAEILGNASASLALMAQLARIQQDGKLEMVQAAMAK
FT                   STTTRLARASVAMGRSLMGGNGISSDYEMGKLFGDAEILYTYEGSYEINSLIVARAVTG
FT                   KSAFV"
FT   gene            complement(465547..466119)
FT                   /locus_tag="Arth_0435"
FT   CDS_pept        complement(465547..466119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0435"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: sma:SAV3244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01836"
FT                   /db_xref="GOA:A0JS16"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS16"
FT                   /protein_id="ABK01836.1"
FT                   /translation="MRKIILMASVSVDGYFEGLDRDISWHLVDEELHQHFNDECKGLGG
FT                   FLDGRLTYELMADYWPTADQDPNSPAVEVEFARIWRDMPKFVFSRTLTDADWNTTVMHD
FT                   VVPEEIAELKAQPGGDLAVSGANLAATFMRLGLIDEYRIYVHPVVLGQGNGRPLFESPD
FT                   VRLNLKLLGTHTFGNGVALLHYERGQD"
FT   gene            466394..466795
FT                   /locus_tag="Arth_0436"
FT   CDS_pept        466394..466795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0436"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO2154 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01837"
FT                   /db_xref="GOA:A0JS17"
FT                   /db_xref="InterPro:IPR021050"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS17"
FT                   /protein_id="ABK01837.1"
FT                   /translation="MKIESWIFGGLAMFFVPVGVVYGFVTGWTEPVGFLALWLVGGLAG
FT                   LIGGYLGYTGRRVGMRPEDRHDAEIHEGAGEQGQFSPWSWWPIAVGISAATGFLGLAIG
FT                   FWIVYIGAGFALVALIGWVFEYSRGDHAH"
FT   gene            466872..467591
FT                   /locus_tag="Arth_0437"
FT   CDS_pept        466872..467591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0437"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; Tetracyclin
FT                   repressor domain protein; KEGG: sma:SAV488 TetR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01838"
FT                   /db_xref="GOA:A0JS18"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS18"
FT                   /protein_id="ABK01838.1"
FT                   /translation="MTQQAEATRRIPLNRDRVLTAAVVLADAAGIESLSMRRLAQELGV
FT                   VPMALYKHVANKEELLDGMVDVLVAEIDPPASDAGWKNAVRLRVLSARKSLLRHPWARQ
FT                   VLESRTTRTPAVLGYMDSFIGMFLAGGFSVDLTHHVMHALGSRMWGFTQELFDDSANAV
FT                   PADLAPETQAAMLHEMAQRYPNILQVALAANHDDGSVVSQGCDDQFEFEFALDLLLDGF
FT                   ERFHRQGWTSGQAKLER"
FT   gene            467610..468551
FT                   /locus_tag="Arth_0438"
FT   CDS_pept        467610..468551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01839"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS19"
FT                   /protein_id="ABK01839.1"
FT                   /translation="MGMEALDWLLDSDPAIRWQVLRDLTGAPPEDVEAERTRVATQGWG
FT                   ARLLELQDENGQWDGGTYFPAQFDESEKGQPWTATTYSLLLLRDFGLDPRSGQARRAVD
FT                   LVRENSRWEEGGQPFFDGEVEPCINGMAVALGAYFGENVDVVVGRLLREQLADGGWNCE
FT                   AERGSVRSSFGTTINVLEGLLEYERATGGSPVSVAARQRGEEYLLERGLLRRKSTGELI
FT                   DRDWLEFSYPTRWFYDALRGLDYFRAAGNRPDERVSEAVEVLRPKRQPDGTWLLENTHP
FT                   GRIHFAMEDGDGRPSRWNTLRALRVLDWYDGQ"
FT   gene            468781..469047
FT                   /locus_tag="Arth_0439"
FT   CDS_pept        468781..469047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01840"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS20"
FT                   /protein_id="ABK01840.1"
FT                   /translation="MSNDQDIPDTGGEHGTGSLPSVRTSRKRTKHPRFRTGEHVRFADG
FT                   HVTGTGVVDDSTRDGSVLWVWADGGNGRRMLLQGRGTSVESLT"
FT   gene            complement(469075..470046)
FT                   /locus_tag="Arth_0440"
FT   CDS_pept        complement(469075..470046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0440"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: nfa:nfa45980
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01841"
FT                   /db_xref="GOA:A0JS21"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS21"
FT                   /protein_id="ABK01841.1"
FT                   /translation="MAELHAAALAVVHETVPFQQACWAGVDPATLIMTSITNWPPWPTP
FT                   DEYGVRFAETEYAGTEPNPFAQLTRRPMPAARLSDVAHRDVVRSVRLNDLLRPQGLEHE
FT                   LRAVFRTDDVCWAVGGLFRESGPDFTDREVDFLSSIAAALAAATRVAVRVERPALRGPD
FT                   GPVIVLVGPRGEVRAATPAAATWLAALEDQAPGRFGMTLYSVVGAAKAAASGTARMRMR
FT                   DVGDHWVVLQASRLITGDDPGQMVVTVEPATTHEMVTFLLAAYGATPRERDVCLEVVAG
FT                   SATTEIAEHLYISPHTVHDHLKSLFEKVGVGSRGELVARLLT"
FT   gene            470234..470632
FT                   /locus_tag="Arth_0441"
FT   CDS_pept        470234..470632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa37170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01842"
FT                   /db_xref="GOA:A0JS22"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS22"
FT                   /protein_id="ABK01842.1"
FT                   /translation="MNAVAQLFALLEALIYIAVFPLEAFFLRRPAVQKFLSTPAENVPA
FT                   VMMWAIPVGFRNLLIALGVIAGLVALNTGSEVVGRTLVTYCCAYMVLGGATMALADALG
FT                   HYPTKGDSIPGTLAATVPALIALVASAF"
FT   gene            470838..472607
FT                   /locus_tag="Arth_0442"
FT   CDS_pept        470838..472607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0442"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sil:SPO3831
FT                   hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01843"
FT                   /db_xref="GOA:A0JS23"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS23"
FT                   /protein_id="ABK01843.1"
FT                   /translation="MDGYAELRAFRATHTYRSLTVGGVEWNYVPGQAPPGARGAGPALL
FT                   VLGGGFSFGESAFRTITAFEPRFRVLAPSYPAVRTMAELLTGLAAILDAEGIPSANVFG
FT                   HSLGAGVAHAFARRYPQRVDRLVLSGFGLYTRGHTRLVSAFVRLFSVLPKAALAAFYRP
FT                   RIARLLEGAEEDERAFLSAYTEDLFAAHTKESALARLAVLLDLAAHPDLYSAASAFERP
FT                   ADVLLIAASDDRGFTPREREALLATYPGARAHVFGRGGHWAAVTHPTEYDAVVGRFLEG
FT                   RPPPPGRSERAPAQPPRRAPRRGGEERLNASALDAKLAAFRAGHRYRTVDVGGVRWRYL
FT                   AGGSGEQVLLLPSGGTRVPDMYLLLIEALERDFRVLAPAYPAGAGIAGLADGLAAILDA
FT                   EGVKEADVLGSSFGGFVAQVFARRHPERVRRLVLANTGGPAAAPLPGLPLLIRCLAVLP
FT                   EDAVRFLTGWNWRRWFVTGANGDSKFWDALLGDILSRLGKADLLSALREMNDFAHLPAE
FT                   AVQGVPAAATPPAPVLLIESERDEAFSPRARAALRALYPAAEVRLFAGAGHGVMATRTA
FT                   EYVETVREFLRMP"
FT   gene            complement(472643..473002)
FT                   /locus_tag="Arth_0443"
FT   CDS_pept        complement(472643..473002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV6096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01844"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS24"
FT                   /protein_id="ABK01844.1"
FT                   /translation="MSALTAPETVPIDGKIFAGVTNSGTGEVGAATRFHYHQDDDIVWA
FT                   EYSGGAILRGYLVGTRTADTLNFRYSHVSTDRLTANGVCESRIEVLDDGRVRFHESWAW
FT                   ESRPETGTSVVEEIR"
FT   gene            473192..473776
FT                   /locus_tag="Arth_0444"
FT   CDS_pept        473192..473776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01845"
FT                   /db_xref="GOA:A0JS25"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS25"
FT                   /protein_id="ABK01845.1"
FT                   /translation="MSSVDLEGARRPAAAAIASAGVWLIGISPVPGVYLEQDPGLRLEM
FT                   LRRGKRSWVVGQHIAAAGTAAVPVAFVRVALALPPGRTRAFAAAAAVALAAGAPLFVSQ
FT                   LALRASDLERFAARGLAGWPFLAYSWLHVIALGSLSGALASLPNRGREAAAVGLAALGS
FT                   GAVLARTGDIPPFVFYVSEQLAAASLLRRVD"
FT   gene            complement(473978..474868)
FT                   /locus_tag="Arth_0445"
FT   CDS_pept        complement(473978..474868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0445"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   cgb:cg1527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01846"
FT                   /db_xref="GOA:A0JS26"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS26"
FT                   /protein_id="ABK01846.1"
FT                   /translation="MKTMTHSDDVRKFLTSRRARITPDEAGLPVYGGNRRVSGLRREEV
FT                   AMLAGMSIDYYIRLERGNLSGASDSVLEALARALKLDDAETAHLFDLARAATAAPRVRR
FT                   KRSPQTVRPSVQRVIDAITAAPAWVRNDRGDVLAANELGSALYLDLMAEKTAPPNSARF
FT                   TFLNPKARDFFADWERAADDIVAVLRSTAGKNPYDKDLTDLIGELSTRSEEFRTRWARH
FT                   DVKYHRAGRKRLHHPVVGDLDLSFEAFELPADPGLRINVYTADPGTPSEDALKVLASWA
FT                   ATQRNTAKAAVKENK"
FT   gene            complement(474906..475319)
FT                   /locus_tag="Arth_0446"
FT   CDS_pept        complement(474906..475319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01847"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS27"
FT                   /protein_id="ABK01847.1"
FT                   /translation="MVVSRKYNLPVLILLDGLMGALADFGRHSTGHHQASGIFQKPGPG
FT                   LGIETVPLVFKAHTGVCPSVPVCLEVNSVQSTPPVNRLTALSPSPRESLSCTRQLRPCQ
FT                   TGYQAGWGALRVHASSFQRHRHFHMAGIHGRSG"
FT   gene            complement(475593..476588)
FT                   /locus_tag="Arth_0447"
FT   CDS_pept        complement(475593..476588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0447"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: sco:SCO5322 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01848"
FT                   /db_xref="GOA:A0JS28"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS28"
FT                   /protein_id="ABK01848.1"
FT                   /translation="MNTTPVSTPHFTSTTASERPLSGQDQPQVDAAIRMGAAGERALVL
FT                   GGGGSTGNAWLIGVVAGLFSAGLDVTTADLTIGTSAGSTAAAQIAGATPAELLAAVLAA
FT                   APQQRTDPARSDGGRVPIGPVADQMRRTGEIIAAAEDAADMRRRLGAAALGMDAASDDS
FT                   RRTQWRATVAARLPSQHWPQRTMLITAVDAHTGEPVVFDRHSGVDLADAVAASCASGFA
FT                   YRIGDNRYIDGGYRRSSENADLATGYRRVLVLSPFSGRSRAPLKWGLHLAAQVDELRAR
FT                   GSKVETIFPDSRSAHMFGANAMDLSLRPPAARAGYDQGKALAKQLTEFWR"
FT   gene            complement(476791..477129)
FT                   /locus_tag="Arth_0448"
FT   CDS_pept        complement(476791..477129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01849"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS29"
FT                   /protein_id="ABK01849.1"
FT                   /translation="MTKYLISFPSEAMVLTAEEFPIVSAESHAVIEEAKAAGVYVFGGG
FT                   IDEEVDPVLVSADGSVSPEIYPGSELKGGFTVLELPTREDAVEWARKIAVACRCSQELR
FT                   EFGYDPAS"
FT   gene            complement(477345..477782)
FT                   /locus_tag="Arth_0449"
FT   CDS_pept        complement(477345..477782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0449"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: lxx:Lxx18620 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01850"
FT                   /db_xref="GOA:A0JS30"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS30"
FT                   /protein_id="ABK01850.1"
FT                   /translation="MAIKLENVGIAVRDLEATIAFFTDLGLTVIGRDTVSGEWTDTAVG
FT                   LDGNHAKIAMLRTPDGHGHLELFEYIHPKAIESNPTRPNDIGMHRVAFSVDDIDKALEI
FT                   AAKHGCHPLRGVATYRDEYKLTYLRGPSGILVMLAEKLKKD"
FT   gene            478209..478745
FT                   /locus_tag="Arth_0450"
FT   CDS_pept        478209..478745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01851"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS31"
FT                   /protein_id="ABK01851.1"
FT                   /translation="MSGRGGTRLVRSAAATVLSMLLAGVLAACTYEDFGDPTATAVRST
FT                   RPAPSVPTKGPEILDTETRNYAELEKSLAVAQGSVLLEDSGPADGPGVGFSKTVKVQTA
FT                   GRYTVTAACVGIPDAQVFLSRPGSKELLSLDLDCSGVLSQVVELQEGYVAAMLMRHDPT
FT                   GPWTGAVAGVRITDG"
FT   sig_peptide     478209..478295
FT                   /locus_tag="Arth_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.861 at
FT                   residue 29"
FT   gene            complement(478852..479325)
FT                   /locus_tag="Arth_0451"
FT   CDS_pept        complement(478852..479325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV1084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01852"
FT                   /db_xref="InterPro:IPR014457"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS32"
FT                   /protein_id="ABK01852.1"
FT                   /translation="MTSPHLDQWTLSDHNYRRSEVTAFVGSGDVVWQRVAQEVLLWKIK
FT                   TASGFLVDPPGPVSPGDRVVVTARLGGLTVAEPVQVIDVVQEPGRSGFSYRTMPGHPVD
FT                   GEEAFFVHRRGEEVHLTVRSLTRAASRQPWRRLFPLLLIAQWIFQRRYLRALR"
FT   gene            complement(479306..479794)
FT                   /locus_tag="Arth_0452"
FT   CDS_pept        complement(479306..479794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01853"
FT                   /db_xref="GOA:A0JS33"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS33"
FT                   /protein_id="ABK01853.1"
FT                   /translation="MGTQYYDLTAEWPSLPRTGSVTIYRYSSELELKPDRPGVNHYLPG
FT                   GRGFPIGISILRPPILGRYGRYVLKGAFFGRSGFSFHDSLKVSICTCSRLAMSSDKRIF
FT                   GGRTMDIVVAAVFMAIFFYVLYGVIRAATRDGIIAARQSWKADATQDGQEVTHDEPAS"
FT   gene            complement(479825..480166)
FT                   /locus_tag="Arth_0453"
FT   CDS_pept        complement(479825..480166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01854"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS34"
FT                   /protein_id="ABK01854.1"
FT                   /translation="MKMIKPMLTATLVAGLTGCSYTGAPEDSATDSPVDPTSTSTPAPE
FT                   SGQPQVFEGKFVSQAAVTRGTVTLTVTPSKVELELAEFSTGDAEDLYVHLNPGTLEPSA
FT                   IGELGLNTP"
FT   sig_peptide     complement(480098..480166)
FT                   /locus_tag="Arth_0453"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.642 at
FT                   residue 23"
FT   gene            481032..481329
FT                   /pseudo
FT                   /locus_tag="Arth_0454"
FT   gene            complement(481524..481772)
FT                   /locus_tag="Arth_0455"
FT   CDS_pept        complement(481524..481772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01855"
FT                   /db_xref="GOA:A0JS35"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS35"
FT                   /protein_id="ABK01855.1"
FT                   /translation="MEDRYAGIPPKMKRLLKVTSIAATPVVIGALILRSFLDLWIVTLI
FT                   VAAVAALLFIPLGLAAAQERRELRHAPTDDLTRKNDE"
FT   gene            482457..483116
FT                   /locus_tag="Arth_0456"
FT   CDS_pept        482457..483116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01856"
FT                   /db_xref="GOA:A0JS36"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS36"
FT                   /protein_id="ABK01856.1"
FT                   /translation="MSGIDDLMAEANDRWADAKRRAQGVEDNGLGEAVKTYYTRYFPAG
FT                   FFILVAAGTIGATLAFPGTPERLPTFLTFGFLLGFLGALIGGLVYNAKKVAPAAKFGRI
FT                   DVLLCLENEEKKQVRRQIAGKGPIDPEHLSVTRAAAVQLRKGLATQLLLAPLYPLIFIP
FT                   QVMNLALRGDSLFAWLMAIGVGVIAAGVGFLVRDFRRAGRFLAHTAEQAAPGNAPP"
FT   gene            483246..483794
FT                   /locus_tag="Arth_0457"
FT   CDS_pept        483246..483794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01857"
FT                   /db_xref="GOA:A0JS37"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS37"
FT                   /protein_id="ABK01857.1"
FT                   /translation="MMTWWNKHPILLTMLVLALGWGFVLAVQLVFGDSFDEAAVSATFW
FT                   VICVAAVWYVFLRRRKKTEQRLADAGQVLMYLRYPDSRPGSLSGIWNMGVATLAPRTLH
FT                   FQPSVYDNLEPSGRAVVLTGLEVASPPRSLNRQDKKHVPQFLFQAMTLSSDAGTIEVAA
FT                   SPATLEKVRQSVIAPPAEN"
FT   sig_peptide     483246..483326
FT                   /locus_tag="Arth_0457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.887 at
FT                   residue 27"
FT   gene            484186..485940
FT                   /locus_tag="Arth_0458"
FT   CDS_pept        484186..485940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0458"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: sth:STH275 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01858"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS38"
FT                   /protein_id="ABK01858.1"
FT                   /translation="MAPPSMLDPSVDGCGGRLVWMESRVELFALIRRDARVEGLSVRAL
FT                   AAKHKVHRRTVRQALESASPPERKPRQGVAWRLEPFKPAIDAMLTEDTTAPRKQRHTAR
FT                   RILARLVEEHGAEELSYSTVRDYVRVRRAQIDVEAGRRVEVFIPQEQAPGAEVEVDFGE
FT                   VWVVLNGVKTKCHMFVFRLSNSGRAIHRIYLTQAQEAFLEGHIEAFNVLGGIPTKHIRY
FT                   DNLTSAVTAVVFGQGRQRQENDRWVLFRSHYGFDPFYCQPGIAGAHEKGGVEGEVGWFR
FT                   RNRLSPMPVAGSLDELNDRIRAWEVLDDRRRINDRIRTIGQDFALEQPFLAPLPAELFD
FT                   PGLVLTPRVDRSSMVTARMVKYSVPARFIGRRLRVSLRASEVVVFDGRTVVARHQRIVA
FT                   KHGQSVQLDHYLEVLKTKPGALPGSTALARSRESGAFTTAHDAFWAASRRVNGDADGTR
FT                   ELIDVLLLHRSMDAGDVQAGITAALGVGAVSADVVAVEARRHSSSVSDGGAGPDRHPVA
FT                   REDADVQRVVSLTQRRLMDPAAVIAGLPSDTRPLPSVGVYDELLAKRSHPAGIVSKESI
FT                   SWALQHPL"
FT   gene            485916..486734
FT                   /locus_tag="Arth_0459"
FT   CDS_pept        485916..486734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0459"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: sma:SAV208 IstB-like ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01859"
FT                   /db_xref="GOA:A0JS39"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS39"
FT                   /protein_id="ABK01859.1"
FT                   /translation="MGPAAPSMTITPTLRRRRGLTEQAAVAAVDQACRRLRLPTIRAVL
FT                   DEALTVAGKEQLSYQGFLAELLLAECDDRDRRSSLRRVKAAGFPRDKWLGDFDFDANLN
FT                   INAATIHTLATGDWIRKGSPLCLIGDSGTGKSHLLIGLGTAAAEKGYRVKYTLATRLVN
FT                   ELVKAADEKVLAKTIARYGRVDLLCIDELGYMELDRRGAELLFQVLTEREEKNSIAIAS
FT                   NESFSGWTKTFTDPRLCAAIVDRLTFNGAIIETGTDSYRLAHSLNRVNPG"
FT   gene            complement(486871..487179)
FT                   /locus_tag="Arth_0460"
FT   CDS_pept        complement(486871..487179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01860"
FT                   /db_xref="GOA:A0JS40"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS40"
FT                   /protein_id="ABK01860.1"
FT                   /translation="MNTLAVALLMLASAMSTAYALLQVLSSPTQRLPYIDNRPMSDGGG
FT                   RKWLFLGAIVLIAVGSFVYSQRSDGNQILDFVVFLIVGVVPVVLIRFVHNRRVPESK"
FT   sig_peptide     complement(487117..487179)
FT                   /locus_tag="Arth_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 21"
FT   gene            complement(487411..488418)
FT                   /locus_tag="Arth_0461"
FT   CDS_pept        complement(487411..488418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP1569 ModD"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01861"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS41"
FT                   /protein_id="ABK01861.1"
FT                   /translation="MRLRHGLLSFVVVTSVALTGMGAPAVAAPDTSPLKAPAAPAPPAP
FT                   PVTDAALEPVPEPVPFAPAPGDEVAAADAAGTPIIPEGAPAALTVAALVPATGANGAAS
FT                   GNRGAASMVSHSLSDAAVLGWNPTNGNIVLTGDLLRLKGVSRDMEVKWRYNSLNDVRPT
FT                   LSVGTQEAGVRADASNNITYTAADGGEYTFVPNGSGGWTAPPGLNASIRSFDPFTVTIR
FT                   FNDTGNSNQYIKSGAVYVLRNEDDPYSDLPNRASSAKTARPSTPTTPGATRPHGEPRLR
FT                   PTHGPTPAATTTPPATASNSVPATTTPSVDASRNWTPPGRKPTPTSTQAVTPST"
FT   sig_peptide     complement(488335..488418)
FT                   /locus_tag="Arth_0461"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(488712..489137)
FT                   /locus_tag="Arth_0462"
FT   CDS_pept        complement(488712..489137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01862"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS42"
FT                   /protein_id="ABK01862.1"
FT                   /translation="MIELPALIAALSNVLPSHVPMTKWPDPGYPQDVLLEWRPKAMGAS
FT                   ILDVGWEANGGDIQIGFGSRYFDLFPPKKGAPDGRLEDILEYAEAISLGRLVTFSETEG
FT                   RGRVETTVFGCRSGPRFYRAHERATGEPDIYLPYAPW"
FT   gene            complement(489413..489877)
FT                   /locus_tag="Arth_0463"
FT   CDS_pept        complement(489413..489877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01863"
FT                   /db_xref="GOA:A0JS43"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS43"
FT                   /protein_id="ABK01863.1"
FT                   /translation="MREPWLFVFGAVFVIGTVSTLLWTRTFERRKNRLGWSEKGETFGK
FT                   RRQIQLAACIAAAIVTFVTVTYGLGLPPGAGRTGELGLILILISIIWVVFRRDIARYQY
FT                   QIAMTMFGKLRPEQEQEQHQVRTMESVGIAFSVLLSITGILLLTLNLAFS"
FT   gene            complement(489957..490229)
FT                   /locus_tag="Arth_0464"
FT   CDS_pept        complement(489957..490229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0464"
FT                   /product="DNA gyrase, A subunit"
FT                   /note="KEGG: fra:Francci3_0007 DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01864"
FT                   /db_xref="GOA:A0JS44"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS44"
FT                   /protein_id="ABK01864.1"
FT                   /translation="MDEDERQAREQLMIHDALVQAMDRREEVFQEIEDSEDMDEAIRRV
FT                   GQLLGVGELGSRFVLDLQARRFTRDQRQAISSYAEELRSRLRDGR"
FT   gene            490355..490777
FT                   /locus_tag="Arth_0465"
FT   CDS_pept        490355..490777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01865"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS45"
FT                   /protein_id="ABK01865.1"
FT                   /translation="MKPRGLLLVGLGVVAAVVALALLLFSRPWSRVCPAMGYAYVGPVE
FT                   LQFSHEPTSAAACFEEDCTPAPVAKSPDGKWMVPQSTPYLVPPASVRTVYVEAALSSGS
FT                   RIARTFPIETEPTGEYPYGRECGGPYTFLPVKVPIG"
FT   sig_peptide     490355..490420
FT                   /locus_tag="Arth_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.718 at
FT                   residue 22"
FT   gene            complement(491091..491672)
FT                   /locus_tag="Arth_0466"
FT   CDS_pept        complement(491091..491672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0466"
FT                   /product="Resolvase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: xfa:XFa0019
FT                   recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01866"
FT                   /db_xref="GOA:A0JS46"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS46"
FT                   /protein_id="ABK01866.1"
FT                   /translation="MAAHRIGYARVSTRDQNLDLQLTALKGAGCDRIFEDTMSGTKAGR
FT                   PGLAKALETLREGDTLIVWKLDRLGRSVKDLLDFAGGLNERGIGFVSLTDSIDTTTASG
FT                   RFFFNVMASLAQMERELMVERTQAGLQAAREQGRVGGRKRVMTEAKIRSARKLLNQGTP
FT                   PKEVAASLGVSVPTLYRWVPATNPEALAVP"
FT   gene            492593..495838
FT                   /locus_tag="Arth_0467"
FT   CDS_pept        492593..495838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0467"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; KEGG: sco:SCO0072
FT                   secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01867"
FT                   /db_xref="GOA:A0JS47"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS47"
FT                   /protein_id="ABK01867.1"
FT                   /translation="MAAYRSLLSGLVLSAVVFTGLTAPAGAATASAAVKPPARAGAPHR
FT                   AGLGVEASAAPAIGMAPMVLPPASGADGIKSGNRSAAAMITRQLTDLSALSYNPTNGNV
FT                   VLTGQLLHVKGANRDLSIGWRYNSINDVRPTLSVGAVEAGVTVGTGNSVTYTAPDGGTY
FT                   TFVSAGAGVWTMPPGLNATITVFTSTAITIRFNDTGFTNEYELVGSVFRLKYMNDQNAS
FT                   SPNRITYTYNGSGQLSTINDTIGGRPVTFSYSDPNNAEQPSSIHDDALSRTISLEYSGP
FT                   NGAMSRITDATGAVMDFGYGAPSDRITTVTDDAGTVTTLAYDTPQKRLGQATYATGTAV
FT                   QSVWQYSYLIDPVNGFFAYVKDPNLNTTQFRSSAANQNAQTQDPLGHQSQFLVDAHDNV
FT                   TNTATSLGYSTTYTYNTNNSLTKITSPAAAGGGTGGEISFTYPTNTGNPLSNYQPNTSI
FT                   SSENQTTSYSYDANTNNRYQTTTPGTGGGAGGTPKLNYQGDAAGTTCGAKKGQVCKSTD
FT                   GNGNITTYTYGALGMPTTITRPSPLGTITNVYDDASRLITSTDGKGQTAHYDYDDNDRL
FT                   VQIDRGVNCATLCVSYVYDGRGNLIEREDDTGITTYAWDLQNRPQSKTIGGVTTSVTYD
FT                   GASNILTSVDPLGTVTYKYDAASRLISLAEPGGSCPGTPAFPNATKCTGFDYDNDNRRT
FT                   AVKYPTGVKNTTVYDNNSRITSITATNTSAGILAKRAYTYTMNGTKDGALRKTMTDQAG
FT                   TVTTYSYDPMNRLSQAVTGTVTETWTYDKNANRTKDTKTGTADVYNAYNAADQLCWAGS
FT                   SAGTCASPPGGATTYSYDANGNTTVAGATTQGYNVFDQFTSNSNGGTTNYTYTGSRNDE
FT                   RLTAGSTAFLNGSLGITRQTTGGASTSFIRDPQGTLISMRTSTGASFYYTTDALGSIIL
FT                   LTDSAQAAAATYAYDSWGLTTASSGAQAATNPWTYAGGYNDTTSNRIKFGARYYNPYRG
FT                   RFTQPDPSNQEANRYAYAGCNPINSTDPSGLASQECIGQAGQSGAALFVAMFAAMAVIT
FT                   LTGGAALAAAGVAISTFGGGIFSGISAAATCRR"
FT   sig_peptide     492593..492676
FT                   /locus_tag="Arth_0467"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.469 at
FT                   residue 28"
FT   gene            496333..499605
FT                   /locus_tag="Arth_0468"
FT   CDS_pept        496333..499605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0468"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: sco:SCO0072 secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01868"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS48"
FT                   /protein_id="ABK01868.1"
FT                   /translation="MALSFVVVTSVALTGMGAPAVAALDASVLTAPAAPSPPSSPVTEA
FT                   KLEPAPEPVQVEPEPGDEVPSSDAEGTPIIPEEAPAALAVAALAPATGANGVASGNRAA
FT                   ASMVTRQLSDAAALSWNPTNGNIVLTGDLLHLKGVTRDMDVKWRYNSLNDVRPTLSVGT
FT                   REAGVRVDASNNITYTAADGGEYTFVPDGAGGWTRPAGLNASIRSLSATNLNINFDDTG
FT                   YGNGYVKSGDVYVLRSEDDHYGDLPNRASYYDTDGRLSASSDNRNQIINYVYQDANNEE
FT                   QPSQIIDTTINRAINIEYNGGSGRMSKITNASGAALSFTYNSAGKIATVKDGRGTTTTL
FT                   EYDTNGRAKKITYGTGTTAQSIFTPAYPTATSSTLTDPNNKTATYAFTGARQVTQVTDP
FT                   NGNTTQATWDAHDNRLTSVDGLAKTTTATYNLNNSLTKITKPAAGTGTGSETIYTYAGP
FT                   NGRLPIASTNSEGHVTTYGYDVNTANIDKAQTPGPNGGAGGARTWNFERDDELTTCGAQ
FT                   RGQLCKTTDGNGNVTSYAYDANRNPVTITRPAPLGVITNTFDAADRLITSKDGKNQTQT
FT                   HTYDNNDRITQTRQGATCIPATCVTYTYDANGNLTQRVDAGGTTTITYDAQNRPTTKTI
FT                   GGTTTTLTYDGASNILTSVDPLGTVTYKYDAGNRLISLAEPGGSCPATPVFPNSTKCTG
FT                   FEYDANNNRTATKYPNGMKNTTVIDAAGRTTSITATNTTAGVLARRAYTYTVNGTKDGA
FT                   LRKTVTDHAGTVTTYNYDEVNRLTQAVTGTNTETWAYDKNSNRTVDTKTGTANVYNAYN
FT                   GADQLCWVGASAGTCASPPAGAVTYAYDANGNTTTAGATTQTYNVFDQFTSNTNGGTTN
FT                   YAYAGTRNDERTTADGTAFLNGALGITRQTTGGAATSFIRDPDGNLVSMRTSTGASYYY
FT                   TTDALGSVILLTDSAQTKAAEYAYDSWGLTTTNSGAQAAVNPWTYAGGYNDTTSNRIKF
FT                   GARYYNPWRGRFTQPDPSGQDQNRYAYVSCNPINATDPTGLGPAECFFNASAAVFSAFV
FT                   VAGAGAAAVATGGLAVVGLIGAIGLEATTATAAGYYCGELIK"
FT   sig_peptide     496333..496401
FT                   /locus_tag="Arth_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.871 at
FT                   residue 23"
FT   gene            complement(499914..500732)
FT                   /locus_tag="Arth_0469"
FT   CDS_pept        complement(499914..500732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0469"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: sma:SAV208 IstB-like ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01869"
FT                   /db_xref="GOA:A0JS49"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS49"
FT                   /protein_id="ABK01869.1"
FT                   /translation="MRPTAPATTITPTLRRRRGLTEQAAVAAVDQACRRLRLPTIRAVL
FT                   DEALTVAGKEQLTYQGFLAELLLAECDDRDRRSSIRRVKAANFPRDKWLGDFDFDANPN
FT                   INPATIHTLATGEWIRKGSPLCLIGDSGTGKSHLLIGLGTAAAEKGYRVKFILATRLVN
FT                   ELVEAADERVLAKTIARYGRVDLLCIDELGYMELDRRGAELLFQVLTEREEKNSIAIAS
FT                   NESFSGWTKTFTDPRLCAAIVDRLTFNGTIIETGTDSYRLAHSIAQQAAR"
FT   gene            complement(500774..500953)
FT                   /pseudo
FT                   /locus_tag="Arth_0470"
FT   gene            501000..501593
FT                   /locus_tag="Arth_0471"
FT   CDS_pept        501000..501593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0471"
FT                   /product="Resolvase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: psp:PSPPH_A0101 DNA
FT                   invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01870"
FT                   /db_xref="GOA:A0JS50"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS50"
FT                   /protein_id="ABK01870.1"
FT                   /translation="MTALLVGYARVSTEQQDLTAQRDALSAMGITADRIYVDHGLTGTD
FT                   RNRPGLREAMAACRDGDTFVVTKLDRLARSVRDAHEIVDELAQRNVKLSIGGSVHDPTD
FT                   PIGKLLFNVLAMVAEFESDLIRARTREGMKIAKAKGRLKGKKPKLSPAQEAHLVKLHDA
FT                   GEHTTGELAELFSVARSTVYRAVQRARHKSGPAR"
FT   gene            complement(501706..501909)
FT                   /locus_tag="Arth_0472"
FT   CDS_pept        complement(501706..501909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0472"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: sma:SAV4820 putative cold shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01871"
FT                   /db_xref="GOA:A0JS51"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS51"
FT                   /protein_id="ABK01871.1"
FT                   /translation="MATGTVKWFNAEKGFGFIAPDDGSADVFAHYSAIATSGYRSLDEN
FT                   QKVEFDVTQGPKGPQAENIRPL"
FT   gene            complement(502054..502977)
FT                   /locus_tag="Arth_0473"
FT   CDS_pept        complement(502054..502977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0513 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01872"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS52"
FT                   /protein_id="ABK01872.1"
FT                   /translation="MASPEYEEYPSADGVMDDATLKDAEIRDWNWAVLPKGSVSTRFAA
FT                   PSGSLAMVAMGKPQNPRVVLVPGATGSKEDFAVMMPELAEAGFYVLSYDLAGQYESAGA
FT                   GPENLVPPRRHYDYELFVNDFVAVLESGGVPAHVVGYSFAAIVAQIAYSKRPELFRSFT
FT                   LLSCPPLTGQCFRGISRFGRFTGLANGRVGAALMIWGIRRNVNKVSPNRLRFVRNRFRF
FT                   TRRQSVRDIYGLMKNVPDLREHLAAATVPKFVAVGEHDLWPLHLHRQFAQSIGARISVY
FT                   RGGHSPSETSPHQFGRDLLAMYAEGG"
FT   gene            complement(503068..505788)
FT                   /locus_tag="Arth_0474"
FT   CDS_pept        complement(503068..505788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0474"
FT                   /product="Pyruvate, water dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /note="PFAM: pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding; PEP-utilising enzyme, mobile region;
FT                   KEGG: mba:Mbar_A3264 pyruvate, water dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01873"
FT                   /db_xref="GOA:A0JS53"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS53"
FT                   /protein_id="ABK01873.1"
FT                   /translation="MAHVSPAPAPASGAGNSLVVDLAELASGSLALVGGKALNLGKLAA
FT                   AGFPVPAGFCLTTTGYRMAAPAELDYIAARLDGANGLDGAKKYDGAPGLPDDQRDGLAR
FT                   QAREAMAAAQVPADVEAAVRGAYAAMGDAPVAVRSSATAEDLPFASFAGQQDSFMDVIG
FT                   ADAVVQAVRRCWASLWTDRAVAYRTANGISNREAGLAVVVQQMVDAGTAGVLFTANPVT
FT                   GTRTESVIDSSPGPGQAVVSGAVNPDHFVVDTATSRILQGPQGAGTSLDPAQVRELTSL
FT                   GDAAQRLFGAPQDVEWVIDAGGKAWLTQSRPITTLYPLPEDESPGGTGGADRTAGGDTR
FT                   VYLCGTLLQGLTRPLTPMGLSVLGLMRNSKGPWKYVNPGLRMYVDLTAVVRNKSGRKAL
FT                   LRLLPLADGRSAAVFPALLEDPRFSIVRPARRLPGRKRTKGHAGTEAKGTEESQSLVLM
FT                   AGLIPAMIRALLWPDGELRRARRYQDRLEARLALPLPANPARRLQHAEDVLGSTVNGII
FT                   QATLPGPSVGYLMLAAARRLLRGIAKPRELEAVLRGLPHNVTTIMDLELWQLAVSLGRD
FT                   PESRRVFTELRPDGLAALYTAGGLPSVAQAGLRTFLSKYGHRAVAEIDLGMPRWAEEPD
FT                   HLLGIISNYLRVEDPEQAPDRQFARAADHAEARVSELVERAAARSRLRGRLVALCLRRA
FT                   RQLSGLRELPKFYIVMVLAEMHRQLTAVGEELTRTGNISAATDVFFLDFEELRVALRGA
FT                   DLKEVVAVRRRMYDVELRRRRVPRLLLSDGTDVEAAMMAAAAALPQAAAADRLTGTPAS
FT                   AGTATGKVRVIMDPVGAHVEPGEILVAPSTDPGWTPLFLTAGALVMEMGGVISHGAVVA
FT                   REYGIPAVVGVADATVRLRDGQTVTVDGAAGTVTW"
FT   gene            complement(505798..506115)
FT                   /locus_tag="Arth_0475"
FT   CDS_pept        complement(505798..506115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01874"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS54"
FT                   /protein_id="ABK01874.1"
FT                   /translation="MAGFVQIIEFQTSRIEEIEQLGRPSRTEGGTPPTFRRIVATADRD
FT                   RPGTYFTIVDFDSYESAMENSNRPETSEFAAKMAALCDGPLIFRNLDVMWEDNGEAAEN
FT                   G"
FT   gene            complement(506224..507375)
FT                   /locus_tag="Arth_0476"
FT   CDS_pept        complement(506224..507375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0476"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: reu:Reut_B4255 GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01875"
FT                   /db_xref="GOA:A0JS55"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS55"
FT                   /protein_id="ABK01875.1"
FT                   /translation="MQLDTLTLRVAFAIVAFTLALLFYFAAYRSTRSPYSAWWCVALTL
FT                   FLAGSAAYLFNGTPQQVWANPLGNCLLVAGGACVWAGARSLRAARPRSWQLAAGPAVVT
FT                   VSSALENPGVNIWAGGAVFLALMGLMLGLASRELWRLEPGYSRVRIPLAIAAAFFAAYY
FT                   FCRLVVYLAEGPDGRIFVTYFGSAVTTLVTMVLLVVVSFSMAALSSEQQTRALRAVATQ
FT                   DGLTGLLNRAAFLDLASEELLRLRHTRALGTLVLADLDHFKAVNDTYGHAAGDAALQSF
FT                   ASACNETVRSTDLVGRYGGEEFIFLLPGVSPDRAEAITAEINKQLEAVRGPDGSRMPTV
FT                   SYGIAPIGKGTSGLDELIATADAALYRAKSLGRNRTVRGIHTP"
FT   gene            complement(507472..508527)
FT                   /locus_tag="Arth_0477"
FT   CDS_pept        complement(507472..508527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0477"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   lxx:Lxx23600 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01876"
FT                   /db_xref="GOA:A0JS56"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS56"
FT                   /protein_id="ABK01876.1"
FT                   /translation="MRATIIHGPGDIRVEDRDYPTIQLPTDVVVKVTASCVCGSDLWPY
FT                   RGVRPTRRPTAIGHEFVGVVESTGEGVTELAVGDFVIAPFVVSCGECPQCLNGVTVACD
FT                   HLAGWGGRDDTGHKIDGGQGQAVRVPLAESTLVKVPGVTEPDAELTANLLTLSDVMATG
FT                   HHAALSAKVAPGRTVVVVGDGAVGLCGVLAAKRLGAERIIAMSRHADRQALAREFGATD
FT                   IVEERGDDGVAKVRALLGGVLADSVLECVGTKESMEQALHCVRPGGALGFVGVPTGGGE
FT                   VPLRYLFDSNVSIAGGMAPARTYIPELLADVLAGSINPGRVFDSVMPLEEAPQAYKAMD
FT                   ERRAIKVLLTP"
FT   gene            complement(508590..509816)
FT                   /locus_tag="Arth_0478"
FT   CDS_pept        complement(508590..509816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0478"
FT                   /product="conserved hypothetical alanine-rich protein"
FT                   /note="KEGG: sco:SCO1894 hypothetical alanine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01877"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS57"
FT                   /protein_id="ABK01877.1"
FT                   /translation="MNDTRASVTGYLYPWDVLGDSGAAADVAAVGVDRVALAASYHSVR
FT                   AATPRHPRRRVVDARTAALYVPVTDAWAGQDLIPAEGTGWTGTSDAFGEAARQLRSAGV
FT                   PVDAWTVLTHSSSLGARHPQLCVRNAFGETYLHALCPSNEAVRKYARTIVGQVLRHGNP
FT                   DGLVLEAAGPLGFSHQNQHEKTEGADYSPWVQALLSLCFCDACRSGYGRRGMDAGVLAA
FT                   KVRSAVLSDSMEAGGNHRLQLGAGCDADGFVPLLECRWDATATLLDGVLTEAAAWPDVR
FT                   LSIHASPDPWSSGPFASLRALERSKLWESFPGATAVLPCWGAATDSAAALRSFRSDAPA
FT                   AATGAYVLALPPKSADSRALSQEWKALLDEGCTELHLYHLGLASTRRREAVAGALGLLG
FT                   GREGTEPKE"
FT   gene            complement(509813..511102)
FT                   /locus_tag="Arth_0479"
FT   CDS_pept        complement(509813..511102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0479"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: ani:AN0613.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01878"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS58"
FT                   /protein_id="ABK01878.1"
FT                   /translation="MNTSTTFQAITTPTAADLKITDVTITPIAFSDPPLLNAVGVHEPL
FT                   VHRVVIEIRTANGLLGLGECAGGQSRLANLAVGARAIRGVSVFDTTLMELLINEALAGE
FT                   PSVFERAAVFSAFEVAALDIQGHATGRSVSELLGGTVRDEVPFSAYLFYKWAEHPALDG
FT                   KPAISDEWGEALDPEGIVRQARKMISEYGFKSIKLKGGVFPPAQEIEAIKALRQAFPGL
FT                   PLRLDPNTAWTVETSRWVAQETSGLLEYLEDPTPGLEGMAAVATTAAMPLATNMCVVAF
FT                   DHIKRGVELGAVQVILGDHHYWGGLRHTRELGAICQTFGIGLSMHSNSHLGISLAAMVH
FT                   VAASTPALTYACDTHYPWNGHNDVVKPGALRFVDGSVKVPAGPGLGVQLDREKLAELHQ
FT                   QYLDAGMTARDDTGYMQKFVPDYTADLPRW"
FT   gene            complement(511153..512061)
FT                   /locus_tag="Arth_0480"
FT   CDS_pept        complement(511153..512061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0480"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: yps:YPTB0503 ABC type sugar
FT                   transport system, permease protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01879"
FT                   /db_xref="GOA:A0JS59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS59"
FT                   /protein_id="ABK01879.1"
FT                   /translation="MTLARTTAAPRRRPSPSARFDTALGWSPQFGANMALRITLCVLVF
FT                   CIFALPFVAIISAAFDRNSSPTEISLLPKTFTLQNFEVAQQQGLWGYLLNSLVIAGGGL
FT                   LLQMTVSVFAAYSLSRKKFRGQALVLLLVLMTMMLPEEVIGIPLSLVLGDLPLLGISLK
FT                   GSVLAVILPVGIWGFSIFIMSEFMKEIPGEIEEAARLDGVGEFRMLFTIILPLCKPALG
FT                   VIGIFGFMMVWDQYLLPLIAANDPSDYTLTVALSVLRNDTTVGPGVLVAGAVMAMIPSL
FT                   LVYLFLQRSMIRGITSGATKG"
FT   gene            complement(512058..513008)
FT                   /locus_tag="Arth_0481"
FT   CDS_pept        complement(512058..513008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0481"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypm:YP0612 sugar transport
FT                   system, permease protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01880"
FT                   /db_xref="GOA:A0JS60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS60"
FT                   /protein_id="ABK01880.1"
FT                   /translation="MTATPTKTPVSRPAPPAHKAAGGTRKRRGSKQSLAVWLFLLPAAL
FT                   LGLYFKFIPMFEGVRLSLFKVQPFLGDIFVGFENYAKVLGDQRFMEALGHTIFLGVTQT
FT                   LGALLVGFVLALLLEGQARSLWFLRTAIFLPVVTALAVVGEIWRILYFPTADGPLNSIL
FT                   GWLGLGPLQFLNGTDTALWSIAVVGIWSGAPYNMVIILAGLTGVDRSLYESAGVDGATV
FT                   WQRLRYITLPALRPSLVIVLTLAAIRSLRSFTEVYVLTGGGPAGSTEVWMTRMYSLGFQ
FT                   RNDIGVASAAAVLLLVVTLLLTVGTQYLAKRKADR"
FT   gene            complement(513005..514336)
FT                   /locus_tag="Arth_0482"
FT   CDS_pept        complement(513005..514336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0482"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: ypm:YP0611 putative sugar binding protein; TC
FT                   3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01881"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS61"
FT                   /protein_id="ABK01881.1"
FT                   /translation="MDSKIRFRARVAVALSIASAAALTGCGSGPSAPAATDDGQPIEVW
FT                   ARAGTDAATTYAAMFKEFTAKTGVKVNFQGVPDLDQQLQTRAASKKLPDIVINDSAALG
FT                   NYTAQGYLQKIDRSSVTGSDRIADSLWKETEGLDGASYGVPFSRQTMVTMIRKDWREKL
FT                   GLPVPKTLEDLAKLATAFATQDPDGNGQADTYGMVVPGSTERGYLGWWASSYIWQDGGS
FT                   YLKDEGNGKYSSNASSPETQAGVSWVKQQFCTPGNTQPGALTAATSVASPFFQTGKAGI
FT                   ILTGPYNFSSFDKTPGKDVYEVIEAPKGSKDNTVLAEGENIYVTASNAKKDQTKQVIDY
FT                   LVSQDGQKAGMTAGKQPIVRVPVNSDVDAAAVYNDPRWSVVQEALKSSSKAFPSAINFV
FT                   PFRQAAAEALNKIVADCPADNVASGLQALDTAINDELNSQNAKS"
FT   sig_peptide     complement(514226..514336)
FT                   /locus_tag="Arth_0482"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 37"
FT   gene            514441..515277
FT                   /locus_tag="Arth_0483"
FT   CDS_pept        514441..515277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0483"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility C-terminal
FT                   domain; KEGG: tfu:Tfu_1140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01882"
FT                   /db_xref="GOA:A0JS62"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS62"
FT                   /protein_id="ABK01882.1"
FT                   /translation="MSAESEPITVAVTGGAGMMATLLRPHLREAGYAVRLIDIAEPASP
FT                   APSESVLVGSVDDIAFMTEALADVDAVIHLGGIHREKPWDDIVRTNITGTQVTLEAARS
FT                   NGVSRVLLASSTHAVGFTPTAEAARDHALPPRPDTYYGVSKAAMEALGGLYADKFGMKV
FT                   VSARIGTGGERPGNTRSLSSWLSPGDSFRLVEATLSEKGAPGHHVVWAVSNNTRGWADL
FT                   SAGKRIGFEPLDDAEDYADQVPADPVPADWDGLLGGFWASSSHRLGVDNYPELELK"
FT   gene            515305..516126
FT                   /locus_tag="Arth_0484"
FT   CDS_pept        515305..516126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0484"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: sma:SAV6388
FT                   IclR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01883"
FT                   /db_xref="GOA:A0JS63"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS63"
FT                   /protein_id="ABK01883.1"
FT                   /translation="MNAVMNPAHAAPAMPAGAAGDVKLVKSAERTIAILEMLAAAPKPL
FT                   TTAEIYKQTGYPRSSLHWLLLTLLELNWIEQSPEGGYRIGTHALLCGTAYLDRDPVMEH
FT                   VSGVLEKVRNATTFTTHYARLDRSDVIYLATRQAVDRRRLSSRVGRKLPAHVTALGKAI
FT                   LAELTDAEVRDRLGEGPYPLLTPNSVPDFAALQTELAGFRKAGYSLEREQNTVGLCCVG
FT                   IVVPYRIPGTDAISCSIPTELATGQVLSDVVDTLRGAAAELAATLRAAGIR"
FT   gene            complement(516123..516749)
FT                   /locus_tag="Arth_0485"
FT   CDS_pept        complement(516123..516749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0485"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: sco:SCO4276
FT                   putative response regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01884"
FT                   /db_xref="GOA:A0JS64"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS64"
FT                   /protein_id="ABK01884.1"
FT                   /translation="MNPITVLLVDDHLVVRSGLKALLGTQPDIEVVAEAASGEEALALT
FT                   EQLSPAVVMMDLAMGPGMDGIEAIKQLRRRNARQAVLVFTTYDSDADIVRAVDAGAMGY
FT                   LLKDAAPDEIFAAVRGAVQGRSVMSAPVASRLFQQLRNPDEILTPREAELLSLLTEGLS
FT                   NRELGQRLFISEATVKTHLAHIYAKLGVETRAAAIATAIRREGMR"
FT   gene            complement(516746..517966)
FT                   /locus_tag="Arth_0486"
FT   CDS_pept        complement(516746..517966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0486"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region; KEGG: lxx:Lxx18210 two-component
FT                   system, sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01885"
FT                   /db_xref="GOA:A0JS65"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS65"
FT                   /protein_id="ABK01885.1"
FT                   /translation="MPSSPPPLPAAPVPSPAPGPLPRHGAPGRGPLGRIDAVVHLGFAV
FT                   LLVASAVRYVMRHSPADNLWVLALAVAVCSLYAVIAVLSQRRRPWAVWMFVLVALWAVL
FT                   VIAAPSFAWCSFALFFLCRTAFSGWVAYLAGGATAAATAVGLFRLSGGSDIAMLLGPLA
FT                   VGVMLTLIYDRIEQDAAEQRHLHAEVSLAQGRLAASERRAGTIEERERVSREIHDTVTQ
FT                   GLASSLLLLEAANRSWPAEAAREDVLTASGMLRRNLADTRSLVHELASPGLDTAPLPEA
FT                   LLQAASQYVPGVRLLVTGEPRPVPADVRHALLRVVQSAAANTKLHAGAANATVTLGFLP
FT                   GAVTLDVYDDGAGFDPHSLAPPSDAGGYGLRAMRQRVEQLGGVFSVESTPGEGTIVAAQ
FT                   LPTGEEK"
FT   gene            518186..518779
FT                   /locus_tag="Arth_0487"
FT   CDS_pept        518186..518779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0487"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   lxx:Lxx18200 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01886"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS66"
FT                   /protein_id="ABK01886.1"
FT                   /translation="MSKKIAATAAAGALLLTGGLTAAANAGTSAPASAPAAAPAAAPAA
FT                   VPAADVQPAPETVVAQNRISVGASADAVKAALAKCQADKLPFVTIALVDRFGTMQALLR
FT                   GDNAAEHTIEAAQQKAYTAAAFGTPTSELAKRINGNGPSIADLPGTLFLAGGVPLKVNG
FT                   VSVAGIGVGGAPDGALDEACAAAGAEAIAAGTAK"
FT   sig_peptide     518186..518266
FT                   /locus_tag="Arth_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.724 at
FT                   residue 27"
FT   gene            518998..519528
FT                   /locus_tag="Arth_0488"
FT   CDS_pept        518998..519528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0488"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: lxx:Lxx09580 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01887"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS67"
FT                   /protein_id="ABK01887.1"
FT                   /translation="MPAATRPALSAEAQAELDQRLIRAAKANDAATVAELIRAGGNVNA
FT                   KDAIQDSAFLYAGAEGFNEILQLTLVAGADVRSTNRFGGTALIPASEHGHVDTVRILIA
FT                   AGVPVNHVNSLGWTAMQEAILLNSGGPRQQEVVRQLLDAGADPGIRDPLGRSALDNAER
FT                   LGFAEIAALIRAR"
FT   gene            complement(519550..520734)
FT                   /locus_tag="Arth_0489"
FT   CDS_pept        complement(519550..520734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0489"
FT                   /product="Thiolase"
FT                   /note="PFAM: Thiolase; KEGG: fra:Francci3_2502 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01888"
FT                   /db_xref="GOA:A0JS68"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS68"
FT                   /protein_id="ABK01888.1"
FT                   /translation="MSLREQFGKDVLLTGWGHSRFGKLTDDTLESLIVQVATEAIGNAG
FT                   IDPGQIDEIYLGQFNSGMMPLAFPSSLALQVSEQLANVPSTRVENACASGSAAFQQGTK
FT                   SLLAGTAKTVLVIGAEKMTHAGADVVGAALLGADYDMAGKASTTGFTGLFAEVAKHYEK
FT                   RYGPVSDVLGTIAAKNHRNGVDNPYAQLRKDLGEEFCRTVSDKNPMVADPLRRTDCSPV
FT                   SDGAAAVVLSVSPTGGATAPVRLAGIGHANDFFPAERRDPTAFAATRVSWQRALGMAGV
FT                   GLEDLDFAEVHDCFTIAELLMYEAMGLTEPGQGARAVEEGWVFKDGKLPINVSGGLKAK
FT                   GHPVGATGVSQHVIAAMQLTGTAGGMQLANPRRAAVQNMGGVGIANYVSVLEAV"
FT   gene            complement(520731..521435)
FT                   /locus_tag="Arth_0490"
FT   CDS_pept        complement(520731..521435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0490"
FT                   /product="butyryl-CoA:acetate CoA transferase"
FT                   /EC_number="2.8.3.8"
FT                   /note="KEGG: cef:CE1269 putative
FT                   succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B;
FT                   TIGRFAM: 3-oxoacid CoA-transferase, B subunit; PFAM:
FT                   coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01889"
FT                   /db_xref="GOA:A0JS69"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS69"
FT                   /protein_id="ABK01889.1"
FT                   /translation="MAWTRNEMAAIAAEELNDGDYVNLGIGIPTLVANNLPDGVRVVLQ
FT                   SENGLLGMGPFPYEGEEDADLINAGKQTVTVLPGGSIFDSAASFGMIRGGHVKVAILGA
FT                   MQVSGSGDLANWTIPGKMVKGMGGAMDLVAGTPRVVVLTEHNAKDGTAKIVKECTLPLT
FT                   GLSCVDRIISDLAVFDLEKTDDGGRRLTLTRLAPGVTAEEIRGKTEADFDVAPSLDATT
FT                   TIEASTLEGATA"
FT   gene            complement(521468..522208)
FT                   /locus_tag="Arth_0491"
FT   CDS_pept        complement(521468..522208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0491"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: rpb:RPB_1458 3-oxoacid CoA-transferase,
FT                   subunit A; TIGRFAM: 3-oxoacid CoA-transferase, A subunit;
FT                   PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01890"
FT                   /db_xref="GOA:A0JS70"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS70"
FT                   /protein_id="ABK01890.1"
FT                   /translation="MSKLKSGAAAALQDVLRDGMTLAVGGFGLSGIPADLIEAVRDSGV
FT                   KDLTVVSNNMGVDGKGLGILIEAGQVRKVIASYVGENKLFAEQYLAGNLEVEFTPQGTL
FT                   AERLRAGGAGIPAFYTKTGVGTLVAEGKPLAEFDGETYVQERAIKADVALVHAHTADTD
FT                   GNLIYRYTARNFNPVVATAGVITVAEAEVIVEPGQLDPNHIVTPGVFVQRLVRASGRVK
FT                   DIEQRTVRPRTEAAVTSDAVSVPA"
FT   gene            522285..523193
FT                   /locus_tag="Arth_0492"
FT   CDS_pept        522285..523193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0492"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: sme:SMc00263
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01891"
FT                   /db_xref="GOA:A0JS71"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS71"
FT                   /protein_id="ABK01891.1"
FT                   /translation="MGTVNGRFWREKRRFYSVDDRMASVHNMDELEDLTQSPRKKMASL
FT                   PVQGAQVVSRVASLLRIVGRKPEGSPLVELVRESGLTRPTVHRLLSSLASEGLLDQDPQ
FT                   SGNWVLGPEILLMGSVASARFPLEDIARPSLRRLAEETGESAFFSIRRGAETVCLLREE
FT                   GSFPVRSFVLHEGVRFPLGVASAGTAIMAFLPETEQEELLADWPDHAGSFAAGHTEALV
FT                   RESLAATRQAGYSVNPGLVLEGSWGMGAAVFDQRGRPAWALSLTGIEPRFKGERQETLG
FT                   RLLMEEAHRISTLLTRSPGGA"
FT   gene            523639..524595
FT                   /locus_tag="Arth_0493"
FT   CDS_pept        523639..524595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0493"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   hma:rrnAC1152 halocyanin precursor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01892"
FT                   /db_xref="GOA:A0JS72"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS72"
FT                   /protein_id="ABK01892.1"
FT                   /translation="MALQKESRRLVRALLAALISLLMPVALSGTAAADGGKSPRTWTVQ
FT                   VGSESSDQAIQGMSFLPENIYINAGDKITWKANAAEIHTVTFLAEGQSLESTQPFNPGN
FT                   PQYVEAQGGKSYDGKSYYNSGVMTNVSDSGFNEVGRYTLKFPDTGEFTYYCLVHGMAMK
FT                   GTVHVRDAGTEYPYTQSQYDRQSNKQERKILRDGYEQWDAARAKADNHTVIAGTDNETA
FT                   MLMRFVRSHIVVHVGDEVTFVNDGMGAPHTVTFGEEPADELAAVGDPADFTGGDLSSGL
FT                   MLPKSTFTVKFNKAGEFDYICALHDFMGMKGTVEVRD"
FT   sig_peptide     523639..523740
FT                   /locus_tag="Arth_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.886 at
FT                   residue 34"
FT   gene            complement(524769..525590)
FT                   /locus_tag="Arth_0494"
FT   CDS_pept        complement(524769..525590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0494"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD+ synthase; KEGG:
FT                   bld:BLi00370 NH3-dependent NAD+ synthetase; RBL02611"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01893"
FT                   /db_xref="GOA:A0JS73"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS73"
FT                   /protein_id="ABK01893.1"
FT                   /translation="MRELQARIIEEMGVQPRIDPAGEVRKRVTFLKEYLKATHTKGFVL
FT                   GISGGLDSSLAGRLAQLAVEELAAEGTEANFVAVRLPYGVQHDEDDAQAALDFIQAKTE
FT                   WTFNISAAVDGFEEEFEKTVGNGISDFHKGNTKARTRMIAQYALAGEHNYLVIGTDHGA
FT                   ESVTGFFTKYGDGGADILPLFGLNKRQNRALLAELGAPARIWEKVPTADLLDGKPGRTD
FT                   EEELGLSYDQIDDYLEGRDVPDAVAESIEQKYLRTRHKRTVPVTIFDTWWR"
FT   gene            complement(525655..526719)
FT                   /locus_tag="Arth_0495"
FT   CDS_pept        complement(525655..526719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0495"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: pac:PPA2330
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01894"
FT                   /db_xref="GOA:A0JS74"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS74"
FT                   /protein_id="ABK01894.1"
FT                   /translation="MSSAVVDAGDNGAEVRRPPAEKMPTIKDVAELAGVATSTVSRALS
FT                   KPDRVNRHTRERIEEAAARLNYVPSSQARGLSSGRTDTVAVLVPDITNPFYFDIIRGTQ
FT                   HQLKAAGLTQLLVDTEESSEMELEALHKMRRSADGFILAASRLTDAQLADVSGSQPLVT
FT                   INRASANAPTVVIDTPSAMIQALEHLASLGHHRICYVSGPPTSWSNLRRWKIFEEDSAH
FT                   RGLETHRIGPFTPKTTSGAAAADAAVRTGATACIVFNDLLAIGMLQRLRERGIRVPEDM
FT                   SIVGCDDIFGADFCNPPLTTISSPIEQAGRVAVSMLLSQLNPLHGGTTRRLAVMPTHLT
FT                   VRGSTGPAPEPGVR"
FT   gene            526933..528294
FT                   /locus_tag="Arth_0496"
FT   CDS_pept        526933..528294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0496"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: sma:SAV1804 putative secreted sugar binding
FT                   protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01895"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS75"
FT                   /protein_id="ABK01895.1"
FT                   /translation="MRFRSSSGLAAIVTAAALALTGCGAGAGTTGSSTNADGKVDGTGK
FT                   TLNVLVGVLSQYPEQQKKWQSDIAAKFKAETGADVKFETFASANDELTRIQTSVVSGQG
FT                   PDIYGLGTTFTPTAFATKAFVTLSDDDWKKVGGKDRFNPAALGISGPDEGHQAGIPFVS
FT                   RPFVMAYNKELLAAAGIEKPATSWDELAEQAKKMTKDGTFGIATGYKDSYDPWKFIWAM
FT                   SVQAGNPLVDGNSLKMDDPTVKKAYETYFGWLTDDKVVDPASVGWSNSNAVAAFASGKA
FT                   GYLMMTTSSSIPTLDKSAVAGKYEYALMPTTAPGESSPKSDGAEAASILSGDNLVVADY
FT                   SKEKDLAFAYIKLITSKEEQLNYQKTFGDLPANAEALASLTDPKLKPIADAAAKSKATP
FT                   FTGAWGDIQLGLLNVTVQSIPDLSSGRLDESALEARIKDAQTKGQASLDRAAKG"
FT   sig_peptide     526933..527016
FT                   /locus_tag="Arth_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.482 at
FT                   residue 28"
FT   gene            528301..529314
FT                   /locus_tag="Arth_0497"
FT   CDS_pept        528301..529314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0497"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sco:SCO6602 putative
FT                   transmembrane sugar transport protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01896"
FT                   /db_xref="GOA:A0JS76"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS76"
FT                   /protein_id="ABK01896.1"
FT                   /translation="MSTDASNEVRVAADSAATRASRAASSVAGPPPAGESKGRRKGLSE
FT                   RNRPLWMLIPGGALMFIIIVVPLVLGIYMSTLNLDQYTLRRWISSPFIGVENFVEALTS
FT                   SPLLHATWLSVSYSLLAMVVTLPLGIAAAVATQNAFRGRAVVRSIFLIPYVLPSFVVAT
FT                   IWRTMFQPDGIVDKALGTVGIETGLWLNGPQTFWTLVLVQIWASWPFIYLLALSGLQSV
FT                   DHEVHEASALDGALWWNKLRYVIFPYLKGPLALAFLIGMLHHINNFTLPFVLFGVPAPA
FT                   DVEVLPILTYVTSFQSFRFGLSAAMAFVSLVLIAIPLFVYLRAVKLDDAESPGAKK"
FT   gene            529311..530234
FT                   /locus_tag="Arth_0498"
FT   CDS_pept        529311..530234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0498"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sma:SAV1802 putative
FT                   transmembrane sugar transport protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01897"
FT                   /db_xref="GOA:A0JS77"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS77"
FT                   /protein_id="ABK01897.1"
FT                   /translation="MSTSTASRARTSSTAVLRPGSSRQHEVTRLLPRPLLAFILVFLGA
FT                   LVLIPVLYIFLASVNSDIGVANGEFWPSSFTLENYSKIWTSVGLATGLANSVLVAGATA
FT                   VVSAAMSVSTAFVLVRYTFRGRLTILRGLLALQSVPGTLMVLPVFVLFSSAATYLGIQV
FT                   IGTQWGLFVTYLTFAMPFSTWVMVTYLRGLPRELEEAARIDGASNLGVLFRIILPLSWP
FT                   GIVVSGIFAFLLGWNDVLFASVMTRPESQTAAVALQIFGASQEGGAIPYYGQMMAAALV
FT                   CAAPVVILYLIFQRYLVGGLTAGGVK"
FT   gene            530237..531085
FT                   /locus_tag="Arth_0499"
FT   CDS_pept        530237..531085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0499"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: cgb:cg2822 sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01898"
FT                   /db_xref="GOA:A0JS78"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS78"
FT                   /protein_id="ABK01898.1"
FT                   /translation="MVSTTQASWALSGFGDEIDDDPAIQIAVLQALGANHIEVRSAWGT
FT                   NIVDLSDDQLHGLADMLTAKGMKVSAIASPIGKVDVSVPVEHEVERLRRAANAAKVLDA
FT                   KYIRIFSFYYGESVPVDSIRDAVLERMRALADVAEEEGVILLHENEKDIFGDVPDRVLD
FT                   IIESVNSPALKVAWDAANFVQVGVKPFDEAYKKLRPHLEYLQVKDALFSNGHVVPAGEG
FT                   DGDVLRTVEALKADGFNGFASLEPHLAGAHGLGGFSGPTAFGIAARAFAKVTAEAGVQT
FT                   V"
FT   gene            531082..532248
FT                   /locus_tag="Arth_0500"
FT   CDS_pept        531082..532248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0500"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; homoserine dehydrogenase, NAD-binding;
FT                   KEGG: lxx:Lxx17360 lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01899"
FT                   /db_xref="GOA:A0JS79"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS79"
FT                   /protein_id="ABK01899.1"
FT                   /translation="MSKTLKVAITGCGVIGRTHAVALQEFPGTSIVALVDAIPDAAESL
FT                   ADFIESSGRPRPSVHTSLESAFAAADIDLVALATPSGLHIQQGLEVLAAGKHVVIEKPL
FT                   DVDLSRAQEIEAAANEAARQGIVASVISQHRFDQASVAVADAVAKGRFGRLTSAIASVA
FT                   WWRGQGYYDSGDWRGTWSMDGGGALMNQGVHTVDLLLWFMGRPVEIHAHTARLAHERIE
FT                   VEDTAVATVTFENGGLAVLHATTAAYPGLTVRVQLMGSEGSAVVDNDQLQYFHARDAGG
FT                   ASADMGLQGGGNQAQEELSKYPAEDYEAKDPTVYPAGHVRQYRDILGAIAEGRQPGVTV
FT                   SDAVNALATVRAVYVSATLNQAVLFEDVLAGKYNDLEVRTGSTSTESA"
FT   sig_peptide     531082..531144
FT                   /locus_tag="Arth_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.468 at
FT                   residue 21"
FT   gene            532253..533158
FT                   /locus_tag="Arth_0501"
FT   CDS_pept        532253..533158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0501"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: lxx:Lxx17340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01900"
FT                   /db_xref="GOA:A0JS80"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS80"
FT                   /protein_id="ABK01900.1"
FT                   /translation="MKFSVFTASTPDWTPEEAVTNLAAQGWDGIEWRITDQAEAPEPGF
FT                   WAGNKATIPLTGLEGNLQRIASITRDAGLEFSGIGGYARCDNHDDVERMLAATAALGAG
FT                   QVRVTTLPLGSAGWGNEEPSGIPYPVLFEAARRDFEWVAERAAHHGVKALVELHHRTIT
FT                   ASASSARRLLEGLDPRHVGVIHDLGNLLIEGQEDYLPAFELLGDYLAHIHVKNAVWVRR
FT                   DERDASGAAVFQNEWAPLQSGQGSVLEYFKALAAHGYDGWVTVEDFSTELPLAERTAGN
FT                   LDYLRRTAALAGLTAGAGAR"
FT   gene            533163..534566
FT                   /locus_tag="Arth_0502"
FT   CDS_pept        533163..534566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0502"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="PFAM: Glucuronate isomerase; KEGG: cef:CE2377
FT                   putative uronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01901"
FT                   /db_xref="GOA:A0JS81"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS81"
FT                   /protein_id="ABK01901.1"
FT                   /translation="MVHSMAAHPDRLLPAEPGVRDIARSLYNLVEGLPIISPHGHVDAA
FT                   VIEQNLPFPDPAALLVTPDHYVTRLIHAGGVPMDQLGLGETAADSRQVWRNFCAAWPDF
FT                   EGTASGYWIRQEFEHVFGLHEEPTVENADRIFDAVSAKLSEPGFRPRQLFKEFNIEVLA
FT                   TTDDPLDSLDSHAALAADPAFAGRVLPTFRPDPYLNIAHPEWRDNVERLIGVGGSGASG
FT                   YAGYIGALESRRRHFVENGAVSADHGVRTPATLKLDAADAERLFERARAGKASPEDREA
FT                   FEAHMMYQMARMSVEDGLVMTIHPGSYRNHHGPTFEAFGADTGHDIPFAVNYTEAIRPL
FT                   LQDFGTAKDFHLVLFTLDETVFSRELAPLAGFYPSVYIGAPWWFLDAPDAMLRFRAAIT
FT                   ETAGFSRSSGFIDDTRAFCSIPARHDTSRRIESSFLARLVAEHRISEERARELIVDIVD
FT                   SSPRRVFKL"
FT   gene            534563..536011
FT                   /locus_tag="Arth_0503"
FT   CDS_pept        534563..536011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0503"
FT                   /product="Mannitol dehydrogenase"
FT                   /note="PFAM: Mannitol dehydrogenase, C-terminal domain;
FT                   Mannitol dehydrogenase rossman, N-terminal domain; KEGG:
FT                   cef:CE2378 putative D-mannonate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01902"
FT                   /db_xref="GOA:A0JS82"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS82"
FT                   /protein_id="ABK01902.1"
FT                   /translation="MSANQAPVLNRALMPLPKAPVRIVHLGLGAFHRSHEAWYTQHAGD
FT                   GAEWGIAAFTGRRPDAARALAAQDGLFTLIERSGDGDSFEVIGSITEAVDGADLGRLRE
FT                   LVSAPATAMVTLTITEAAYGLAPDGSFHAGAPEIAEDLAMLAHVAGTGGKPRTPLGRLV
FT                   SALAGRRDAGSGPIAVVSCDNLSGNGDVARRAVTGMAEAWDSELALWIGENVSFVSTSV
FT                   DRITPRTTDADIAEVEQACGYRDSTPVVAEPFRDWVISGDFPKGRPRWEDAGAVVVDDI
FT                   EPYENRKLWLLNGAHSLLAYSGQLRGHTTVAQALEDPACRDAVEAFWDEAAAHLRGDDL
FT                   HIPEYRDALRGRFGNGRIAHHLSQIAADGTTKLRMRALPVLAAERSEGRSGAGSALMLA
FT                   AWIDFVAVHKELQDPMSDAIGTANGARGPERVASLLNLISPQLGGDPQIVALVAGLSGT
FT                   FSTDTGQTSSETATLAHLIPGRNS"
FT   gene            536017..537246
FT                   /locus_tag="Arth_0504"
FT   CDS_pept        536017..537246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0504"
FT                   /product="D-mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: sco:SCO7629 probable starvation sensing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01903"
FT                   /db_xref="GOA:A0JS83"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS83"
FT                   /protein_id="ABK01903.1"
FT                   /translation="MKIIAAEVFVTSPSRNFVTLRITTEDGVTGIGDATLNGRELAVAA
FT                   YLKEHVAQLLIGKDPHRIEDTWQFLYRSSYWRRGPVTMAAIAAVDMALWDIKGKVAGLP
FT                   VYQLLGGASRNGLRAYGHASGSDIPSLFDSVREHLELGYKSIRIQTAVPGIKAVYGVAA
FT                   QAQASGERYDYEPAGRGTFPLEEDWDTRAYLRHLPTVFEAVRNEFGPEIPLLHDGHHRM
FT                   TPIQAAKLGKALEPYDLFWLEDCTPAENQEGLRLVRQHTTTPLAIGEVFNTVYDFQTLI
FT                   KEQLIDYVRAASTHFGGISPLKKVMDFAAQYQIKSGFHGPTDISPVGFAAQLHVGLAIH
FT                   NYGIQEYMQHSDKTNEVFEQSMTFVDGYLHPGDKPGIGVEFNAEAAAAYPYQQAYLPYN
FT                   RLVDGTVHDW"
FT   gene            537257..539596
FT                   /locus_tag="Arth_0505"
FT   CDS_pept        537257..539596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0505"
FT                   /product="gluconate kinase, SKI family"
FT                   /EC_number="2.7.1.12"
FT                   /note="TIGRFAM: carbohydrate kinase, thermoresistant
FT                   glucokinase family; PFAM: shikimate kinase; glycoside
FT                   hydrolase, family 3 domain protein; KEGG: cpe:CPE0154
FT                   probable beta-hexosamidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01904"
FT                   /db_xref="GOA:A0JS84"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS84"
FT                   /protein_id="ABK01904.1"
FT                   /translation="MTAHRTAKHRIIVMGVSGCGKTTIGDLVARELGVPFLDGDSLHPV
FT                   ENVAKMAAGMPLTDEDRWPWLATVGAELAEAGDGGLVLACSALRRSYRDAIREQAPDTV
FT                   FLHLHGSKEVLRARTEGRTGHFMPPALLDSQLATLEPLDADEAGIVVDIAAPVDQVVAE
FT                   ALAGIAAGNAGAVGTTAVARSTTAGTREGAARTQPRQFDVDLQAAPFNLDDDAVAWVDS
FT                   TIAGMSLEEKIGQLFINHNNDYSPEYLDSVLENYHVGGMRYRPGPSAAVQEHIRYAQSR
FT                   TRIPLLVASNPEMGGAGSCDDGTFVSTHLQAGSHPDKAIARQMGQVAGVETAALGCNWA
FT                   FAPIVDIHYNWRNTVISTRSFGNTPEIVVERAQEYFDGISESPTACAMKHFPGDGIDER
FT                   DQHVVTSYNTLGYEDWNRSYGHVYREMIGHGVQSIMIGHIGAPELSRHFRPGMADADIL
FT                   PATLSPELLQDLLRGELGFNGLILTDASQMIGLTQAMKRKDLVPATIAAGCDMFLFFRN
FT                   PAEDFGYMMDGYKSGVITEQRLHDALRRILALKASLGLHRKARHELVPPAEALAVIGSD
FT                   AHRAIAAEIADKTVTLVKDTAHNLPITPVTHKRIRLYGISGSADFTRADPLAYLDTVKE
FT                   ELETAGFEVHLFKTADQREAAGETGVNFMSVISEEATGDYADKYDAAFVFANVKGFAQE
FT                   AAIRIKWSTPMAAEIPWYVTEVPTVFVSLNQPNHLIDVPMVKTAIHAHTGTREAIRATI
FT                   EKIMGSSEFQGTFNENVFCDSFDTRL"
FT   gene            539677..540939
FT                   /locus_tag="Arth_0506"
FT   CDS_pept        539677..540939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0506"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG: mtc:MT1794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01905"
FT                   /db_xref="GOA:A0JS85"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS85"
FT                   /protein_id="ABK01905.1"
FT                   /translation="MERTGCAVVGGGPAGMMLGLLLARAGVEVTVLEKHGDFLRDFRGD
FT                   TVHASTIRLIDELGLGDGFRRLPQSKLNNVAFPIPGVGLVTLGDFATLKPPYNYIAMMP
FT                   QWDFLNFLATEAASEPTFTLLMEHEATSLMFDGGRVTGVRYRTRGGSKGQGTEGALHAD
FT                   LVVATDGRHSVLRRAAGLQPKDYPVPFDTWWFKLPRHASEKGAVAGIVPAFRDREAMIA
FT                   LFRDDYYQMGYLGPKGADARIRSEGVERFRERVASLRPDLADRVDSIRSLDDLHWLDVR
FT                   LDRLRRWYVDGMLCIGDAAHAMSPAGGVGINLAIQDAVAAAALLAPALIRGNVSVKDLA
FT                   GVERRRRMPTVIIQTVQRVMHRAVFVPLFAGRRTGAPPVLLFFVRHAPVVRRLLPRLIA
FT                   FGPRPEHAPAFARRAQPRAAR"
FT   gene            complement(540918..541160)
FT                   /locus_tag="Arth_0507"
FT   CDS_pept        complement(540918..541160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0507"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="KEGG: dar:Daro_2709 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01906"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS86"
FT                   /protein_id="ABK01906.1"
FT                   /translation="MNEQDARQAVQTAISQVAPDVDFDGLDEGSRLRQDLELDSLDFLR
FT                   LVESINEATGVDIPERDYTAVATVKGMIDYLAARG"
FT   gene            complement(541157..542590)
FT                   /locus_tag="Arth_0508"
FT   CDS_pept        complement(541157..542590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0508"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein; KEGG:
FT                   rfr:Rfer_0385 catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01907"
FT                   /db_xref="GOA:A0JS87"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS87"
FT                   /protein_id="ABK01907.1"
FT                   /translation="MPSLGADMEHGKMVEWLIKPGDYVHRGDVVAVVDTDKTVMDVESF
FT                   EEGVVAELLVDVGTTVPIGTPLARITRTPDDGAGQAGGRPAGPHAKPASGAAETAVAAA
FT                   AAEPAGAAAAAAAVQVPPPVRHLAHQLGVDTAGIRGTGRHGAVTRADVEHAAAARPGPA
FT                   APAAPAATPAPMPHGARVRSSPRARRLADQLGVDIGGVPGTGPDGAVTEADVQRAVSGH
FT                   TAAAPAEEALPEEATVPGAEALPPKEAPPSEAQDRLSSLRRAIGSLMTRSKKSIPHYYV
FT                   STTLDLRAAIAWMQQVNEQRPVASRLVPSALLLKATALAAKEVPEVNGFFTDGVFRPSS
FT                   SVHLGVAVALRHGGLVAPAIHDADTLAVDVLMQQLRDLVSRARAGRLQRAEMADPTLTV
FT                   TNLGDLGVEAVYGVIYPPQVAMVGLGKLVEQPWAHDGMLGVRPAVTATLSADHRVSDGL
FT                   RGGRFLARIDELLQKPEEL"
FT   gene            complement(542598..543578)
FT                   /locus_tag="Arth_0509"
FT   CDS_pept        complement(542598..543578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0509"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein; KEGG: dps:DPPB39 probable pyruvate
FT                   dehydrogenase, E1 component, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01908"
FT                   /db_xref="GOA:A0JS88"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS88"
FT                   /protein_id="ABK01908.1"
FT                   /translation="MKTTYREAMRAAIRDAIQRDERVFLMGEDVGAYGGCFAVSLGLFE
FT                   EFGPERIRDTPLSEAGFVGAGIGAALGGMRPIVEIMTVNFSLLALDQLVNNAATLLHMS
FT                   GGQFNVPLVIRMTTGAGRQLGAQHSHSLEGWLAHIPGLRILTPATLEDARGMLWTALQD
FT                   PDPVLIFEHGTLYNVAGDLADDAGPVDISTAAVRRPGADISLITYGGTLPAVLDAATQL
FT                   AGEGIDAEVLDLRVLRPLDDAAVLGSVAKTHRAVVVDEGWRSGSISAELSARITENAFF
FT                   DLDAPVGRVCSAEVPLPYAKHLELAALPTTERIVAAAREAVGARG"
FT   gene            complement(543575..544576)
FT                   /locus_tag="Arth_0510"
FT   CDS_pept        complement(543575..544576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0510"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase, E1 component; KEGG: dps:DP2096
FT                   probable pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01909"
FT                   /db_xref="GOA:A0JS89"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS89"
FT                   /protein_id="ABK01909.1"
FT                   /translation="MTGTSARGTGNADSDHARHLLRQMLRVRRLEEQCVELYSAAKIRG
FT                   FLHVYIGEEAVAAGVMSTLAPDDAVVATYREHGHALLRGVPAGAILAEMYGHVEGCCRG
FT                   RGGSMHLFDAGTRFYGGNAIVAGGLPLAVGLALADKMSGRSRVTVCFFGEGAVAEGAFH
FT                   ESLNLAALWQLPVLFCCENNLYAMGTALARSESQTDIALKAAGYEIASWSADGMDVIAV
FT                   EEAARRAVDAVRAGGGPHFLELRTYRFRAHSMFDPERYRDKAEVSRWMERDPIDTLRTA
FT                   LEAAGQLSAKDWKSIQQDVDTEVDAAVEFAEAGTPEPLEDLTRFVYSERSPE"
FT   gene            complement(544573..546396)
FT                   /locus_tag="Arth_0511"
FT   CDS_pept        complement(544573..546396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0511"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pol:Bpro_0761 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01910"
FT                   /db_xref="GOA:A0JS90"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS90"
FT                   /protein_id="ABK01910.1"
FT                   /translation="MTAGTAPSTRWPAIPKDISGLAVRPNMVDYDASRAAFSWDEARHA
FT                   LAGLPDGGVNIAYEAVDRHAAGERAGHEALRFIRSDGTARSLSYAELAEQTGRFAGVLH
FT                   RLGIGRGERVFSLMGRSPELYVAVLGTLKNASVFCPLFSAFGPEPVRQRLHLGSGRALV
FT                   TTRALYRRKVAQIRDELPELEFVLLIDAEGRPDPGTLDLAELMRDAQPRETVPTRAEEM
FT                   ALLHFTSGTTGTPKGAIHVHDAVTAHHATGFFALDLHADDVYWCTADPGWVTGTSYGVI
FT                   APLTHGVTTIVDEEEMDAERWYRILAEQHVTVWYTAPTALRMLMKAGAGHAAGHDLSAL
FT                   RFVASVGEPLNPEVVVWGQEAFGQPVHDNWWQTETGGIMISNYPAMEIRPGSMGRPLPG
FT                   VEAAIVARDPDGKAVILNGEAVLVTEPEGVGELALRPGWPSMFRGYLHEDERYLRCFAG
FT                   GWYLTGDLARMDADGYFWFVGRGDDVIKSSGHLIGPFEVESSLMEHEAVAEAGVIGVPD
FT                   PVAGEVVKAFVELRTGWQPSESLKLDIIGFARKRLGPAVAPRLLDFTDALPKTRSGKIL
FT                   RRLLKARELGLPEGDTSTIESPPGRYPGAPV"
FT   gene            546545..547129
FT                   /locus_tag="Arth_0512"
FT   CDS_pept        546545..547129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0512"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: sma:SAV4522 putative orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01911"
FT                   /db_xref="GOA:A0JS91"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS91"
FT                   /protein_id="ABK01911.1"
FT                   /translation="MTASSAPAADAAAARARLLELIKELAVVRGKVILSSGAEADYYID
FT                   LRRITLHHEASKLVGQVMLSLIDEAGIDFECAGGLTMGADPVGTAVMHAAGDAGRSVDA
FT                   FVVRKAQKSYGMGRQVEGPSVEGRKVLVLEDTSTTGGSALTAVEGVRKAGGNVVAVAVI
FT                   VDRDTGAKEKIEAETGVPYLFAFGKDELGLS"
FT   gene            547253..548035
FT                   /locus_tag="Arth_0513"
FT   CDS_pept        547253..548035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0513"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: sco:SCO4029
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01912"
FT                   /db_xref="GOA:A0JS92"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS92"
FT                   /protein_id="ABK01912.1"
FT                   /translation="MLPSNPVPTTVDQIQNLILESADFEDFLNELARFSAHQMAGDGDD
FT                   ALCGITLLRDRKAATIGWSSDSAREVDEIQYRLSQGPCLTAAQEEREVHVPDLFEEDRW
FT                   GPDYANAVASHGLRSVLSLPFTLQGDAKAALNLYSDVPRKFDERAAARAREYTREISQA
FT                   LRLAVRFSLHTDSATNLRATLESRTTIDIAIGIVMAQNRCSQEAAVQILTDASSNSNVK
FT                   LRDIAKSLVDSVGGAGTRTHFEEPGQGQDRGQGRSQAG"
FT   gene            548565..549875
FT                   /locus_tag="Arth_0514"
FT   CDS_pept        548565..549875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0514"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01913"
FT                   /db_xref="GOA:A0JS93"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS93"
FT                   /protein_id="ABK01913.1"
FT                   /translation="MRTPGPVFRRRAPGSQRLRLRSPGRSRRDFRYGAAGAVRRDRDGA
FT                   FTAGKRRSWPEQLNGRTGGASGRARDLAGFAGFIYGFRCGYGRGVPRVQDPSQSEGGPG
FT                   SAEGRLLKHAAELKRFSRRNFLMGTGAASLLAADMFFTRYVQAERRTNKILTVGDDFAE
FT                   SYYPHSSWILFPGYKTSWEEAQWILNSLRGALRQRGQLAAVGYSNEGLDIDQIVIAVIG
FT                   YVRAKKLTSLYFYGHSFGGMVATQVAARLRELHGVEVEFILLDSSPYSKFDVLDQSWFE
FT                   GVVVLYEGGFRVPTVLRGGYELGERIVHKDERSWRQVLDQSLEQLSPIAPSSVLIQSES
FT                   AYIYHFDATRFAGMLGGTRMAFIGNPRDGTVNYETARQSWAQTFAANMVSNDRRTEDAL
FT                   PAHASPQWNPFVYRPIIEELQDEIFPLPSGGHRMTAF"
FT   gene            complement(549897..550727)
FT                   /locus_tag="Arth_0515"
FT   CDS_pept        complement(549897..550727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0515"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   pac:PPA1954 predicted sugar phosphatase/hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01914"
FT                   /db_xref="GOA:A0JS94"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS94"
FT                   /protein_id="ABK01914.1"
FT                   /translation="MAESDEVRSSAAVYRSGQEIECWLTDMDGVLVHENQPIPGAAELI
FT                   QRWVDTSKRFLVLTNNSIFTPRDLAARLRSSGLEIPEENIWTSALATAQFLKDQVRGSD
FT                   SGNRAYTIGEAGLTTALHEAGFILTDQNPDFVVLGETRTYSFEAITMAIRLILAGARFI
FT                   ATNPDATGPSKDGPMPATGAIAALITKATGREPYIVGKPNPMMFRSAMNQIDAHSETTA
FT                   MIGDRMDTDIIAGMEAGLHTVLVLSGITHKDDIAAYPFRPNQILNSVADLKSQI"
FT   gene            550922..552037
FT                   /locus_tag="Arth_0516"
FT   CDS_pept        550922..552037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01915"
FT                   /db_xref="GOA:A0JS95"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS95"
FT                   /protein_id="ABK01915.1"
FT                   /translation="MRRQIPAAGHQQASREPQDARKHLKGPTMSNNYSAPPPGENRAGD
FT                   TESYPEVPRPPQGRQAPPYPPQQFQQHPYAAQPHTAQPQRNNKNLIIVLAAVAAAVIVA
FT                   LVAVFVWVIPAFSKPQAEGNPAPAATSSEAASSEAAGESPAPEESAAPSADPGSDGMPA
FT                   GAFPLPAGWAELQGPAKIPADDDPLYNRFVTGESSFSYLSAWSSDDTFGITKDPSTGAP
FT                   MQQVAKGTEERDGDGISTAFAFFAEAEEGKYGKEPAKVQAAIKDIEAKLKAIPAAELPQ
FT                   HLVGHKCAGGFEASTPEIREFRRAAAVVVGFTCTNAGGDAIRAVNLFTVTPWGTPQMVG
FT                   VSGHESYWSANPEALEKIGNSYRANRWKLDG"
FT   gene            552108..552782
FT                   /locus_tag="Arth_0517"
FT   CDS_pept        552108..552782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0517"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   tfu:Tfu_2449 tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01916"
FT                   /db_xref="GOA:A0JS96"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS96"
FT                   /protein_id="ABK01916.1"
FT                   /translation="MTDHPQTPALPVPPPGEEPEPKAEVGVGPWEGEFPEGEHWDPDLL
FT                   ADGDRRNVVDKYRYWKHEAIVADLDSKRHDFHIAIENWQHDLNIGTVVRTANAFLAKEV
FT                   HIIGRRRWNRRGAMVTDRYQHVRHHPTVEDFVAWAQGEGLAIIGIDIFPDSVPLETYDL
FT                   PKNCVLVFGQEGPGLTPEVHEAAVDTLSIEQFGSTRSINAASAAAIAMHAWIRRHVFSQ
FT                   HV"
FT   gene            552991..554010
FT                   /locus_tag="Arth_0518"
FT   CDS_pept        552991..554010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0518"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: pac:PPA2011 fructose-bisphosphate aldolase;
FT                   TIGRFAM: ketose-bisphosphate aldolases;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01917"
FT                   /db_xref="GOA:A0JS97"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS97"
FT                   /protein_id="ABK01917.1"
FT                   /translation="MPIATPEIYSEMIDRAKAGGFAFPAVNVTSSQTLNAALRGFAEAE
FT                   SDGIVQVSTGGAAYWSGASTKDMVAGSLGFAAFAREVAKNYGVNIALHTDHCPKDKLDG
FT                   FVLPLLAASEAEVKAGRNPIFNSHMWDGSAETLQENLRIARELLERTAAAKMILEVEIG
FT                   TVGGEEDGVENEINEKLYTTVEDALVTIEALGAGENGRYITALTFGNVHGVYKPGGVKL
FT                   RPEILKDIQAQVGAKIGKESPFDLVFHGGSGSSDQEIADAVSYGTIKMNIDTDTQYAYT
FT                   RPVADHMFKNYDGVLKVDGEVGNKKTYDPRVWGASAEAGLAARVVEATKQLGSAGKTF"
FT   gene            554013..554435
FT                   /locus_tag="Arth_0519"
FT   CDS_pept        554013..554435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01918"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS98"
FT                   /protein_id="ABK01918.1"
FT                   /translation="MSDEFRRNLMGPEPTLLPAESEIYQHLALGQEALDLVAKHPTSSL
FT                   LWAILAEEAWNEGRIVDSYAYARVGYHRGLDSLRRNGWRGVGPIPWEHEPNRGFLRALY
FT                   ALGRASSAIGEAEEPERIEKFLNDSDPTAKAAIEGT"
FT   gene            complement(554504..555136)
FT                   /locus_tag="Arth_0520"
FT   CDS_pept        complement(554504..555136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa27340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01919"
FT                   /db_xref="UniProtKB/TrEMBL:A0JS99"
FT                   /protein_id="ABK01919.1"
FT                   /translation="MTALATESFREQLLSRRYEPNVAVVNELCDTFQSLKPDTVVPYVD
FT                   PMHDVDECRIISLYSNIGTADESGFITAGDSEAATRMLGVQWKLGLRPEFVMPWNVHPW
FT                   HIPGEPNGKFTPDQISAGLKPLLKFLALVPRASVIVAHGTEANRLAQLLLKTEVPLLWR
FT                   RGLKTYKVRSLSGRAFAGTEARQQQYLDEMHVVYADAMARTGLTKAN"
FT   gene            complement(555343..556428)
FT                   /locus_tag="Arth_0521"
FT   CDS_pept        complement(555343..556428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0521"
FT                   /product="Methionine synthase, vitamin-B12 independent"
FT                   /note="PFAM: Methionine synthase, vitamin-B12 independent;
FT                   KEGG: cef:CE2028 putative epoxyalkane:coenzyme M
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01920"
FT                   /db_xref="GOA:A0JSA0"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA0"
FT                   /protein_id="ABK01920.1"
FT                   /translation="MVDVVQRQKDVGIDIPNDGEYGHAMASSVDYGAWWNYSFSRLGGL
FT                   EPTNVDRWADAEVHRSSPGNIVLTSFPDRRDRQKFNDAYNDPSSGILAHRKSVAQPKIA
FT                   GPLTYTGHDLVAPDITNLKTGLAAAGLAEGFVASLSPGSCARVANEYYASDEELVYACA
FT                   DAMREEYKAIIDAGLTVQLDDPSLAESWDQINPEPSLADYLKFIQLRVEATNWALRDLP
FT                   QDQIRLHVCWGSWHGPHTTDIPFADIIGSVLQVNAGAYSFEAANVRHEHEWRVWEDTRL
FT                   PEGKVIIPGVVSHATNVVEHPDLVADRIVKFAELVGRENVIASTDCGLGAASTRRLPWP
FT                   NWSPWAKVHAAPPSGCGDGLG"
FT   gene            556767..558056
FT                   /locus_tag="Arth_0522"
FT   CDS_pept        556767..558056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0522"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG: cgb:cg3063
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01921"
FT                   /db_xref="GOA:A0JSA1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JSA1"
FT                   /protein_id="ABK01921.1"
FT                   /translation="MPAIVIVGAQWGDEGKGKATDLLGGRVDYVVKPNGGNNAGHTVVV
FT                   GGEKYELKLLPAGILSPNAVPIIGNGCVVNLEALFQEIDGLEARGADTSKLRVSANAHL
FT                   VAPYHQVLDKVTERFLGSRAIGTTGRGIGPAYMDKVARLGIRVQDVFDASILRQKVEGS
FT                   LRQKNELLVKVYNRRDIEVDEIVDYFLSFAERLRPLVIDSTYVLNTALDEGKVVLMEGG
FT                   QATFLDVDHGTYPFVTSSNPTAGGASVGSGIGPTRISRSIGIIKAYTTRVGAGPFPTEL
FT                   FDEMGMYLQKTGGEFGVNTGRPRRCGWYDAVLARHASRVNGFTDYFVTKLDVLTGIEQI
FT                   PVCVAYDVDGVRHDEMPMTQTEFHHAKPIFEYFEGWTEDITGARTLEDLPENAKNYVLA
FT                   LEKLSGTRFSAIGVGPDRDQTIVVNDLIND"
FT   gene            complement(558137..558349)
FT                   /locus_tag="Arth_0523"
FT   CDS_pept        complement(558137..558349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01922"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA2"
FT                   /protein_id="ABK01922.1"
FT                   /translation="MSEEVMAVPAAGPAATPKHVTGLINSQGSAATRAMREQARRRRDA
FT                   EAKLQQHLLQTRSRQSPDQTVSIQH"
FT   gene            558603..559064
FT                   /locus_tag="Arth_0524"
FT   CDS_pept        558603..559064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0524"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01923"
FT                   /db_xref="GOA:A0JSA3"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA3"
FT                   /protein_id="ABK01923.1"
FT                   /translation="MGLSLKSGKNKTGPEPGLPERTAALEQGPRRYRARINRAPVLDPT
FT                   RVQELAGNIHAQSRLLEFLNLFLVLLPSRVNNVAGALASGDPQAASAAAQSLASSAAMA
FT                   GAARLELVALLVDSDLRIGRMDRARETGRRLGPDAAELASALSRLLTGR"
FT   gene            complement(559125..561356)
FT                   /locus_tag="Arth_0525"
FT   CDS_pept        complement(559125..561356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0525"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   fra:Francci3_0813 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01924"
FT                   /db_xref="GOA:A0JSA4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA4"
FT                   /protein_id="ABK01924.1"
FT                   /translation="MNPGLLKLAVVGSRSAYGRVAGIAGGVAVGVCLLLLLWGGANGLS
FT                   ARDDRGAWLRETGLPSVAAPLTDDPTASAPATPVPLTADTVLMEANAAEVFRDRLINRR
FT                   DVAALEATTVKIPGIGSPPEPGSYFASPALQRLIESTPRDELGDRFGTFAGTIDDAALP
FT                   GPDSLVIVTGAAEADLRQNGRAFLVSDFTTNPYGGSAAAYNTVLSIGAIAVFFPVLLLI
FT                   SIVTGLGAAQRRERFATLRLIGASPQAISGIAAVETAVPSLIGAVLGVVLAAVLRPAAA
FT                   QIPVNGSRMFAADLTTGWAATAAVVAVVVTASALVAAHRTAHAGIGPLGVTRAVHEKTP
FT                   TIWRSVPLLAGLAAMITAVLMIRVMAVRLPWLESPLLIGGFVLVLVGIVVIGPWLTRLV
FT                   SRLGLRRARSAAGVIAASRIQKTPVATFRSVSGLVIAVFVVSVFAGGSSIVESTQAPPA
FT                   RPGLLQPTSLHATVAAGHTPDQVADAVRAAGELPGIRNATIGYGPAALSERDAGPEIYL
FT                   RAADAPGLGFEDIPATETVAVDTSFLQYWTTQPVALTPAPAANLDGLIPVVIVLGTDGT
FT                   PEAMDRARTALNGSAVTAIPATARLDLQPQSSTRLIQGLAALAYLGMFVAIAIAGLSLA
FT                   VATASAILDRKRVLGLMRLMGMPVSVLRRIITREAAVPLLTVVLLSVGLGFLVAWLMVA
FT                   FIDDTYRVTWPAPEYFLALGLSLVLALGAVIATFSLIRGNTAVTATRFE"
FT   gene            complement(561353..562066)
FT                   /locus_tag="Arth_0526"
FT   CDS_pept        complement(561353..562066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0526"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fra:Francci3_0812 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01925"
FT                   /db_xref="GOA:A0JSA5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA5"
FT                   /protein_id="ABK01925.1"
FT                   /translation="MSTTGTASPILSARGLHHSFGQTKALRGIDLDVQRGEVLAVMGPS
FT                   GSGKSTLLHCLAGVLVPDGGSVTYRPSGRSPMETSALGEPKRTRLRLTDFGFVFQFGQL
FT                   LPELTAADNVSLPLLLAGTRRPEALRRSTELLERLGLDGMAARLPGELSGGQAQRVAVA
FT                   RAMVTSPAVLFADEPTGSLDSLASENVLTLMLELVREAGTTVVMITHDARTAAYADREV
FT                   IVRDGGIGAGYRVTA"
FT   gene            complement(562063..562590)
FT                   /locus_tag="Arth_0527"
FT   CDS_pept        complement(562063..562590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0527"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: fra:Francci3_0811 transcriptional regulator,
FT                   PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01926"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA6"
FT                   /protein_id="ABK01926.1"
FT                   /translation="MNKSLTLLGLLSRQPSYGYDLKHSYDRYFGTGKALAFGQVYSTLA
FT                   RMVRDELINALGGETGAGPDRKKYEITAAGQVKVHEWLFTPDVPSESLQSNLFAKTVIA
FT                   LLLEDDADRLLDVQRSEHMARMRELTRLKKDADLLQVLMCDHGLFHIEADLRWIDLTGA
FT                   RLAQLKKELQST"
FT   sig_peptide     complement(562534..562590)
FT                   /locus_tag="Arth_0527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.938 at
FT                   residue 19"
FT   gene            563054..563608
FT                   /locus_tag="Arth_0528"
FT   CDS_pept        563054..563608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0528"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   sco:SCO4866 ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01927"
FT                   /db_xref="GOA:A0JSA7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA7"
FT                   /protein_id="ABK01927.1"
FT                   /translation="MTEALTDASLMALKGRDGELFNLVYRSYASQVLGYLTARGVEDPE
FT                   ATMQDVFLAVLPRIATISGGASGLRTFLFSVAHARMVDDHRRQSRTPPKQPFEPDLDRR
FT                   EAASAEAGAMLLVAPGEVLELLDVLGEDQKEVLTLRIIADLTVEQVAEIMGKSAGAVKQ
FT                   LQRRALDRLREHSAVKDYVAP"
FT   gene            563605..564447
FT                   /locus_tag="Arth_0529"
FT   CDS_pept        563605..564447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cjk:jk0177 putative Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01928"
FT                   /db_xref="GOA:A0JSA8"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA8"
FT                   /protein_id="ABK01928.1"
FT                   /translation="MTNRDEVSAGTVDRLLLDSGHTDLPDLRAALLSIASLAQMQVPAP
FT                   GPELAAMLAGPRDELIRKRWLRRHRPTVVGLAVLTGMGLGVSGVAATSQGAAEGSGRWS
FT                   IQELTTDWAPDWKLPVGPGASNKGGPMAWKSPLFLQLDQAAPPGAVEPVDPVTPSEGRE
FT                   PSDNEVPATAPGSPASPAAKAPGRAPGADAANGQAGKPGGGTPGGNGGDAASEEHSRPV
FT                   APQKTGAPAEKAASEPEADSMGHHSGKPQKDESRAVSVDSALGSAVEPVNRWLKKFRP"
FT   gene            complement(564489..564983)
FT                   /locus_tag="Arth_0530"
FT   CDS_pept        complement(564489..564983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0530"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: mlo:mlr8464
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01929"
FT                   /db_xref="GOA:A0JSA9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSA9"
FT                   /protein_id="ABK01929.1"
FT                   /translation="MSVEDRTWESPSAPDRLNLLRQAKSLAIVGASDKPSRASYFVATY
FT                   LQSSTRYKVYFVNPVVKEILGQPTYASLADLPESPDIVDVFRKHDDLPGVLDEAIAAGA
FT                   KTLWLQLGSWHEDVAKEAEAAGLDVVMDRCVKIEHARFHGGLHLAGFDTGVISSKRQVL
FT                   A"
FT   gene            complement(564983..566317)
FT                   /locus_tag="Arth_0531"
FT   CDS_pept        complement(564983..566317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0531"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: mta:Moth_1309
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent enzymes;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01930"
FT                   /db_xref="GOA:A0JSB0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB0"
FT                   /protein_id="ABK01930.1"
FT                   /translation="MADRKFGFRTRALHAGGTPDAEHGARAVPIYQTTSFVFKDTQDAA
FT                   NLFALQKYGNIYSRIGNPTVAAFEERIASLEGGIGAVATSSGMAAEFITFAALTQAGDH
FT                   IVAASQLYGGTVTQLDVTLRRFGVDTTFVPGTDPADYAAAVRENTKAIFVEVVANPSSE
FT                   VQDLEGLAKVARDAGIPLVVDATLSTPYLVRPIEHGADIVIHSATKFLGGHGTTLGGVI
FT                   VESGRFNWGNGKFPTMTEPVASYGNVSWWGNFGEYGFLTKLRCEQLRDIGPALSPQSAF
FT                   QLLQGVETLPQRLDEHLKNAQAVAEWLEADERVAYVNFSGLPSHPHFERAQKYLPLGPG
FT                   SVFSFGVKGGRAAGQKFIEALQLASHLANVGDSRTLVIHPGSTTHQQLSPAQLESAGVP
FT                   EDLVRISIGLEDLEDILWDLDQALDAASTPVVELVEADTCTIGAN"
FT   gene            complement(566317..567528)
FT                   /locus_tag="Arth_0532"
FT   CDS_pept        complement(566317..567528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0532"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG: nfa:nfa54330
FT                   putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01931"
FT                   /db_xref="GOA:A0JSB1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024014"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB1"
FT                   /protein_id="ABK01931.1"
FT                   /translation="MNDISSVARLSEPLKFAYWVPNVSGGLVVSTIEQRTSWDFDYNKK
FT                   LARIAEDSGFEYALTQTRYAASYGADKQHEATSFSLALLAATERLKVISAVHPGMWHPG
FT                   VLAKYIITTDHISNGRAAVNIVSGWLKNEFTNFGLEWLEHDERYVRTEEFIRVLRGLWT
FT                   EQEYSQSGKYYNITDFTLNPAPVDVPGRAHPEIFFGGNSTAAQATAGRVADWYFSNGKD
FT                   LEGFKENIAGVVAAAGESGRGTDGSLPAPRFGLNGFVIARDSEKEARDTLREIVEKAHK
FT                   PAVEGFRAAVQEAGASTKDGKGMWADSSFEDLVQYNDGFKTQLIGTPEQIAERIVEYKK
FT                   IGVNLFLTGYLHFQEEVAAFGQDILPIVRELEADLARRNGTELDLSGTPVAADASKTTG
FT                   LVNA"
FT   gene            complement(567539..569551)
FT                   /locus_tag="Arth_0533"
FT   CDS_pept        complement(567539..569551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0533"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: tfu:Tfu_2856 acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01932"
FT                   /db_xref="GOA:A0JSB2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB2"
FT                   /protein_id="ABK01932.1"
FT                   /translation="MHGVPTDGPARHRSITNVAFWEEQALRLDWAEPSGGAPTGNNGGK
FT                   PWHTAHRRVPADVETGTGPEITWFEGGRLNVAYNCVDRHVAAGRGDKVALHFEGEPGDR
FT                   RAITYAELQREVSKAANALLALGITKGDRVVIYLPVIPETVIITLAVARIGAIHSLVFG
FT                   GFSAEALKFRVEDTRAKLLVTTDGQFRRGVAVPVKDNADAAVAGDNAIEHVLVVNRTTP
FT                   ADQLATVPMTEGRDVWWHDAVGQASEVHEPEAFDAETPLFIMYTSGTTGKPKGLVHTSG
FT                   GYLTQASWSFEYLFSNPDPALRDQDVHWCTADLAWVTAHTYEIYGPLSNGATQVIFEGT
FT                   PNTPHPGRHFEIIERYGVTQYYTAPTLVRSFMGWFPDGVPDSYDLSSIRMLGTVGEAVN
FT                   PEAWRWLRQNIGAGTAPVVDTWWQSETGATILSPAPTDTEFKPGCAARPLPGVSTRIVD
FT                   DAGNTVPPGVQGFIVVDSPGPAIARTVWGNPQRYFDSYWRKYAEQGWFLAGDGAKYDDD
FT                   GDIWILGRVDDTLNVSGHLLSTIEIESALVSHPDVVEAGVCPVTDPKTGHAIVAFVVLK
FT                   GGVSAEVATELRDHVARAIGPIAKPRDVVVVPDVPKTRSGKIMRRLLTQLFEGTTLGDT
FT                   TSLQNEPAIAGIQEALAGYAASLIGQKQSPLNGQK"
FT   gene            570013..570438
FT                   /locus_tag="Arth_0534"
FT   CDS_pept        570013..570438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0534"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   fra:Francci3_3063 CoA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01933"
FT                   /db_xref="GOA:A0JSB3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB3"
FT                   /protein_id="ABK01933.1"
FT                   /translation="MSHVNDPAVIDRLMRTKGTWAIVGLTTNEWRSAYDVSLYIRDRMG
FT                   MEIIPVNLPGDDVHGEKGYRSLADIPAEKHPIDVVDCFVNSHRVGAVIDQAIAVGAKAV
FT                   WLQLGVFDDAAVERAKAAGLDVVVNSCPAREGWRVGI"
FT   gene            570477..570887
FT                   /locus_tag="Arth_0535"
FT   CDS_pept        570477..570887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0535"
FT                   /product="protein of unknown function DUF419"
FT                   /note="PFAM: protein of unknown function DUF419; KEGG:
FT                   sco:SCO2535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01934"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB4"
FT                   /protein_id="ABK01934.1"
FT                   /translation="MDVDTLREICLSFPGAFEDFPFGPETSVFKVRAAVAGGSRPDAKM
FT                   FAASAMDPADWSVSLKCEPALAEQLRAIHPEITGAWHMNKTHWNGVRLDGSLPDDMIRD
FT                   MVEDSYDLVVATMSRKQREQLEWAGLARGEGA"
FT   gene            570884..571429
FT                   /locus_tag="Arth_0536"
FT   CDS_pept        570884..571429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO5445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01935"
FT                   /db_xref="InterPro:IPR014457"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB5"
FT                   /protein_id="ABK01935.1"
FT                   /translation="MKSRVARGSLNYPGIGSTEHGRTPDGTPCVVTQAYLGEGAALYRR
FT                   VAHGILAWQLQKRSGLRVRADSDFVVPGARVVSGFGVGPFRISAPCEVVWVRRPVPGDG
FT                   PQSAGFGYGTLPGHPVRGEEAFEVELDSQGRVFLKITAFSRPANWFYAAGSAVAARAQR
FT                   HVTSRYIGSAHELAAGES"
FT   gene            571444..572073
FT                   /locus_tag="Arth_0537"
FT   CDS_pept        571444..572073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01936"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB6"
FT                   /protein_id="ABK01936.1"
FT                   /translation="MLEQKTLDELWNFDDPAGSEARFRTAAADDNYDADEQAEFATQVG
FT                   RAIGLQGRYEEADALLDAIDADEPTVAVRVLLERGRLLNSSGHAAMAVPLFEQAAELAD
FT                   HLSEEFLAVDALHMLAIADPEHAESWTRSALEYASTVHDPRTRRWMVSLHNNLGWTLHQ
FT                   GGRFTEALVEFQLAEQWAERVGTPQQQEWAREAIEECQHSLAAGRP"
FT   gene            572116..572436
FT                   /locus_tag="Arth_0538"
FT   CDS_pept        572116..572436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0538"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   mbo:Mb1148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01937"
FT                   /db_xref="GOA:A0JSB7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB7"
FT                   /protein_id="ABK01937.1"
FT                   /translation="MIFIVVKFKVKPDWSDKWLGLVEDFTQATRQEPGNLWFDWSRSVE
FT                   DPNEFVLVEAFKDDAAGDHVNSAHFQKAMADMPQALAETPRIISRQLDGDGWDRMGELT
FT                   IA"
FT   gene            572455..572748
FT                   /locus_tag="Arth_0539"
FT   CDS_pept        572455..572748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0539"
FT                   /product="protein of unknown function DUF503"
FT                   /note="PFAM: protein of unknown function DUF503; KEGG:
FT                   mpa:MAP1841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01938"
FT                   /db_xref="InterPro:IPR007546"
FT                   /db_xref="InterPro:IPR036746"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB8"
FT                   /protein_id="ABK01938.1"
FT                   /translation="MWIGWIEFDILLGDVHSLKEKRSVVRPLLAELKRRFEVSVAEVGD
FT                   HEQYRRTQLGAGLVAADRAHLVEVLTAVERFVANRPELELLSARQRELRSDD"
FT   gene            complement(572827..575145)
FT                   /locus_tag="Arth_0540"
FT   CDS_pept        complement(572827..575145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0540"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: sco:SCO4079 phosphoribosyl formylglycinamidine
FT                   synthase II; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01939"
FT                   /db_xref="GOA:A0JSB9"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSB9"
FT                   /protein_id="ABK01939.1"
FT                   /translation="MSTSAETVSKKFNIDTVENAAKTPDVELPWAELGLKQNEFDEVVK
FT                   VLGRRPTGAELAMYSVMWSEHCSYKSSKNHLRQFGDKVTDEMKKDMLVGIGENAGVTNL
FT                   GDGWAVTFKIESHNSPSFVEPYQGAATGIGGIVRDIISMGARPVAVMDPLRFGAIDHPD
FT                   TARVMHGAVAGIGGYGNSLGLPNIGGEMVFDSVYQGNPLVNALAVGVMRHEDIRLANAS
FT                   GKGNKVVLFGARTGGDGIGGASVLASESFDDTKPSKRPAVQVGDPFAEKVLIECCLELF
FT                   KGSLVEGIQDLGAAGISCATSELASNGDGGMEVELTSVLLRDPTLTPGEILMSESQERM
FT                   MAVVTPENVAAFEAVMDKWAVEYSWLGEVTDTGRLIITWEGEVIVDVDPRTVAHDGPVY
FT                   DRPFARPEWQDAVQADAFTGSVQDAGRPSAPKELAAAVTELISSPNMCDKSWITNQYDR
FT                   YVGGNTAMAFPDDAGVVRVDEETGLGVALATDANGRYTYLDPYHGAQLALAEAYRNVAT
FT                   SGAVPMAVSDCLNFGSPEDPDVMWQLAEAIRGLSDACMVLGIPVTGGNVSLYNQTGTTP
FT                   IHPSPVVAVLGKLDDVARRTPSGWKEDGQAIYLLGTTAAELDGSEWANMRGHLGGQPPK
FT                   VDLAAERALGEILINASRDGMVDSAHDLSEGGLAAALVESALRYGVGARIALQDVMDRD
FT                   GVDLFTALFSETQGRAIVGVPRSEEVRFTDMCTARGFAHTRIGVVDAASGQLEINGVDA
FT                   LSLEALREAHEATLPKYFG"
FT   gene            complement(575142..575927)
FT                   /locus_tag="Arth_0541"
FT   CDS_pept        complement(575142..575927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0541"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: sco:SCO4078 phosphoribosyl formylglycinamidine
FT                   synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01940"
FT                   /db_xref="GOA:A0JSC0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC0"
FT                   /protein_id="ABK01940.1"
FT                   /translation="MTELPLIGEAVAVAANPRLAGARIGVVTFPGTLDDRDAARAVRLA
FT                   GATPVELWHADTTLGDVDAVVIPGGFSYGDYLRAGAIARFAPLMAKIIDAANSDARLPV
FT                   LGICNGFQILTESHLLPGSMIKNDHLKFMCRDQVLRVENNTTAWTSDYAAGQEITIPLK
FT                   NQDGQYIADEKVLDALEAEGRVVFRYVGFNPNGSRRDIAGISNAAGNVVGLMPHPEHAV
FT                   EPGFGPETGLSGSAGVGGSDTDGLGFFTSVLNKIVGGAK"
FT   gene            complement(575929..576180)
FT                   /locus_tag="Arth_0542"
FT   CDS_pept        complement(575929..576180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0542"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: tfu:Tfu_0178 phosphoribosylformylglycinamidine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01941"
FT                   /db_xref="GOA:A0JSC1"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC1"
FT                   /protein_id="ABK01941.1"
FT                   /translation="MPRIVVDVMPKPEILDPQGKAIVGALPRLGFTAFSSVRQGKRFEL
FT                   TVDGEVTEEILAQARNAAETLLSNPVIEDVVNVEVVEA"
FT   gene            576730..579777
FT                   /locus_tag="Arth_0543"
FT   CDS_pept        576730..579777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0543"
FT                   /product="Exo-alpha-sialidase"
FT                   /EC_number="3.2.1.18"
FT                   /note="KEGG: pac:PPA1560 sialidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01942"
FT                   /db_xref="GOA:A0JSC2"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC2"
FT                   /protein_id="ABK01942.1"
FT                   /translation="MWDKSLCPTRFRTAALGRLPERTVDLKLKKREPAGRAGSVGRVAA
FT                   AGLLGMALIAGPGLPARAEPAPPSNPAAAPGTFAEANIAADRTAANFFYRIPALTYLGN
FT                   DVVLAAWDGRPGSSADAPNPNSIVQRRSIDGGATWGPLTVIAAGHVADASGPKYGFSDP
FT                   SYIYDAEANKVFALFVYSKDAGFSASTYGNDDADRNVISSAVVESADEGRTWSQPRFIT
FT                   SVTKPGSSKTNPQPGDVRTNFAASGEGIQLKYGAHKGRLIQQYSGYVRQANGSELFQAY
FT                   SVYSDDHGATWHKGAPIGDRMDENKTVELSDGRVLLNSRDSGNGGYRKVAVSTDGGASY
FT                   GPVTQDTELPDPANNGSISRMYPAAPEGSAEARKLIFTNSNSKAARENVSARVSCDDGA
FT                   TWPGVRTIRPGFSAYSTITRLAEGKFGVLYEANYTDNIQFASFDDAWLNYVCAPVNVPA
FT                   QTIAPGVAQQVPVTVTNQEAHVLSGARASIYTPAGWSAATVDVPDLATGSSATVNVQLT
FT                   PPAGASGPTSLNAAFTTADGRVSQYTFVANSPVAPQVGLTIAGSAPARDVAANPYKEGE
FT                   VLSYTFAVKSTSNVTSNAVPLSGTFETGFLPPSAPNCRYNNLAAGASYNCTTPKHTLTP
FT                   EDIARGYLVPVAEFTVTASGNTALTKAVSFKGAAVPLRDGLLAGSISGARNDAGRDLAV
FT                   QPYAAGEQVPYTFTVSNTGPLAADVVPIAGNFSPLVPPGAGNCRWLNLAAGGSYACSTP
FT                   RHTVTQKEAEEGFFRADSTWTVAASGQSSREYRVDGGEVDLAIRNPKLDGTISAEWADA
FT                   DGDRYASAGDSVTYTYGVGNAGNVALTGVTATDAGISVDRLGIGETATATRVHILTPAD
FT                   IAAGQLPASPFAASASNGSRNVRVDVQAGAVALRLQPAKPAAVPVLTVQDFDGQVPPVD
FT                   LDTNEKYRNGEKVTLRGLPHGQWYYVYLNKHGFRLGWIFPTTADTVEFLLPSTVQNGRD
FT                   DVVVLDSEGKQVSFDRLQVTPKGSIG"
FT   gene            580071..583208
FT                   /locus_tag="Arth_0544"
FT   CDS_pept        580071..583208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0544"
FT                   /product="protease-associated PA domain protein"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; protease-associated PA domain protein; KEGG:
FT                   cps:CPS_3335 serine protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01943"
FT                   /db_xref="GOA:A0JSC3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC3"
FT                   /protein_id="ABK01943.1"
FT                   /translation="MKSKGTSLVRVGGLRKAAALAVGLPLLLSSVAVGPATAAPAEPSG
FT                   VEQAKNVNPTDYKDGRYIVVLAEKAAAAYDGGTAGIAATKPQQGRKLDSGSQNYKAYDA
FT                   HLRKTQREVASKQGVTPSKQFTGALNGFVAELTAVQAAELAKDSNVLVVAPDVENAPDY
FT                   TTTDFLKLTGSDGAWAKQFGGESGAGKGVVVGVIDSGYAPDNPFLQGDAVQPLKGKAQV
FT                   GVPYLTADGKIAMLKSDGTTFQGECQKGIESGASFDGTLCNSKVVSARYFADSFRQYVT
FT                   PEHRAPEELISPVDVGSHGTHTATTAAGNANVEQVIDGASFGKSSGVAPAAKVSVYKVC
FT                   WEDDNPNTGGCYSSASVEAVDAAIKDGVDVLNYSISGNTNSTTDPVALAFLNAAAAGVF
FT                   VSASAGNSGPAVSTVNHASPWLTTVAASTFPSDLLGTVKVSDGSMFRGASIMKSEVKDA
FT                   AVVVAADAAAPDAPTAANLCGPGTLDAAKVTGKVVVCDRGVVDRTAKSLEVQAKGGVGM
FT                   ILVNLTSSSEDADNHVVPTVHVNAPKSLELKSKLSAKPALTVSLVKGDLTGEPLPPAPQ
FT                   VAGFSSRGPSLASGGDLLKPDISAPGVNVLAGVSTIGNNGAQFGFMSGTSMAAPHIAGF
FT                   GALVLSKQPTWSPAMVKSAMMTTAYPLVNADGTPNRNPFEGGAGHIDATRVLDPGLVYN
FT                   SDIKQWLAFLNGQGVETGAPQAGSIAARNLNLPSIALGSLVGEIQVKRQLTALVPGSYR
FT                   PAVDMPGVGVHVEPQVLNFAKAGQTREVTITIKNVSAPVGKFTTGTLTWKGPRTVSSPI
FT                   AVRPVDAQIAPSFSFSSATGTGSGTLDLVSGSDSPIAVGVEGLAPLSETAITKTPGAYA
FT                   AKNDEHNALVKVEVPAGATFARLGVQAESDDVDWDMVVYAPNGSGGLVATQVATASTSE
FT                   FLDLESPRAGTYYIVANLYSTPDNGPASAVVQTVSFPGKPETKLAVNPNPIIAPNGTAT
FT                   TATASWTGLAPGSYLGRLSLGGNGIRTWISVKVGTGTAAAPAGAPAVTPVDAVPGT"
FT   sig_peptide     580071..580187
FT                   /locus_tag="Arth_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 39"
FT   gene            complement(583343..583714)
FT                   /locus_tag="Arth_0545"
FT   CDS_pept        complement(583343..583714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_3059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01944"
FT                   /db_xref="GOA:A0JSC4"
FT                   /db_xref="InterPro:IPR023549"
FT                   /db_xref="InterPro:IPR036819"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC4"
FT                   /protein_id="ABK01944.1"
FT                   /translation="MTADVDLTVRLTEVPGAPEHEFRLVVRHGVTPQAAAMNGSTLPDP
FT                   AAALAAVERFGDEVFFVPRRRDMMCTQQYGGPQVAIVTGTFHGRPVHSRFSLTDGCEIA
FT                   RWRSLAPLFGGTPGSTGQT"
FT   gene            complement(583714..584625)
FT                   /locus_tag="Arth_0546"
FT   CDS_pept        complement(583714..584625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01945"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC5"
FT                   /protein_id="ABK01945.1"
FT                   /translation="MLPADSWKQHEADHQARVRRYADPYLARRSAGRKHPVEDFLFTYY
FT                   TQKPGQLLRWHPGAGVVLTGAEAAARADWKYYRKLDDGDLAAAGLSAGTTAATVDLAAF
FT                   LAERKEALQFAEIILRGTATRPAQFGCFGLHEWAMVYHQDKFELRHEYLQLRLGSQGTD
FT                   RVVEDNRIRCSHFDAFRFYTPDATPLNELAPSRENQRAMEQPGCLHANMDLYKWAYKLA
FT                   PALPSELVMDCFELSWRVRAMDMQASPYDLEEWGYPPIPIETAAGKAEYVEHQRAFSAE
FT                   AQVLRGRLLGALAPLIDEVRGS"
FT   gene            complement(584660..585217)
FT                   /locus_tag="Arth_0547"
FT   CDS_pept        complement(584660..585217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_3059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01946"
FT                   /db_xref="GOA:A0JSC6"
FT                   /db_xref="InterPro:IPR023549"
FT                   /db_xref="InterPro:IPR036819"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC6"
FT                   /protein_id="ABK01946.1"
FT                   /translation="MRKAWIHALVLVSVAGLAACSPGGGGGGPTPSPSATSSTAGPTAT
FT                   QSPDTETTVPAPSPPPTAAPSTSGPGKGNAELAIMVKPSESEAALNYTLVCKDGVPTAE
FT                   SSHPSAAAACTTLKENPAVLSPAPRATDQACTQQYGGPQEATVTGIVDDTPVDSSFGRK
FT                   DGCEIGLWNSAKDILGSAGGAS"
FT   sig_peptide     complement(585095..585217)
FT                   /locus_tag="Arth_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.285 at
FT                   residue 41"
FT   gene            585511..588531
FT                   /locus_tag="Arth_0548"
FT   CDS_pept        585511..588531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0548"
FT                   /product="protease-associated PA domain protein"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; protease-associated PA domain protein;
FT                   proteinase inhibitor I9, subtilisin propeptide; KEGG:
FT                   cps:CPS_3335 serine protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01947"
FT                   /db_xref="GOA:A0JSC7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC7"
FT                   /protein_id="ABK01947.1"
FT                   /translation="MTYPPVGSRDHRRNSATRLAAVVALGISLMIGQGLAAPAWAAADP
FT                   AAEETPSLDAGRYIVMLKDRPLAAYTGGVEGIPGTAASNGRKLDADSAESRRYSAHLEA
FT                   EQSRLAAAEGVAIDDSYTLAVNGFSAELTAEQANALTKDGNVLAVVKDSQYKIDYSSTE
FT                   FLGLPGPGGVWAEQFGGDANAGKGTVVGVLDTGYTPGNPFFAGEQVKPLSGAPHVGEPY
FT                   LSAGNQITMLKADGSTFAGVCQAGDQFAGTECNSKVIGARYYDAAFKSAVPPGLRSPKE
FT                   TYSPVDINNHGSHTASTAAGNSDVSQAVGGRDFGKGSGVAPAAKLAIYKVCWEGVSPAT
FT                   TGCFASSGVEAIEDAIRDGVDVLSYSISGTNNSTVDPVSIAFLNAAAAGIFVAASAGNS
FT                   GPAASTVNHAAPWMTSVAASTHSSSLRGTVELSSGDKFAGASIMSTEVANAPIALAAAV
FT                   KTADAVDANAALCAPGTLDPAKTAGKIVVCDRGVVDRTAKSMTVAQAGGVGMVLVNLTP
FT                   NSLDVDLHSVPTVHLDDPAIKEAVGTDAALTASLVATDTTGLDPPPVPQIAGFSSRGPT
FT                   LAANGDLLKPDIAAPGVGVLAAVSPAGSNGQNFGFLSGTSMAAPHIAGFGALLLGKNPL
FT                   WSAATVKSAMMTTAYDLVDAEGSPVHDVFAQGAGQIDPARIATPGLVYDAGPSDWLGFL
FT                   QGLGYQLGVAPLAAKDVNLPSIALGGLTGTQTVTRTVTALTAGSYRAEVDVSGITAEVT
FT                   PDVLTLAEGEKATFTVQFTNSGAALDAFVGGSLTWSSDEAVVRSPVAIRSVTAVAPAVV
FT                   NASSAGGSGSIVIPVTSGSPEPIDVTVKGLAKASSTAISLVPGPYTGVKDASNDVQIVN
FT                   VPAGSSLARFAVNSANPAADFDLYVVSPAGLLYPGATPAANEAVSIPDPVAGDWKVTTN
FT                   LFASPGGAATAASVEAMVLAGDAGNLTVSPNPLAIENGATGELTATWTGLEAGNWVGLI
FT                   KYGTGPSTQLNVAVTAP"
FT   sig_peptide     585511..585636
FT                   /locus_tag="Arth_0548"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.843 at
FT                   residue 42"
FT   gene            complement(588563..589066)
FT                   /locus_tag="Arth_0549"
FT   CDS_pept        complement(588563..589066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0549"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: nfa:nfa38090
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01948"
FT                   /db_xref="GOA:A0JSC8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC8"
FT                   /protein_id="ABK01948.1"
FT                   /translation="MNQRSAAPIEASDEDLLLEHQLCFALTVASRSVVGAYKPVLDTLG
FT                   LTHPQYLVMLCLWESSPRSVRDISDALAQEPATISPLLRRLEAAGYITRGRAAGNERAL
FT                   AVGLTPSGAALRQRATAVPGTMMERLGLTRGQVGALHQAMTDLIAATRAAAERDATGRD
FT                   TAGA"
FT   gene            589145..589372
FT                   /locus_tag="Arth_0550"
FT   CDS_pept        589145..589372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01949"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSC9"
FT                   /protein_id="ABK01949.1"
FT                   /translation="MANKENAAQRFMRATGKLRAIFGPANRSSLGHEMTDENKALLARR
FT                   EAETQQWETMRRPDGSTYVVPRNPEDKSLR"
FT   gene            589484..589699
FT                   /locus_tag="Arth_0551"
FT   CDS_pept        589484..589699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01950"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD0"
FT                   /protein_id="ABK01950.1"
FT                   /translation="MGIVAKAIQRFMSKTDKLRFFFGPATRGDPTAPVVHRHDDFEAAS
FT                   EEDLAHFEVETDSEGHHYAVRKEDIK"
FT   gene            complement(589827..591185)
FT                   /locus_tag="Arth_0552"
FT   CDS_pept        complement(589827..591185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0552"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   sco:SCO3615 putative aspartokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01951"
FT                   /db_xref="GOA:A0JSD1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD1"
FT                   /protein_id="ABK01951.1"
FT                   /translation="MSMPTTEVKTENQPYVLPVATARTKQLIVQKFGGSSVSDADGIKR
FT                   VAKRVVDAQRAGNEVVVVVSAMGDTTDELLDLAAQVTDSAPAREMDMLLSSGERISMAL
FT                   VAMAINKLGASAQSFTGSQAGMITDGIHGKARIIDVDPHRIRTALDKGHIAIVAGFQGM
FT                   SRTTNEITTLGRGGSDTTAVALAAALDADVCEIYTDVDGIYTADPRVVPSAQKIDRISS
FT                   EEMLELAASGAKILHLRCVEYARRFGVPLHVRSSFSQNEGTWVMPGADDKITTQEGVAL
FT                   EQPIISGVAHDRSEAKVTVVGVPDIPGKAAAIFQVIADAHSNIDMIVQNVSTHGTGRTD
FT                   ISFTLPIVEGADALAALRAAQPEIGFENIEYNEQIGKLSLIGAGMRSHPGVSATFFKAL
FT                   SDAGININMISTSEIRISVVTHADLLDDAVRAIHKAFDLDSEDEATVYGGTGR"
FT   gene            complement(591333..591920)
FT                   /locus_tag="Arth_0553"
FT   CDS_pept        complement(591333..591920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0553"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   spn:SP0566 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01952"
FT                   /db_xref="GOA:A0JSD2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD2"
FT                   /protein_id="ABK01952.1"
FT                   /translation="MEPLASIVTQRLELRLLTQVDAAALRGFRGHADAVRYLSHQPLAA
FT                   GQTDRLLNDLLSRAERSTAEWFHLGWAVVLRSTGAVIGDGRTWNTTEPPLPGGLPGRCA
FT                   SLGYVLHPDYHGNGYGREAAGALVRWLFTECGTHTIYAGVYEPNTASRRLLEGLGFAPD
FT                   HYFTASQDTHGKALASWRYRLDRTAWTLAGND"
FT   gene            complement(591941..592540)
FT                   /locus_tag="Arth_0554"
FT   CDS_pept        complement(591941..592540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0554"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: sco:SCO3618 putative recomination protein;
FT                   TIGRFAM: recombination protein RecR; PFAM: RecR protein;
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01953"
FT                   /db_xref="GOA:A0JSD3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0JSD3"
FT                   /protein_id="ABK01953.1"
FT                   /translation="MYEGAVQELIDELGRLPGVGPKSAQRLAFHILEADPQDMKRLVEA
FT                   ITTVKERVKFCTVCGNVTEQELCNICRDPRRDPSIICVVEESKDVLAVERTRSFRGRYH
FT                   VLGGAINPIAGVGPEQLRIRELLTRLNDGAIQEIIIATDPNLEGEATATYLARMLKSIG
FT                   ITVTRLASGLPVGGDLEYADEVTLGRAFEGRRNALS"
FT   gene            complement(592700..595936)
FT                   /locus_tag="Arth_0555"
FT   CDS_pept        complement(592700..595936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0555"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: lxx:Lxx03430 DNA polymerase III, gamma and tau
FT                   subunit; TIGRFAM: DNA polymerase III, subunits gamma and
FT                   tau; PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01954"
FT                   /db_xref="GOA:A0JSD4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD4"
FT                   /protein_id="ABK01954.1"
FT                   /translation="MSVTTALYRRYRPDSFADVIGQEHVTEPLMTALRKNRVNHAYLFS
FT                   GPRGCGKTTSARILARCLNCAEGPTDTPCGKCPSCIELARGGSGSLDVIEIDAASHGGV
FT                   DDARDLRERATYAPVRDRYKIFIIDEAHMVTSAGFNALLKIVEEPPEHIKFIFATTEPD
FT                   KVIGTIRSRTHHYPFRLVPPEPLMAYLELLCNQENVPVAPGVLSLVIRAGGGSVRDSLS
FT                   VLDQLMAGAGPTGLDYELAVALLGYTHASLLDDVVEAVAASDAATVFRAVDRVIQTGHD
FT                   PRRFVEDLLERFRDLIIVQAMPESAQSILRGMPADQIARLQNQAHNLGAAELSRAADVT
FT                   NTALTEMTGATSPRLHLELLCARILLPTSEQTERGIAARIDRVERRLNYGGNDVGTPAA
FT                   AATASSAPAPSAPVPAAVPAPAASPVPAAAPAASLAPAAVPRATSETPAPAPAASAPEQ
FT                   PAAPEAPARESLTPPRVSTTDWPVDESQAANRSASGPAPSRPAGPQPAVPEAAFPQAPA
FT                   APAAASGPSAPAPVEPVAAARTPLRPEAGQPVAERNVPAPNASSDVEVLRRAWPEVLQT
FT                   LSKIKRSTWALVEPNAQVGQFDGQVLTLAFTTSGLAGAFGRADHSENLRQAIHKTVGID
FT                   CQINAVSGGASSSASSEPNPKAPASPASPETPAGPKAQSKAASPETPATPADVAWGLAP
FT                   ASAAAVPDPEMSPARTHPAASTAGAAGGHPSADATPVHAAGSANAATAAAEPRPAQAAP
FT                   AQAAPAQAAPAQAESAQAAPAQAEPAQAPTAQRQQEDASGSYSYPDDDWGPPLDEDAPP
FT                   LDEEPPMDWTPSVPEQSRPIQPAGIPASVSSSRTADDTSNDDPWSRATEAAPGVWTVGA
FT                   ESNVGKSVEDPDRASLPVVPEPRTPHYEPAAAQLPRSAEMRDEASTLHNGETPHPAEVR
FT                   QPVGALSGAGSSAGAGWATSAQYGPATATDPSPAMSGPDVRSIASPAPAAYASPQTPPV
FT                   AASEAAPGGTVKQSLYQRLSNSPEAEAGRAKAPARQAEAVKTYVQDTPSPDDETIEESG
FT                   VFGRAAVERILGGKLVEERSLDGSPIAPRF"
FT   gene            complement(595991..596080)
FT                   /gene="ffs"
FT                   /locus_tag="Arth_R0009"
FT   misc_RNA        complement(595991..596080)
FT                   /gene="ffs"
FT                   /locus_tag="Arth_R0009"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            complement(596153..596506)
FT                   /locus_tag="Arth_0556"
FT   CDS_pept        complement(596153..596506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01955"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD5"
FT                   /protein_id="ABK01955.1"
FT                   /translation="MTQLHALVTYVPADHAEAVLAAAGDAGAGRIGNYSHCAFTAPGTG
FT                   RFTPLAGARPFIGSEGRSEQVAEVRIECVVEEEVLEAVVAALRAAHPYEEPALMSWAVN
FT                   GHRPARRPDGGEA"
FT   gene            596911..596995
FT                   /locus_tag="Arth_R0010"
FT                   /note="tRNA-Ser1"
FT   tRNA            596911..596995
FT                   /locus_tag="Arth_R0010"
FT                   /product="tRNA-Ser"
FT   gene            complement(597043..597906)
FT                   /locus_tag="Arth_0557"
FT   CDS_pept        complement(597043..597906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I1246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01956"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD6"
FT                   /protein_id="ABK01956.1"
FT                   /translation="MPGWVPLLEEGDDAGYHLPGSAVWAVHGSMTTIVAGIRALLMQAL
FT                   HPGALAGVHDHSRFRDDPLGRLAGTIRWIFTVSYGSTSAARAASGWVLRLHESVRGEYV
FT                   DAHGVKRSYAANDPELLRWVHIAFTDAFLSAHKIWGRPIPGGPDAYVREWAQAGLLMGV
FT                   DSPPLSEAEMRQQLDRWYDDGDLRTDERVAEIVAFIRNPPLHPSLRPGYRMLFAAAVSS
FT                   LEPKYRDMLGLRPPRLGPLPLPVRFGTKVTLAVVQLALGGGGRGRRVGPSEQAARRRLR
FT                   RLGFAA"
FT   gene            598157..599494
FT                   /locus_tag="Arth_0558"
FT   CDS_pept        598157..599494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0558"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: cme:CMH001C similar to
FT                   hedgehog protein Pfam: Kelch_2 Glyco_transf_20 Kelch_1
FT                   Atrophin-1 Hint PROSITE: INTEIN_N_TER PRO_RICH THR_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01957"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD7"
FT                   /protein_id="ABK01957.1"
FT                   /translation="MGNHWGYGHDDHPGRPCLVAARILGVCAISTLGVVALSLQGPATP
FT                   PAAVVTPTSQQSGVGGPGIAPWPDTFMKPLGAAPGTIAANANALISYSRSDIRTISKSG
FT                   KRELNVASEELRRPPAGSLMAPLEVLTETSGFGLRVSPLTGTAGEFHWGQDFAAACGTR
FT                   VYAADAGVVRAVGWHPWGGGNRVEIDHGNGLITTYNHLEGIAVKKGDSVQVGEVIAKVG
FT                   TTGSSTGCHLHFETILDGVHVNPLQWKLLPTKQVDELGTIDMVSYVPGVDAPKGDPTWA
FT                   IPVSSDNSHMVAGGETEGPVQGAPSATETGTPSAPATAATAASTASTSAPATASASSTA
FT                   TAPPPAGTSTATPAPSPSQTETPTPTPTLTEQSTATVSPTEAVTATPTTEPAAEPTFSE
FT                   TPEPTFTATGDPSTEPTAPAEPTADPEPTMTTEPAPTGTATPTPTP"
FT   gene            599592..600077
FT                   /locus_tag="Arth_0559"
FT   CDS_pept        599592..600077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0559"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="PFAM: glutathione peroxidase; KEGG: sco:SCO4444
FT                   putative glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01958"
FT                   /db_xref="GOA:A0JSD8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD8"
FT                   /protein_id="ABK01958.1"
FT                   /translation="MNSLHSIPLTLNDGTTTDFGRFKGRVVLVVNVASQCGFTPQYAGL
FT                   ELLYGKFKDQGFEILGVPCNQFAGQEPGSDDEIAEFCERNFGVTFPLTAKADVRGKNQH
FT                   PLYAELTRFKNGLLPGLVKWNFEKFLVNRDGVVVARFAPTVEPDSPEVIAAIEEALA"
FT   gene            600323..601534
FT                   /locus_tag="Arth_0560"
FT   CDS_pept        600323..601534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0560"
FT                   /product="glutathione-independent formaldehyde
FT                   dehydrogenase"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rba:RB2373 probable formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01959"
FT                   /db_xref="GOA:A0JSD9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSD9"
FT                   /protein_id="ABK01959.1"
FT                   /translation="MTGNKAVAYKGPGKVELIDIDYPSFELKDGPGVNPANVGRPVRHG
FT                   VILKTVATNICGSDQHMVRGRTTAPTDLVLGHEITGEVVEVGPDVEFIKVGDICSVPFN
FT                   IACGRCRNCKERKTGICLNVNPARPGAAYGYVDMGGWVGGQANYVLVPYADWNLLKFPD
FT                   RDQALEKMMDLAMLSDIFPTGFHGAVSAGVGVGSTVYIAGAGPVGLAAATSAHLLGAAV
FT                   VIVGDLNADRLARARSFGCETVDLTEGGPAEQIEQILGVPEVDCGVDAVGFEAKGHGHD
FT                   AKEAPATVLNSLMELTAAGGALGIPGLYVTGDPGGIDEAAKKGALSLSLGTGWAKSLSF
FT                   TTGQCPVMKYNRQLMMAILHDKVHIAKNVNAKAISLEDAPKGYAEFDAGAATKYVLNPN
FT                   GYLS"
FT   gene            601730..602671
FT                   /locus_tag="Arth_0561"
FT   CDS_pept        601730..602671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0561"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mbo:Mb0828
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01960"
FT                   /db_xref="GOA:A0JSE0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE0"
FT                   /protein_id="ABK01960.1"
FT                   /translation="MELIEAEHPRPRHFLLHLSDPHLLGGPDHLYGAVDSEARLKQLFE
FT                   EVKASGARPEAVIFTGDLADRGETEAYAKLRAIVEPACKSMNAQVIWAMGNHDDRHNFR
FT                   SGLLDQPGNDSPVDQSYFINGLRVITLDTSVPGFHHGELSESQLEWLAAELATPAPDGT
FT                   ILALHHPPVPSILDLAVLVELRGQPALAAVLRNSDVRTILAGHLHYSTTASFAGIPVSV
FT                   ASATCYTQDLNVPVGGTRPIDGGQAFNLVHVYEHTIVHSVVPIGSAAAVGEVVSAAETQ
FT                   RRLAAAGIRIPRQAKTQGHPPTQSIPLISASR"
FT   gene            complement(602734..604209)
FT                   /locus_tag="Arth_0562"
FT   CDS_pept        complement(602734..604209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0562"
FT                   /product="putative UDP-glucose-4-epimerase"
FT                   /note="KEGG: mbo:Mb0829c possible UDP-glucose-4-epimerase
FT                   CpsY (galactowaldenase) (UDP-galactose-4-epimerase)
FT                   (uridine diphosphate galactose-4-epimerase) (uridine
FT                   diphospho-galactose-4-epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01961"
FT                   /db_xref="GOA:A0JSE1"
FT                   /db_xref="InterPro:IPR021520"
FT                   /db_xref="InterPro:IPR031356"
FT                   /db_xref="InterPro:IPR031357"
FT                   /db_xref="InterPro:IPR031358"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE1"
FT                   /protein_id="ABK01961.1"
FT                   /translation="MVRHRGRYALINDTRTPYQAMVEDLLFIRNVLANAGLDYLLVRGN
FT                   NHRPVIALDWENRKKLRAALVEACRDEPVYSMTVDAKKKSSVLVADGELSPNRQARIFR
FT                   LYRPRVEPNGGFEFGSSAGVQIELWSFEGNQLILPIENSLTRRTMLTTDAVRGTVDRYG
FT                   HTWPTIENMFADHASDISFDIDMVFSWVDGSSPEYIAARRARMTGVVVGEGDDHEARYR
FT                   QIDELKYALRSVYMFAPWVRRIFIATDSPAPAWLADHPSVTIVRSEEFFADPSVLPTHN
FT                   SQAVECQLHHIEGLSEHFLYSNDDMFFGRAVGPDMFFTPGGVTKFIEAETRIGLGDNDA
FT                   ERSGFENAARVNRKLLWDRFGRITTRHLEHTAAPLRRSVAATMEQEFPQEFAKTAASRF
FT                   RAADNISVTNSFYHYYALLTGRAVTQTAAKVRYIDTTMRSGLNYLPKLLSKRNMDFFCL
FT                   NDGSFPEVEAEERAQLVTDFLEKYYPIKAPWEK"
FT   gene            complement(604407..605321)
FT                   /locus_tag="Arth_0563"
FT   CDS_pept        complement(604407..605321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01962"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE2"
FT                   /protein_id="ABK01962.1"
FT                   /translation="MTASENQAAVSPSAPPLALLLDVDGPVASPVSRNVKPEIIADMVA
FT                   LATAGIPVIFNTGRSDAFIREQVMEPMIAAGMPAGTIIHAICEKGAVWFSYTAAGPGPV
FT                   HVDHDLAVPRAYGDDVRRLVSEDYAKHMFYDETKRAMVSVEQHIDVPSEDYLDEQKLFD
FT                   ADAMVLMARHGLGVVRLDHHAPDSDDQIDYRVDPTIISTDIESVRLGKDLGASRAVELL
FT                   AAQGVRPLAWRTVGDSRTDYAMADWLHHNDHEVKHVDVRPADGVPAKPYAVLTAADLGL
FT                   AEDVIHDDAGGAFLRSWREALAG"
FT   gene            605483..605767
FT                   /locus_tag="Arth_0564"
FT   CDS_pept        605483..605767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01963"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE3"
FT                   /protein_id="ABK01963.1"
FT                   /translation="MGEGRPYPDHGFNTPKEWAALPPRPVRLDELVTTKRTLDLEALLA
FT                   EDSTFFGDLFPHVVQYRGTLYLEDGLHRAVRTALHQRTAIHARVLVIDG"
FT   gene            605760..606425
FT                   /locus_tag="Arth_0565"
FT   CDS_pept        605760..606425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01964"
FT                   /db_xref="GOA:A0JSE4"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE4"
FT                   /protein_id="ABK01964.1"
FT                   /translation="MARKPKDITVLHGHRVVSGSELRATFVEPDDTAEDPVRLRRRILH
FT                   GVVLVLLVGLIISAIIVALAIMNGQIQIPTAERSRSAASACPTATFDYTPNEKVSLNVY
FT                   NATNRPGLARSVADEFLARKFAVAAVDNTQSGYRGVAAVVSGAAGQSAAFSVQRNLPKS
FT                   DYFQDGRSDGSVDVILTSEFKELVAPGLVDQTPGPLSCPRESRRIVDGAKWPVIPKAG"
FT   gene            complement(606465..607088)
FT                   /locus_tag="Arth_0566"
FT   CDS_pept        complement(606465..607088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0566"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: tfu:Tfu_2346
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01965"
FT                   /db_xref="GOA:A0JSE5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE5"
FT                   /protein_id="ABK01965.1"
FT                   /translation="MPRISAATNAAQRAETQRRILTGFGELLFTHGLPGLTMTDVARHA
FT                   GIGRTAVYNYYADIEELLIAYALDETERFLDGLRESLQSLENPVERLALYIRAQVEDLS
FT                   RRHLPPGPAMAAVLSPSSFSKLADHVGELSLLLQDILRDAMGEGYLPPADIAQLAQLIH
FT                   GTLSSSAARGDGTPEAVLRTVRFIQLGAGARFDDAGRPVRLSQP"
FT   gene            complement(607140..607874)
FT                   /locus_tag="Arth_0567"
FT   CDS_pept        complement(607140..607874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0567"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: dra:DR0659 FrnE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01966"
FT                   /db_xref="GOA:A0JSE6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE6"
FT                   /protein_id="ABK01966.1"
FT                   /translation="MKIEIWSDVACPWCYIGKRRFEAALAEFPHRDSVEVQWRSYQLDP
FT                   GLPEHYDGTELDYLSTRKGMAPAQVSQMFQHVAEQARGEGLNYRFDTVVVANSFTAHRL
FT                   IHLAAAHGKQDAAKERLLSDHFEHGKDIGSREYLTSLGRDLGIDAGELDELFTTDKYAE
FT                   DVRFDFEEGRALGISGVPFFVIDRKFGLSGAQPSAMFSQALNQAWQEKQPLVMAGTGAP
FT                   GSEGSKRNDGGAEVCGPDGCAV"
FT   gene            complement(607988..608530)
FT                   /locus_tag="Arth_0568"
FT   CDS_pept        complement(607988..608530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0568"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nfa:nfa37300 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01967"
FT                   /db_xref="GOA:A0JSE7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE7"
FT                   /protein_id="ABK01967.1"
FT                   /translation="MTHTIRQATADDAGRLAELAAVTFPLACPPESSADDIAAHLANTL
FT                   SVTKFHGYLADPDITVLVIDSDGDLRGYSMLVDRPAGDRDVAAALTILPSAELSKCYVH
FT                   PDHHGLGAAAELMHASLDAAAASGARGMWLGVNSQNAKAIRFYEKSGFRKVGTKSFNLG
FT                   TTVEHDFVMERAVPRPG"
FT   gene            complement(608564..609592)
FT                   /locus_tag="Arth_0569"
FT   CDS_pept        complement(608564..609592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0569"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase, C-terminal
FT                   domain; KEGG: sco:SCO2285 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01968"
FT                   /db_xref="GOA:A0JSE8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE8"
FT                   /protein_id="ABK01968.1"
FT                   /translation="MTNQPAGTSDGHLRWGILGTGFIAGLQTQDLLDNGFTVLAVGSRA
FT                   LDSSRAFAEQYGVAGARGSYEDLVADPLVDVVYIATPHPFHHANALLALNAGKHVLVEK
FT                   PFTMNAREAQDIAELAESKGLVALEAMWTRFLPHMIRLRAIIQEGTIGEVRKVVASHNQ
FT                   SLPQDPAHRLNDPALGGGALLDLGIYPVSFAFDILGTPETIRASASMTATGVDRQTAAI
FT                   FDHAGGQQAIVDCELDAASANRAMVIGTEGWIDVESTWYNPVPFTVHAADGSVIERFEQ
FT                   PVSSRGMQYQAAELERLVRAGDTAGTILPPSETVAVMTAMDEIRRQIGLSYAADATPDA
FT                   QR"
FT   gene            complement(609585..610529)
FT                   /locus_tag="Arth_0570"
FT   CDS_pept        complement(609585..610529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc00162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01969"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSE9"
FT                   /protein_id="ABK01969.1"
FT                   /translation="MLGVRGHIALEALAMLRTLEPGQRCEVWIASVTGESEMVFSTDEV
FT                   LLEAPNWTLDGRSLVLNGDGKLWTLDVSGGRLTEVPLTGVPDLNNDHVLAPGGTGIFLS
FT                   ANDGHIYRAPLDGGEGQRITDDDGSFHFLHGVSPDGGELAYVGIQAGDFTRPGRLMTIP
FT                   SDGGTTAAVDVGPGHCDGPEYSPDGQWLYFNTESFSSLPGHAQLARVQVDGSGFERLLE
FT                   SVTVDWFPHLSPDGELACYIRFLTGTEGHPADLPVDVVLVSTGDWTAPLHTWPLFGGQG
FT                   TLNVNSWSPDSARFAYVAYPLGNTDTPKDQVRD"
FT   gene            complement(610582..611583)
FT                   /locus_tag="Arth_0571"
FT   CDS_pept        complement(610582..611583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0571"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: AP endonuclease 2 domain protein; Xylose
FT                   isomerase domain protein TIM barrel; KEGG: sco:SCO6571
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01970"
FT                   /db_xref="GOA:A0JSF0"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF0"
FT                   /protein_id="ABK01970.1"
FT                   /translation="MPRPYTLFTGQWADLPFEEVARLASGWGYDGLEIAVSGDHLDAWR
FT                   WDEPGYVQSKLAVLEKYNLKVWAISNHLKGQAVCDDPIDFRHEAIVGSKVWGDGDPEGV
FT                   RTRAAEEMKHTARLAKALGVDTVVGFTGSSIWQYVAMFPPVPEKVIEAGYQDFADRWNP
FT                   ILDVFDECGVRFAHEVHPSEIAYDYWTTVRTLEAIGHREAFGLNWDPSHFMWQGIDPVS
FT                   FIWDFKDRIYHVDCKDTKLRPTGRNTVLGSHLPWGDPRRGWDFVSAGRGDVPWESSFRA
FT                   LTAIGYDGPISVEWEDAGMDRLHGAPEALAALKKFDFPASQTSFDAAFSSKD"
FT   gene            complement(611585..612781)
FT                   /locus_tag="Arth_0572"
FT   CDS_pept        complement(611585..612781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0572"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: sma:SAV1825 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01971"
FT                   /db_xref="GOA:A0JSF1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF1"
FT                   /protein_id="ABK01971.1"
FT                   /translation="MNSPESTDGTNPDNPPLGVAMIGYAFMGKAHSNAWRNVASYFDVP
FT                   AFEQKVLVGRDAGQVAAAAARYGWAESATDWRSVLDRDDIHVVDICAPGWMHAEIAIAA
FT                   LEAGKHVLVEKPLANTLAEAEAMADAARSARERGVQSMIGFNYRRVPALALAKELISEG
FT                   RLGTVRHVRAAYLQDWLTDAESPMTWRLRKETAGSGALGDIASHAIDQVMFLLGGHVTE
FT                   VSGRLHTFVSSRPGADGPEEVTVDDAAWATLTLDSGTIASVEVSRMATGQKNSLKLEIY
FT                   GDKGSLLFDLEAINELGFLDATLPAREQGFRRILVNEPEHPYMAAWWPQGHVIGWEHTF
FT                   THEIRDFLAAIDGGTPPSPSFEDGLAVQRVLAAIEESANAKSSIIQLAASPVPVTEGA"
FT   gene            complement(612792..613910)
FT                   /locus_tag="Arth_0573"
FT   CDS_pept        complement(612792..613910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0573"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   lxx:Lxx03050 NADH-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01972"
FT                   /db_xref="GOA:A0JSF2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF2"
FT                   /protein_id="ABK01972.1"
FT                   /translation="MSTSSMRKGPVGVAVIGAGNISKQYLDNLTDFPDLKVHVIADLFE
FT                   DAAAARAKEYGIAEYGGVDAALNHPDVEIIVNLTIPAAHVEVATAAVNAGKHVWTEKPF
FT                   SLDRESGLGLLKAADAAGLRLGCAPDTFLGAGLQTARRLIERGDIGTPLTAMTTFQTPG
FT                   PESWHPNPAFLFQYGAGPLFDMGPYYLTALVQTFGSVRKVAAIGSKSKEVRVIGSGPKL
FT                   GEEFTVEVPTHVSAMAQFEGGQSSHSVFSFESPRQRMGFMEITGTEATISLPDPNYFDG
FT                   DVRLWRAGDEEWTVIPATGPSNGRGMGVLDMARSIRAGVPHRATGNLAYHVLDTMVSIS
FT                   ESVESGTFVNVESSAPASPALPEDWNPTASTL"
FT   gene            complement(613907..614671)
FT                   /locus_tag="Arth_0574"
FT   CDS_pept        complement(613907..614671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0574"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: lxx:Lxx03040 sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01973"
FT                   /db_xref="GOA:A0JSF3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF3"
FT                   /protein_id="ABK01973.1"
FT                   /translation="MSYSLQLYTLRNAIQEDLPGTIRKVAEIGFTQVEPYNFLATAKEL
FT                   GAALKENGLTAPSGHAPLLSQDQDEIFAAAKELGISTVIDPFLPAEHWQKAEDIQATAA
FT                   KLNAAAKKGAEYGIRVGYHNHAWELESTIDGRTALEYFADLLDPELVLEVDTYWVAVGG
FT                   QDPVAILTKLGDRVKFIHIKDGPINTDTKAQQPAGQGKIAVWDVIGAAKSLEVGVVEFD
FT                   DYSGDIFDGIAQSLEFLNAGASEGAQSEGARA"
FT   gene            complement(614727..615620)
FT                   /locus_tag="Arth_0575"
FT   CDS_pept        complement(614727..615620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0575"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sco:SCO3482 putative
FT                   sugar-permease; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01974"
FT                   /db_xref="GOA:A0JSF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF4"
FT                   /protein_id="ABK01974.1"
FT                   /translation="MSAAVHAHPESGPVLGVAGPAKNLRVLSEAGHRGQWWRFVAILAI
FT                   TAIVLVPIMVTVVLAFTPGPTSTAKGLTFENLANVFSGTLAATWLQNSLITTLATVTVS
FT                   VAVAAPAGYVLSRGRSKAVSGYSLLLFVMQSLPIITSVVPLFILFAGMGLVDNLLGITI
FT                   IYVGSTMTVATWMMAAYFDSIPISLEEASWIDGCSVFGSFTKVVLRNSLPGILSTAIFA
FT                   FLLAWNDYLVAIVFLRSNEIFTLPMGVQSFFQQNATDWTSVMALAVVMMLPPVIVFATL
FT                   NKYFSVGGIGGSLAGR"
FT   gene            complement(615620..616579)
FT                   /locus_tag="Arth_0576"
FT   CDS_pept        complement(615620..616579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0576"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sco:SCO3483 putative
FT                   integral membrane transport protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01975"
FT                   /db_xref="GOA:A0JSF5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF5"
FT                   /protein_id="ABK01975.1"
FT                   /translation="MALTTAQSGLSRARRGVAPGGPGGPANRKSKLSAQTSRTFFWLLL
FT                   PSVILLVLIHGYPLIHAGVQATHDGSLIQTGNFVGGENFATVLSSPAFWKAAQFTLMFT
FT                   IVGVFGSWLVGLGLALLLRTKIPAGGTFKVLLLLPWVVPIVVSSTAWNWLVATPDSLIP
FT                   SLFRNLGLGTPLFLADPNLAAITVMVFKVWVSFPFMMMMISAALASVDTTVYEAASMDG
FT                   ATRWQQFSQITLPLIARSTYISWILMTIFCVNDFPTIYLLTGGGPVSATTSLVVLAYRT
FT                   VFQDFATGPGVAIAFLMTMTLVVISVLLYRQIRKSSVE"
FT   gene            complement(616591..617913)
FT                   /locus_tag="Arth_0577"
FT   CDS_pept        complement(616591..617913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0577"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: extracellular solute-binding protein, family 1; KEGG:
FT                   sco:SCO3484 putative secreted sugar-binding protein; TC
FT                   3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01976"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF6"
FT                   /protein_id="ABK01976.1"
FT                   /translation="MSTKPSIASSAFSRRGFLGFAAAAASAPLLAACGGGSASQGGGGA
FT                   GGTIKFWDMPWATPAYNDAAKKLAEGFSGSGSKASYQIIQWNNFYQTFSSAIASKTGPA
FT                   VSTGGGFQAFQFEQQGQIAYADKVIDKLKENGQFDDFLPGVLDPFKSDKGYVAVPWQLD
FT                   MRVFWYRKSLFEKAGVGLPTDWPSLLEAGKALKKVGAFGFTTGAGAGNNYGNHSMIMMM
FT                   VNNGGGVWNKDGELDLMNDRNVEAMEFVLELVSNGIVDPAAVSYTTDNMSAQWKDGKAG
FT                   FGLFQVNVPQRVGDTSGDLLVADPITGPHGDKATIVFPNNIMMYTNTPSQEASEAFLVY
FT                   YLGQLKELWRQKLMSALPVFKSITELPEFANDPNNVKIVKDWQPIAKTFAAQGKTLNAN
FT                   LAALDGGQALNQFSQTILTGKADAKTALQTFQSGLESVLKK"
FT   sig_peptide     complement(617818..617913)
FT                   /locus_tag="Arth_0577"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.338 at
FT                   residue 32"
FT   gene            complement(618021..618830)
FT                   /locus_tag="Arth_0578"
FT   CDS_pept        complement(618021..618830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01977"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF7"
FT                   /protein_id="ABK01977.1"
FT                   /translation="MTTQLSVYADPQAEAAGAVSAVVASLPLSFGPGASAADVTAVAGH
FT                   AGWTDRASAAIRSGAKGVVVSAPVAEDPAGLTAVADAAGSVVVLDLQWAGNLALDSTSE
FT                   NVHGAIAAALEDALLLDSVAIAVPGTDPLHLLTDQLAVLVQCGIEVRNVRMVQRNGNGY
FT                   TVSGVIADGIPVALQGILTSALPATASLTVLTSTGRTDVVLPDPAAAWPAEVRSVTTEG
FT                   AMTLPTLYESSHRTSWSRVHSHISSGTPAHDLARFSAVMSLLSQLTS"
FT   sig_peptide     complement(618720..618830)
FT                   /locus_tag="Arth_0578"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.835 at
FT                   residue 37"
FT   gene            complement(618827..619936)
FT                   /locus_tag="Arth_0579"
FT   CDS_pept        complement(618827..619936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0579"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   cme:CMO306C probable myo-inositol dehydrogenase Pfam:
FT                   Shikimate_DH ThiF 3HCDH_N DapB_N GFO_IDH_MocA
FT                   Semialdhyde_dh TrkA_N NAD_binding_3 GFO_IDH_MocA_C"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01978"
FT                   /db_xref="GOA:A0JSF8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF8"
FT                   /protein_id="ABK01978.1"
FT                   /translation="MSSQAQASPALLGVGILGAGPVTQAIHLPSLARLGDILDVRHIMD
FT                   VDPAVAEAVAGRVGAKFSTSMEELLADPAVDIVAICSPHQFHATQVIASCRAGKKAVLC
FT                   EKPFAMTGEEAARIAAVSAETGVPIIVGAMHTFDPGWLAAEDAWGELPEQVHTVRSSIV
FT                   LPPNPRFEDFATEIVGRIPAPGNDSTGPEAIKAMLTGGVMGLAIHDLPLVRRFTPDFAA
FT                   VEVLHAETLSPFGYVISLRAGNVTIELRAAMNGTWEPSWTFEAIGDDAALEIDFTPSYV
FT                   HAGSATARIRTVGRTTVLGPFGHNGYEGEWRKLAELARGAGQPPSAETLIHDLEFALAI
FT                   ADAAAGRVDTGRVDAGSAAGSTADQEVNA"
FT   gene            620121..621353
FT                   /locus_tag="Arth_0580"
FT   CDS_pept        620121..621353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0580"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: lxx:Lxx03030
FT                   transcriptional regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01979"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSF9"
FT                   /protein_id="ABK01979.1"
FT                   /translation="MSPTSGKETGIDAGTDAAPDGAGSLSRAGDLFQLLRDGKARTRAE
FT                   LALTTGLARSTVAARIDALISSGLVGPAGEASSSGGRPPSRFAFNPAARSVLAVDVGAT
FT                   HVIVAVTDLGGNVLAERRLAQDVADGPEAVLGRVVEEGKTLLSEAGRTAADLAGIGIGL
FT                   PGPVEHATGMPVKPPIMPGWDGFDVVRYVRRSLPVPVLVDNDVNIMALGERTAYWPEHD
FT                   NFLFIKVATGIGAGIISSGELQRGANGTAGDLGHVRVPRGDEVLCRCGNYGCLEALASG
FT                   PAVARELARHGLPAEKGSDVLRLVAEGNLQAIQALRQAGRDVGDVLATVVNLLNPSVIV
FT                   IGGSLGQAGEHLMAGVREVVYRRSLPLATSHLRIALSMAGDQAAILGASQMVTQHVLSP
FT                   AVIEATLQATG"
FT   gene            621437..622630
FT                   /locus_tag="Arth_0581"
FT   CDS_pept        621437..622630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0581"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   zmo:ZMO1111 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01980"
FT                   /db_xref="GOA:A0JSG0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG0"
FT                   /protein_id="ABK01980.1"
FT                   /translation="MTANILARVPRGWILLASIGLIALNMRGPFVAVAPVVGPMQQDLG
FT                   FSPVELGLLTGIPVLCFSLAAPLASFAGRKFGAEFAIMLTLLGVLAGVIVRSAGNGGLV
FT                   LFGTAIIGVAITIGNIAVPLIIRRDFSPHRQGTAMGIYTAALNIGSFLTSVVTAPLAEV
FT                   AGWRLALAASGLFAVAATVFWVMAVGRQAFVPSPVEESDPRPAGGRPASRWITAGLTAG
FT                   FAGQAFSYYGVTAWLPTFLIDELGMAPSAAGAGSSLFQILAIVGGLGVPMVARFASTTA
FT                   VAVTLGLMWLTVPLGLLLAPELWWLWSSVGGAAQGGGITVIFIAIIKLARDQASAGRMS
FT                   AVVQGVGYSVGAVAPTLLGYVHGLSGSWTNPLLLILASVAAFFLGTTLSVRKVPKTR"
FT   gene            complement(622836..624500)
FT                   /locus_tag="Arth_0582"
FT   CDS_pept        complement(622836..624500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0582"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: tfu:Tfu_0819 malate synthase; TIGRFAM: malate
FT                   synthase A; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01981"
FT                   /db_xref="GOA:A0JSG1"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG1"
FT                   /protein_id="ABK01981.1"
FT                   /translation="MNSFTDNFTINGITLTAQPICRQGEVLTPDALAFVAKLHRATTER
FT                   RQELLQGRRNRRAEIAKGQDPRFLRETESVRNDPNWRVAPPAPGLEDRRVEITGPVDKK
FT                   MTINALNSGAKVWLADMEDSSTPSWRNVIQGQLNLTDALERRIDFTSPEGKDYKLRPAG
FT                   ELPTIVVRPRGWHLPEKHMLIDGEPIAGGIVDFGLYFFHNARRLLAQGKGPYFYLPKIE
FT                   NHLEARLWNDIFILAQELLGIPQGTIRATVLIETITASFEMEEILYELRDHAAGLNAGR
FT                   WDYIFSMIKNFRTRGPRFVLPDRVQVTMTAPFMRAYTEQLVRACHKRGAMAIGGMAAAV
FT                   PNRKDEEANAIAFEKVRADKTREANDGFDGSWVAHPDLVPVCREVFDAVLGEKPNQLDR
FT                   LREDVTPDDRALLDIAATKGTITEQGIRNNIEVGIRYIESWLRGNGAVAIHNLMEDAAT
FT                   AEISRSQLWQWIFSRAITDEGEIITRHWVEELLDEEFSRLERFEGDRFADARDIFEEVT
FT                   LADAFPTFLTLPAYARFLHEARDRSEEPVEDAELVAA"
FT   gene            complement(624594..625925)
FT                   /locus_tag="Arth_0583"
FT   CDS_pept        complement(624594..625925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0583"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: mpa:MAP3961 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01982"
FT                   /db_xref="GOA:A0JSG2"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG2"
FT                   /protein_id="ABK01982.1"
FT                   /translation="MTAAFEPTQQTPEQQAAALELEWAANPRWEGVTRDYKASDVVRLR
FT                   GRVSEEHTLARRGSEKLWKQLTEEHKTGGYTNALGALTGNQAVQQVKAGLRAIYLSGWQ
FT                   VAADANNSGHTYPDQSLYPANSVPTVVRRINNALLRADQIEFSEGIQTVEDWMVPIVAD
FT                   AEAGFGGPLNAYELMKSMIQAGASGVHWEDQLASEKKCGHLGGKVLIPTQQHVRTLNAA
FT                   RLAADVAGTPSVVIARTDAEAATLITSDVDERDQEFILREGGQPVRTPEGFYKVRNGIE
FT                   PCIARAKAYAPYSDLIWMETGTPDLELARKFAEAVKAEFPDQMLSYNCSPSFNWRKHLD
FT                   DATIAKFQRELGAMGFTFQFITLAGFHALNYSMFDLAHGYAREGMSAYVELQEKEFASE
FT                   SRGYTATKHQREVGTGYFDDIATALNPNASTLALVGSTEEGQFH"
FT   gene            626107..627594
FT                   /locus_tag="Arth_0584"
FT   CDS_pept        626107..627594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0584"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: tfu:Tfu_1378
FT                   helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01983"
FT                   /db_xref="GOA:A0JSG3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG3"
FT                   /protein_id="ABK01983.1"
FT                   /translation="MSPTSWNRKAATPPSSPATAELDVISLGRRVRHLRKAAAMTLDDL
FT                   SAAVGTAPSQLSLIENGKREPKLGLLQQLAAALNVSIDQLLGAEPPNRRAALEIELERY
FT                   QRSPLYESLNLPKIRISSRLPMDVLESMVGLQHELERRLNEQVATPEEARRANAELRAM
FT                   MRERNNYFPEYEAEAQKVLASVGHKNGPLSHHVIADIAGHLGFSLHHVGDLPHSTRSVT
FT                   DLKNRRIYLTQNQRSDHDPRSVLLQALGHYVLGHQTPSNYGDFLMQRVATNYFAAALML
FT                   PEQATVEFLQKAKQAKEIAVEDIRDAFAVSYETAAHRFTNLATQHLDIRTHFQKTHKSG
FT                   IIYKAYENDGVTFPQDHTGAIEGQPSCKNWTSRVVFDVPDKFSAYNQYTDTPAGTYWCT
FT                   ARTERSANGEFSLSVGVPYAQVKWFRGRDTTERSKSTCPDESCCRRPPASLTSEWAGNA
FT                   WPSARAHSHLLAAMPPGAFPGVDETEVYSFLQAHSGS"
FT   gene            complement(627706..628731)
FT                   /locus_tag="Arth_0585"
FT   CDS_pept        complement(627706..628731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0585"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: nfa:nfa28130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01984"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG4"
FT                   /protein_id="ABK01984.1"
FT                   /translation="MTGMTDLAGSLPPRRAALKAGLAAGLAGLLIPALTACTAEDKPGT
FT                   VTVAGGEPGGFYLEFATLLAESIQRHGVAGSASALTTGGSLDNLRQLLTGQATFAVALA
FT                   DAAAQKMPAGGPSDAGIAALGRVYENYVHCVVRRAGGIRTLTELAGRTVAVGEPGSGTS
FT                   LTTPRLLEAAGLASVAVGAAPAANGGKTVTVLNLGLNAGLAALQDGSVDALFWSGGVPT
FT                   AAIAATHHEVGLGFLDLSPLLPKLRTKYGAFYDRVLIPEGAYEGIPAVWAVGVANLLLC
FT                   RSDLDERTVKRTVELLVDHAEELIPRSSMGVQFLSPESLINTAGLPLHPAAAAAYRELH
FT                   G"
FT   sig_peptide     complement(628615..628731)
FT                   /locus_tag="Arth_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.848) with cleavage site probability 0.536 at
FT                   residue 39"
FT   gene            complement(628760..630193)
FT                   /locus_tag="Arth_0586"
FT   CDS_pept        complement(628760..630193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0586"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: nfa:nfa28140 putative two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01985"
FT                   /db_xref="GOA:A0JSG5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG5"
FT                   /protein_id="ABK01985.1"
FT                   /translation="MKLRVLGVLSVLSVLIVIFASTALLTSASRELTQELQINRAAALN
FT                   RLAQVAFDAANDGESIQLQAEMDRYSELYGEGVLIRLQQGTLRSGGLSEDRADVRDAVA
FT                   RAKLNLSDTTLSQIQPFGTGSEVISRSFGSASQVLGEAVLEVNLDAARQKLRERWLLVG
FT                   VAAAALAAVLLLGAARVTRWVLRPVHRLNSAVTELESTGRSSRLPEDGPPELRELSRSF
FT                   TRMARTVSDSIDSQRQLIADTSHQLRNPVGALRLRIDLLQLELQTAREHNAAAGVLAEL
FT                   ERVEEILDGVLKLATAEHRAFEDSAGGPPGAPSRGFRAVIDPYPVLQEETERAGPAARR
FT                   GGSSILLEDPPDPAAHIACNAAELAQMVGELINNAIKYAAGARIAVAVRVRQDAVAVEV
FT                   SDTGPGLSAEERAAATSRFWRSPQHREIRGNGLGMTIVDKLAGANGGRLLLTETSPHGL
FT                   TARIEFPRAMASQGPEALS"
FT   sig_peptide     complement(630116..630193)
FT                   /locus_tag="Arth_0586"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.296 at
FT                   residue 26"
FT   gene            complement(630190..630858)
FT                   /locus_tag="Arth_0587"
FT   CDS_pept        complement(630190..630858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0587"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: nfa:nfa28150 putative
FT                   two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01986"
FT                   /db_xref="GOA:A0JSG6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG6"
FT                   /protein_id="ABK01986.1"
FT                   /translation="MDVLIVEDDDAMASALDAAVVSAGHTASRVARGADALLEHRRFEV
FT                   ILLDLGLPDMDGLDVLRKLRQVTPVPILILTARDDERSVVLGLRSGADDYLVKPVKLVE
FT                   LLARIEAVTRRAGRSKDSRQRSIVLGELEVDLERRVAAVGPRVLPLTATEFDLLALLAG
FT                   HAGSVVTREQILDALWGDAFLASSRSLDVHLTGLRAKLQLPGFIINVRGVGYRVEADPA
FT                   "
FT   gene            631116..632510
FT                   /locus_tag="Arth_0588"
FT   CDS_pept        631116..632510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0588"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mbo:Mb3503c probable
FT                   dicarboxylic acid transport integral membrane protein KgtP
FT                   (dicarboxylate transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01987"
FT                   /db_xref="GOA:A0JSG7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG7"
FT                   /protein_id="ABK01987.1"
FT                   /translation="MSTQQAEVQSESAQTRRAVSNILKGSAGNLVEWYDLYVYTVFAAY
FT                   FQSHFFNSKDELQAGLEAMAVFSTSFLMRPIGAWFFGRYADRKGRKAALTLSVTLMSAG
FT                   SFAIALLPTTQQVGVWALVLLILIRLIQGFSVGGEYGTSATYMSEAATSKRRGFFSSFQ
FT                   YVTLIGGQMMALLVLVILQNVMPKGDLTEWGWRIPFAIGGVAALVVLWLRRSMEETVSA
FT                   EQVEAAKIPAVAGVAQPGTMRLLFTQYWKPLLICIGVTLGGTVAFYTYTNFILKFMNDT
FT                   SGIAKTDTSVINFWALFIFMLLQPVYGLISDKVGRKPLLLWFGITGVLFTWPLLSTLSD
FT                   TKDPFTAFLLMMGGLLIVGGYTSINALVKAELFPASIRALGVGLGYAIANSLFGGTVPL
FT                   IGAAFQKAERVDLFFTYVTVAIAISLVVYIFALRNKKATHLDHEQGHAWSQTRKDDDKD
FT                   KDLLKV"
FT   gene            632977..634221
FT                   /locus_tag="Arth_0589"
FT   CDS_pept        632977..634221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0589"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: fra:Francci3_1959
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01988"
FT                   /db_xref="GOA:A0AWM9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0AWM9"
FT                   /protein_id="ABK01988.1"
FT                   /translation="MEVIHPRCAGVDISKKDAKVCVRIQGRGGRSTTSTITTWGSMTGQ
FT                   ILGLKEHLLDEHVDLVVMEATGDYWRPFYYLLEDDGLNIILVNAHDARNVPGRKTDVSD
FT                   AAWLADLGAHGLVRASFVPPPPIRELRDLTRARTIITQERTREIQRLEKLLEDACIKLS
FT                   SVASNITGVSGRLILQALIDGQTDPAALAEMAQRRLRSKIPELTQALNGRFTEHHRYMT
FT                   GLYLHRIDAHTADINDLSARIEAAMEPFRFARELLVSIPGFSTTIAEIFIAETGADMSA
FT                   FATAGQLASWAGTSPGSNESAGRVKSTKTRPGNRYLKGALGIAALSCAKSKNTYLGARY
FT                   RRIASRRGPAKALVAVEHSILTAAWHMLTTGELYNDPGADYFTRQTPVKTMARAVRQLE
FT                   SLGYQVILEPLQQTG"
FT   gene            634421..636169
FT                   /locus_tag="Arth_0590"
FT   CDS_pept        634421..636169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0590"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: pac:PPA1468 pyruvate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01989"
FT                   /db_xref="GOA:A0JSG9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSG9"
FT                   /protein_id="ABK01989.1"
FT                   /translation="MAKELASQLIEQLQAAGVQRIYGIVGDSLNPIVDAVRKTGGSQQG
FT                   GIDWIHVRHEEAAAFAAAAEAQLTGRLAVCAGSCGPGNLHLINGLYDANRSGAPVLAIA
FT                   SHIPSKQIGSGYFQETHPDRLFNECSVYSELVSTAEQAPRVMHSAIQHAVGLGGVAVVT
FT                   LPGDIAGLEATGRTPLPATFRRATLTPDAASVRELADAINAAEKIAIFAGAGTQGAHDE
FT                   VVALAELIGAPIGHSLRGKDFMQYDNPYDIGMTGLLGYGAAAEGIEDADLLILLGTDFP
FT                   YDQFLPGTRTAQVDRAAHKLGRRTDVDIAVHGDVLPTLGALKPLLARKKNRRFLNQMLK
FT                   KHDRLMNKAVGAYTRKVEKKQPIHPEYAASILDQVAAENAIFTADTGMCNVWTARYINP
FT                   LGTRRLIGSYLHGSMANALPHAIGAQLAYPGRQVISVSGDGGLSMLLGELITVAAHRLP
FT                   VNVVVFNNSTLGMVKLEMLVDGLPDFGVDVPDADYAAVARALGFHAVRVTDPARIEDAY
FT                   REAFAHPGPSLVELITDPKALSIPPKITGSQVLGFATAMSKVVLNRGAGEAVSMARSNL
FT                   RNIPRR"
FT   gene            complement(636222..636611)
FT                   /locus_tag="Arth_0591"
FT   CDS_pept        complement(636222..636611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: deh:cbdb_A1151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01990"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH0"
FT                   /protein_id="ABK01990.1"
FT                   /translation="MAQHFDNVDEYIASFPAEVQGTLQEIRRRCHEAVPESGEVISYGI
FT                   PTITLNGKYVVYFAGWAHHISVYPVPAGDEAFEAAIAPYRAAKGTLKFPLGKPVPYELI
FT                   EKTAARLAAGRRGPQPPSDTQDGGR"
FT   gene            636881..638176
FT                   /locus_tag="Arth_0592"
FT   CDS_pept        636881..638176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0592"
FT                   /product="proteinase inhibitor I4, serpin"
FT                   /note="PFAM: proteinase inhibitor I4, serpin; KEGG:
FT                   det:DET0222 serine protease inhibitor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01991"
FT                   /db_xref="GOA:A0JSH1"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH1"
FT                   /protein_id="ABK01991.1"
FT                   /translation="MKTHRVARIATAGALAALTACSASSPELLKADGVERISVDGAAYA
FT                   AELRSFRASALGLGEALLADGGDGSKGNVVSSPGSLLIALAMLRAGASGETAAEMDSVL
FT                   KLPAEHRDEAMNALLSSLGKFDGDPGSVDEDNPPRKPVMHAANGLFVDKDVPTGDAFLE
FT                   TLARHYGTGVYPVDFSNEAATKPAIDAWVNRNTGGRIKEAPAKYDRDNTFSLLNSLYFA
FT                   SAWRAPFDPNDTSDLPFTTAAGEKIDAPAMHNELEMKYAEGAGWQGVDLPYADGFVMRL
FT                   VLPGTGVPGAGTGAGSPVFGAERLTDIADAFDRAPLETVQIQLPRWDHKCSFDLRKVFE
FT                   SLGLRKTLTTTEDFNNIQPGMMITQAAQAANITVAEKGTVAAAVTQINGAVTSAPPQPE
FT                   RTITFDRPFHYQIVHVETGLPLFMGTVADPRS"
FT   sig_peptide     636881..636949
FT                   /locus_tag="Arth_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.344 at
FT                   residue 23"
FT   gene            complement(638301..639143)
FT                   /locus_tag="Arth_0593"
FT   CDS_pept        complement(638301..639143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0593"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase type-1; KEGG:
FT                   pac:PPA1712 putative
FT                   hydroxymethylpyrimidine/phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01992"
FT                   /db_xref="GOA:A0JSH2"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH2"
FT                   /protein_id="ABK01992.1"
FT                   /translation="MTSAAVDTYPAVALTIAGSEATGGAGAQADLKTFQELGVFGIANL
FT                   TCIVSFNPNDNWNHRFVPVDQQVIADQLEATTAAYGAASGAPSVLDTVKIGMLGSPATI
FT                   STVASALAAGAFSNVVLDPVLICKGQEPGHALDTDQALKAQILPLATFVTPNHFEAESL
FT                   SGLEITDVESLKAAAIRIHELSGAAVLAKGGVRLAGPDAVDVYYDGDTLEILSAPKVGE
FT                   VAVSGAGCSLAAAVTAELAKGATPLEAARTAKAFVTAGIRNRVASGAPFDALWQGGPR"
FT   gene            complement(639638..640543)
FT                   /locus_tag="Arth_0594"
FT   CDS_pept        complement(639638..640543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   NAD-dependent epimerase/dehydratase; domain of unknown
FT                   function DUF1731; KEGG: bha:BH3889 cell-division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01993"
FT                   /db_xref="GOA:A0JSH3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH3"
FT                   /protein_id="ABK01993.1"
FT                   /translation="MNNPKTVVLAGASGFIGGYFRTRFEQDGWQVLAVGRSGADTVRWG
FT                   DHDGLTRALDGAELLVNLAGRSVDCRYSQRNKAQILESRVSTTAELGRAARRCSAPPAT
FT                   WLNASTGTIYRHAEDSPQSEHDGELGDGFSVDVARAWESALAAAETPSTRKVPLRISIV
FT                   LGPGGGVMRPFAALARLGLGGHMGGGSQKFSWVHVEDLYRSALFVHRRTDLTGPVNVAS
FT                   PEVVDNRELMRLVRRAYRVPFGLPTPGWLLELGAAMIRTETELVLKSRWIQPQKLLDAG
FT                   FIFRHAELGNALQDVTGRQA"
FT   gene            complement(640596..641252)
FT                   /locus_tag="Arth_0595"
FT   CDS_pept        complement(640596..641252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0595"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sma:SAV3407
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01994"
FT                   /db_xref="GOA:A0JSH4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041673"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH4"
FT                   /protein_id="ABK01994.1"
FT                   /translation="MARKSEQTRQLVADVALRMFREIGFEKTTMRAIATEAGVSVGNAY
FT                   YYFASKDELVQELYVQVQAEHAAKAAKALEGVKDLSGRLKATLHTGLDVMEPYHRFGAE
FT                   FIATAIRPTSPVNPFSGESMAARDASLAIFRNVVEGASPSVPRKFRAELPELLWLSYMG
FT                   AALFWVYDTSEDRRRTRKLVDGMAPLIARGLSLARIPGVNKVLGDVLSLSRGVRD"
FT   gene            641358..642191
FT                   /locus_tag="Arth_0596"
FT   CDS_pept        641358..642191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0596"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   pac:PPA0931 conserved protein, DUF165 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01995"
FT                   /db_xref="GOA:A0JSH5"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH5"
FT                   /protein_id="ABK01995.1"
FT                   /translation="MMRQWNTVPAAGRCGTPPSANTAGCCSDLLRDRSRAAARTTPNGS
FT                   PMTSAKTFPASAAPKFASIGSPYFGIMLAFMAVVLILSNIGASKGVAIGPIITDGGFFL
FT                   FPLAYILGDVISEVYGFAVARKAIITTFALSVFASACYWVIIALPGFDDEFGTSKQAAL
FT                   EGALGPVPQIVLASLLAFLAGQTINSWILVKMKARTGEKSLWARIMGSSVAGEFVDTLI
FT                   FCSIAASVIGITDAGSFVNYVLVGFLYKTLVEFLFVPVTASAIGWIKKREPSYGA"
FT   gene            complement(642271..643233)
FT                   /locus_tag="Arth_0597"
FT   CDS_pept        complement(642271..643233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0597"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01996"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH6"
FT                   /protein_id="ABK01996.1"
FT                   /translation="MIHESPPGANLWRTDQLLASGSNSRAIARLVQEGKLVRLRRGCYA
FT                   RGDWWRSLNATARRRQLIFAHSLGTLTTSAGRFAYSHVSGASLHGLQLWKVDDRVHLTR
FT                   EGSPSAVTHGRDVIAHTRPLGSRELCFVDGLPCTSLERTVVDCSLMFTVQQAVILVDHA
FT                   ARMGADLGLLRSQCSDLIGRNGVVALRRALELADPRSESAGESLTRELLHRLRITPPEL
FT                   QYQVRSPFGEHRLDFAWPERRVALEFDGKTKYFDYRPTGDVLFAERRREKALMEQGWTF
FT                   LRIEWKDLFNEVEFKYRVLAALNLGAGAGASPLRRFRAG"
FT   gene            complement(643401..644150)
FT                   /locus_tag="Arth_0598"
FT   CDS_pept        complement(643401..644150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0598"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: sco:SCO7359
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01997"
FT                   /db_xref="GOA:A0JSH7"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH7"
FT                   /protein_id="ABK01997.1"
FT                   /translation="MLIEIPAADGTAEALVARPSQGPGPWPGVILYMDAFGLRPRIQEM
FT                   AQRIADWGYVVLAPNTFYREGTAAEIEPHTDMTTPEGRAAAGKEAFPRVGRLTTDKAQP
FT                   DIDAWVAALRTLDGVAPGPIGTFGYCMGARLAVRTATTHPGVVAACAGFHGGGLATDAP
FT                   DSPHLGLGNASARFVFGHADHDQSMDADAVARLGRALDAAGLEATNEIYPGASHGYSMA
FT                   DTSAFHAEATERHFRELRALLDSTLKG"
FT   gene            complement(644258..645565)
FT                   /locus_tag="Arth_0599"
FT   CDS_pept        complement(644258..645565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0599"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: nfa:nfa2650 putative tRNA-guanine
FT                   transglycosylase; TIGRFAM: tRNA-guanine transglycosylases,
FT                   various specificities; queuine tRNA-ribosyltransferase;
FT                   PFAM: Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01998"
FT                   /db_xref="GOA:A0JSH8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH8"
FT                   /protein_id="ABK01998.1"
FT                   /translation="MPANTEPSLPPLEPGAAALQSEFSFTVGKRLSETCSPTPEQVAAN
FT                   GGELLGRTGTISTPHGEIQTPAFIAVGTKATVKSVLPESVAELGAQAVLANAYHLYLQP
FT                   GADILDEAGGLGAFMNWRGPTFTDSGGFQVMSLGSGFKKVIDMKSVDTSGPDDAVAPGK
FT                   ERLAHVDEEGVWFKSHLNGDRHRFSPEISMNVQHQIGADIMFAFDELTTLQNSRGYQEE
FT                   SLERTRRWAERCITEHFRLTESRLGKPYQALFGVIQGAQYEDLRRKACRDLGAMNFDGF
FT                   GIGGALEKENLGTIVRWCNEELPENKPRHLLGISEPDDIFTAIENGADTFDCVSPTRVA
FT                   RNSAFYHPEGRFNLSGAKYKRDFGPLQEGCDCYACLNYSRAYIHHLFKAKEMVSATLIS
FT                   IHNERFVVKMVDDARLAIEAGNFFDFKAETLGRYYS"
FT   gene            complement(645609..646280)
FT                   /locus_tag="Arth_0600"
FT   CDS_pept        complement(645609..646280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK01999"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSH9"
FT                   /protein_id="ABK01999.1"
FT                   /translation="MLREPAKVAQWHGWEADDLAAEINEIYFKDTVVEGPDHTSLTVDG
FT                   GDEFTLRPVPAGTEVSVTRAALDHNSEWAAWDEDITQSWLTFLQQLRFALEHHPHGKRR
FT                   TAFFSVPGGDGSAIDKLGLGDVPKPGEPYSLTLATGEEISGKVWYRTNHQVGLTVHSYA
FT                   EHGDGLLIVADQPPIAEIRPDGGSMVIVSTYDLGAHRLEEIRNSWDSWRAENYPTSDPV
FT                   H"
FT   gene            complement(646412..647482)
FT                   /locus_tag="Arth_0601"
FT   CDS_pept        complement(646412..647482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0601"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3688 response regulator receiver
FT                   domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK02000"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSI0"
FT                   /protein_id="ABK02000.1"
FT                   /translation="MTHRPAAQHYNELQAGSLQAGHLLLLPDGERSAEIQSVLVEDDDF
FT                   GTPAVVLATLTGGGILRIAAGSTVLVAGSGAGMEAASPGGTAANAGGEETAVSEESDAA
FT                   TPLQLVEPPAARAESAGEAAAPAAPAVVVPPLPATTPAAAPAAGPSAEELALIPEPAGT
FT                   PESVVESVASAHPDAVGVMLLSDRLAKGINTKSGSCLKDLNDLAHELFVALKDAEGALA
FT                   VADLLNVLPFDGNPGRWTSVEAALALSSYICRQTGQEERAEVYEKLLRAPDAMETDPFK
FT                   ARMNAKVRQRSLNEPNLYDKEIFRAIDNSNPDAEREWRLLRLEALMFLRAHGGSETIGL
FT                   KELERRIGNELESVRA"
FT   gene            complement(647591..648130)
FT                   /locus_tag="Arth_0602"
FT   CDS_pept        complement(647591..648130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arth_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lxx:Lxx20800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arth_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK02001"
FT                   /db_xref="GOA:A0JSI1"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR032582"
FT                   /db_xref="UniProtKB/TrEMBL:A0JSI1"
FT                   /protein_id="ABK02001.1"
FT                   /translation="MNVRTPDPNPGWLSDEDLFEARGRLPMVYVEAVPVRLDPLGFVNE
FT                   VGTLLQADEDGTMIRSLVSGRVLYRETIRAALLRHMEKDLGPLAFPQLPISPVPFTVAE
FT                   YFPAPSHTGFTDDRQHAVSLAYIIPVTGECEPRQDALELTWMTPEEVLSPDVQLEFSGG
FT                   RGVLVRQALAFAGVGS"
FT   gene