(data stored in ACNUC7421 zone)

EMBL: CP000458

ID   CP000458; SV 1; circular; genomic DNA; STD; PRO; 3483902 BP.
XX
AC   CP000458; AAHL01000000-AAHL01000333;
XX
PR   Project:PRJNA13918;
XX
DT   03-NOV-2006 (Rel. 89, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 6)
XX
DE   Burkholderia cenocepacia HI2424 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Burkholderia cenocepacia HI2424
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-3483902
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., LiPuma J.J., Gonzalez C.F.,
RA   Konstantinidis K., Tiedje J.M., Richardson P.;
RT   "Complete sequence of Chromosome 1 of Burkholderia cenocepacia HI2424";
RL   Unpublished.
XX
RN   [2]
RP   1-3483902
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., LiPuma J.J., Gonzalez C.F.,
RA   Konstantinidis K., Tiedje J.M., Richardson P.;
RT   ;
RL   Submitted (30-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; bcf5e6736a9e57b8167f170ef8e862f2.
DR   BioSample; SAMN00113327.
DR   EnsemblGenomes-Gn; Bcen2424_R0001.
DR   EnsemblGenomes-Gn; Bcen2424_R0002.
DR   EnsemblGenomes-Gn; Bcen2424_R0003.
DR   EnsemblGenomes-Gn; Bcen2424_R0004.
DR   EnsemblGenomes-Gn; Bcen2424_R0005.
DR   EnsemblGenomes-Gn; Bcen2424_R0006.
DR   EnsemblGenomes-Gn; Bcen2424_R0007.
DR   EnsemblGenomes-Gn; Bcen2424_R0008.
DR   EnsemblGenomes-Gn; Bcen2424_R0009.
DR   EnsemblGenomes-Gn; Bcen2424_R0010.
DR   EnsemblGenomes-Gn; Bcen2424_R0011.
DR   EnsemblGenomes-Gn; Bcen2424_R0012.
DR   EnsemblGenomes-Gn; Bcen2424_R0013.
DR   EnsemblGenomes-Gn; Bcen2424_R0014.
DR   EnsemblGenomes-Gn; Bcen2424_R0015.
DR   EnsemblGenomes-Gn; Bcen2424_R0016.
DR   EnsemblGenomes-Gn; Bcen2424_R0017.
DR   EnsemblGenomes-Gn; Bcen2424_R0018.
DR   EnsemblGenomes-Gn; Bcen2424_R0019.
DR   EnsemblGenomes-Gn; Bcen2424_R0020.
DR   EnsemblGenomes-Gn; Bcen2424_R0021.
DR   EnsemblGenomes-Gn; Bcen2424_R0023.
DR   EnsemblGenomes-Gn; Bcen2424_R0024.
DR   EnsemblGenomes-Gn; Bcen2424_R0025.
DR   EnsemblGenomes-Gn; Bcen2424_R0026.
DR   EnsemblGenomes-Gn; Bcen2424_R0027.
DR   EnsemblGenomes-Gn; Bcen2424_R0028.
DR   EnsemblGenomes-Gn; Bcen2424_R0029.
DR   EnsemblGenomes-Gn; Bcen2424_R0030.
DR   EnsemblGenomes-Gn; Bcen2424_R0031.
DR   EnsemblGenomes-Gn; Bcen2424_R0032.
DR   EnsemblGenomes-Gn; Bcen2424_R0033.
DR   EnsemblGenomes-Gn; Bcen2424_R0034.
DR   EnsemblGenomes-Gn; Bcen2424_R0035.
DR   EnsemblGenomes-Gn; Bcen2424_R0036.
DR   EnsemblGenomes-Gn; Bcen2424_R0037.
DR   EnsemblGenomes-Gn; Bcen2424_R0038.
DR   EnsemblGenomes-Gn; Bcen2424_R0039.
DR   EnsemblGenomes-Gn; Bcen2424_R0040.
DR   EnsemblGenomes-Gn; Bcen2424_R0041.
DR   EnsemblGenomes-Gn; Bcen2424_R0042.
DR   EnsemblGenomes-Gn; Bcen2424_R0043.
DR   EnsemblGenomes-Gn; Bcen2424_R0044.
DR   EnsemblGenomes-Gn; Bcen2424_R0045.
DR   EnsemblGenomes-Gn; Bcen2424_R0047.
DR   EnsemblGenomes-Gn; Bcen2424_R0048.
DR   EnsemblGenomes-Gn; Bcen2424_R0049.
DR   EnsemblGenomes-Gn; Bcen2424_R0050.
DR   EnsemblGenomes-Gn; Bcen2424_R0051.
DR   EnsemblGenomes-Gn; Bcen2424_R0052.
DR   EnsemblGenomes-Gn; Bcen2424_R0053.
DR   EnsemblGenomes-Gn; Bcen2424_R0054.
DR   EnsemblGenomes-Gn; Bcen2424_R0055.
DR   EnsemblGenomes-Gn; Bcen2424_R0056.
DR   EnsemblGenomes-Gn; Bcen2424_R0057.
DR   EnsemblGenomes-Gn; Bcen2424_R0058.
DR   EnsemblGenomes-Gn; Bcen2424_R0059.
DR   EnsemblGenomes-Gn; Bcen2424_R0060.
DR   EnsemblGenomes-Gn; Bcen2424_R0061.
DR   EnsemblGenomes-Gn; Bcen2424_R0062.
DR   EnsemblGenomes-Gn; Bcen2424_R0063.
DR   EnsemblGenomes-Gn; Bcen2424_R0064.
DR   EnsemblGenomes-Gn; Bcen2424_R0065.
DR   EnsemblGenomes-Gn; Bcen2424_R0066.
DR   EnsemblGenomes-Gn; Bcen2424_R0067.
DR   EnsemblGenomes-Gn; Bcen2424_R0068.
DR   EnsemblGenomes-Gn; Bcen2424_R0069.
DR   EnsemblGenomes-Gn; Bcen2424_R0070.
DR   EnsemblGenomes-Gn; Bcen2424_R0071.
DR   EnsemblGenomes-Gn; Bcen2424_R0072.
DR   EnsemblGenomes-Gn; Bcen2424_R0073.
DR   EnsemblGenomes-Gn; EBG00001021675.
DR   EnsemblGenomes-Gn; EBG00001021679.
DR   EnsemblGenomes-Gn; EBG00001021681.
DR   EnsemblGenomes-Gn; EBG00001021683.
DR   EnsemblGenomes-Gn; EBG00001021684.
DR   EnsemblGenomes-Gn; EBG00001021685.
DR   EnsemblGenomes-Gn; EBG00001021686.
DR   EnsemblGenomes-Gn; EBG00001021687.
DR   EnsemblGenomes-Gn; EBG00001021688.
DR   EnsemblGenomes-Gn; EBG00001021689.
DR   EnsemblGenomes-Gn; EBG00001021690.
DR   EnsemblGenomes-Gn; EBG00001021691.
DR   EnsemblGenomes-Gn; EBG00001021692.
DR   EnsemblGenomes-Gn; EBG00001021693.
DR   EnsemblGenomes-Gn; EBG00001021694.
DR   EnsemblGenomes-Gn; EBG00001021695.
DR   EnsemblGenomes-Gn; EBG00001021696.
DR   EnsemblGenomes-Gn; EBG00001021697.
DR   EnsemblGenomes-Gn; EBG00001021698.
DR   EnsemblGenomes-Gn; EBG00001021699.
DR   EnsemblGenomes-Gn; EBG00001021700.
DR   EnsemblGenomes-Gn; EBG00001021701.
DR   EnsemblGenomes-Gn; EBG00001021702.
DR   EnsemblGenomes-Gn; EBG00001021703.
DR   EnsemblGenomes-Gn; EBG00001021704.
DR   EnsemblGenomes-Gn; EBG00001021705.
DR   EnsemblGenomes-Gn; EBG00001021706.
DR   EnsemblGenomes-Gn; EBG00001021707.
DR   EnsemblGenomes-Gn; EBG00001021708.
DR   EnsemblGenomes-Gn; EBG00001021709.
DR   EnsemblGenomes-Gn; EBG00001021710.
DR   EnsemblGenomes-Gn; EBG00001021711.
DR   EnsemblGenomes-Gn; EBG00001021712.
DR   EnsemblGenomes-Gn; EBG00001021713.
DR   EnsemblGenomes-Gn; EBG00001021714.
DR   EnsemblGenomes-Gn; EBG00001021715.
DR   EnsemblGenomes-Gn; EBG00001021716.
DR   EnsemblGenomes-Gn; EBG00001021717.
DR   EnsemblGenomes-Gn; EBG00001021718.
DR   EnsemblGenomes-Gn; EBG00001021719.
DR   EnsemblGenomes-Gn; EBG00001021720.
DR   EnsemblGenomes-Gn; EBG00001021721.
DR   EnsemblGenomes-Gn; EBG00001021722.
DR   EnsemblGenomes-Gn; EBG00001021723.
DR   EnsemblGenomes-Gn; EBG00001021724.
DR   EnsemblGenomes-Gn; EBG00001021725.
DR   EnsemblGenomes-Gn; EBG00001021726.
DR   EnsemblGenomes-Gn; EBG00001021727.
DR   EnsemblGenomes-Gn; EBG00001021728.
DR   EnsemblGenomes-Gn; EBG00001021729.
DR   EnsemblGenomes-Gn; EBG00001021730.
DR   EnsemblGenomes-Gn; EBG00001021731.
DR   EnsemblGenomes-Gn; EBG00001021732.
DR   EnsemblGenomes-Gn; EBG00001021733.
DR   EnsemblGenomes-Gn; EBG00001021734.
DR   EnsemblGenomes-Gn; EBG00001021735.
DR   EnsemblGenomes-Gn; EBG00001021736.
DR   EnsemblGenomes-Gn; EBG00001021737.
DR   EnsemblGenomes-Gn; EBG00001021738.
DR   EnsemblGenomes-Gn; EBG00001021739.
DR   EnsemblGenomes-Gn; EBG00001021740.
DR   EnsemblGenomes-Gn; EBG00001021741.
DR   EnsemblGenomes-Gn; EBG00001021742.
DR   EnsemblGenomes-Gn; EBG00001021743.
DR   EnsemblGenomes-Gn; EBG00001021744.
DR   EnsemblGenomes-Gn; EBG00001021745.
DR   EnsemblGenomes-Gn; EBG00001021746.
DR   EnsemblGenomes-Gn; EBG00001021747.
DR   EnsemblGenomes-Gn; EBG00001021748.
DR   EnsemblGenomes-Gn; EBG00001021749.
DR   EnsemblGenomes-Gn; EBG00001021750.
DR   EnsemblGenomes-Gn; EBG00001021751.
DR   EnsemblGenomes-Gn; EBG00001021752.
DR   EnsemblGenomes-Gn; EBG00001021753.
DR   EnsemblGenomes-Gn; EBG00001021754.
DR   EnsemblGenomes-Gn; EBG00001021755.
DR   EnsemblGenomes-Gn; EBG00001021756.
DR   EnsemblGenomes-Gn; EBG00001021757.
DR   EnsemblGenomes-Gn; EBG00001021758.
DR   EnsemblGenomes-Gn; EBG00001021759.
DR   EnsemblGenomes-Gn; EBG00001021760.
DR   EnsemblGenomes-Gn; EBG00001021761.
DR   EnsemblGenomes-Gn; EBG00001021762.
DR   EnsemblGenomes-Gn; EBG00001021763.
DR   EnsemblGenomes-Gn; EBG00001021764.
DR   EnsemblGenomes-Gn; EBG00001021765.
DR   EnsemblGenomes-Gn; EBG00001021766.
DR   EnsemblGenomes-Gn; EBG00001021767.
DR   EnsemblGenomes-Gn; EBG00001021768.
DR   EnsemblGenomes-Gn; EBG00001021769.
DR   EnsemblGenomes-Gn; EBG00001021770.
DR   EnsemblGenomes-Gn; EBG00001021771.
DR   EnsemblGenomes-Gn; EBG00001021772.
DR   EnsemblGenomes-Gn; EBG00001021773.
DR   EnsemblGenomes-Gn; EBG00001021774.
DR   EnsemblGenomes-Gn; EBG00001021775.
DR   EnsemblGenomes-Gn; EBG00001021776.
DR   EnsemblGenomes-Gn; EBG00001021777.
DR   EnsemblGenomes-Gn; EBG00001021778.
DR   EnsemblGenomes-Tr; Bcen2424_R0001-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0002-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0003-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0004-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0005-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0006-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0007-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0008-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0009-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0010-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0011-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0012-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0013-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0014-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0015-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0016-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0017-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0018-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0019-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0020-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0021-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0023-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0024-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0025-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0026-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0027-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0028-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0029-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0030-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0031-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0032-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0033-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0034-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0035-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0036-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0037-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0038-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0039-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0040-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0041-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0042-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0043-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0044-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0045-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0047-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0048-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0049-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0050-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0051-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0052-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0053-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0054-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0055-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0056-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0057-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0058-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0059-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0060-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0061-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0062-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0063-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0064-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0065-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0066-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0067-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0068-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0069-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0070-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0071-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0072-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0073-1.
DR   EnsemblGenomes-Tr; EBT00001624097.
DR   EnsemblGenomes-Tr; EBT00001624098.
DR   EnsemblGenomes-Tr; EBT00001624099.
DR   EnsemblGenomes-Tr; EBT00001624100.
DR   EnsemblGenomes-Tr; EBT00001624101.
DR   EnsemblGenomes-Tr; EBT00001624102.
DR   EnsemblGenomes-Tr; EBT00001624103.
DR   EnsemblGenomes-Tr; EBT00001624104.
DR   EnsemblGenomes-Tr; EBT00001624105.
DR   EnsemblGenomes-Tr; EBT00001624106.
DR   EnsemblGenomes-Tr; EBT00001624107.
DR   EnsemblGenomes-Tr; EBT00001624108.
DR   EnsemblGenomes-Tr; EBT00001624109.
DR   EnsemblGenomes-Tr; EBT00001624110.
DR   EnsemblGenomes-Tr; EBT00001624111.
DR   EnsemblGenomes-Tr; EBT00001624112.
DR   EnsemblGenomes-Tr; EBT00001624113.
DR   EnsemblGenomes-Tr; EBT00001624114.
DR   EnsemblGenomes-Tr; EBT00001624115.
DR   EnsemblGenomes-Tr; EBT00001624116.
DR   EnsemblGenomes-Tr; EBT00001624117.
DR   EnsemblGenomes-Tr; EBT00001624118.
DR   EnsemblGenomes-Tr; EBT00001624119.
DR   EnsemblGenomes-Tr; EBT00001624120.
DR   EnsemblGenomes-Tr; EBT00001624121.
DR   EnsemblGenomes-Tr; EBT00001624122.
DR   EnsemblGenomes-Tr; EBT00001624123.
DR   EnsemblGenomes-Tr; EBT00001624124.
DR   EnsemblGenomes-Tr; EBT00001624125.
DR   EnsemblGenomes-Tr; EBT00001624126.
DR   EnsemblGenomes-Tr; EBT00001624127.
DR   EnsemblGenomes-Tr; EBT00001624128.
DR   EnsemblGenomes-Tr; EBT00001624129.
DR   EnsemblGenomes-Tr; EBT00001624130.
DR   EnsemblGenomes-Tr; EBT00001624131.
DR   EnsemblGenomes-Tr; EBT00001624132.
DR   EnsemblGenomes-Tr; EBT00001624133.
DR   EnsemblGenomes-Tr; EBT00001624134.
DR   EnsemblGenomes-Tr; EBT00001624135.
DR   EnsemblGenomes-Tr; EBT00001624136.
DR   EnsemblGenomes-Tr; EBT00001624137.
DR   EnsemblGenomes-Tr; EBT00001624138.
DR   EnsemblGenomes-Tr; EBT00001624139.
DR   EnsemblGenomes-Tr; EBT00001624140.
DR   EnsemblGenomes-Tr; EBT00001624141.
DR   EnsemblGenomes-Tr; EBT00001624142.
DR   EnsemblGenomes-Tr; EBT00001624143.
DR   EnsemblGenomes-Tr; EBT00001624144.
DR   EnsemblGenomes-Tr; EBT00001624145.
DR   EnsemblGenomes-Tr; EBT00001624146.
DR   EnsemblGenomes-Tr; EBT00001624147.
DR   EnsemblGenomes-Tr; EBT00001624148.
DR   EnsemblGenomes-Tr; EBT00001624149.
DR   EnsemblGenomes-Tr; EBT00001624150.
DR   EnsemblGenomes-Tr; EBT00001624151.
DR   EnsemblGenomes-Tr; EBT00001624152.
DR   EnsemblGenomes-Tr; EBT00001624153.
DR   EnsemblGenomes-Tr; EBT00001624154.
DR   EnsemblGenomes-Tr; EBT00001624155.
DR   EnsemblGenomes-Tr; EBT00001624156.
DR   EnsemblGenomes-Tr; EBT00001624157.
DR   EnsemblGenomes-Tr; EBT00001624158.
DR   EnsemblGenomes-Tr; EBT00001624159.
DR   EnsemblGenomes-Tr; EBT00001624160.
DR   EnsemblGenomes-Tr; EBT00001624161.
DR   EnsemblGenomes-Tr; EBT00001624162.
DR   EnsemblGenomes-Tr; EBT00001624163.
DR   EnsemblGenomes-Tr; EBT00001624164.
DR   EnsemblGenomes-Tr; EBT00001624165.
DR   EnsemblGenomes-Tr; EBT00001624166.
DR   EnsemblGenomes-Tr; EBT00001624167.
DR   EnsemblGenomes-Tr; EBT00001624168.
DR   EnsemblGenomes-Tr; EBT00001624169.
DR   EnsemblGenomes-Tr; EBT00001624170.
DR   EnsemblGenomes-Tr; EBT00001624171.
DR   EnsemblGenomes-Tr; EBT00001624172.
DR   EnsemblGenomes-Tr; EBT00001624173.
DR   EnsemblGenomes-Tr; EBT00001624174.
DR   EnsemblGenomes-Tr; EBT00001624175.
DR   EnsemblGenomes-Tr; EBT00001624176.
DR   EnsemblGenomes-Tr; EBT00001624177.
DR   EnsemblGenomes-Tr; EBT00001624178.
DR   EnsemblGenomes-Tr; EBT00001624179.
DR   EnsemblGenomes-Tr; EBT00001624180.
DR   EnsemblGenomes-Tr; EBT00001624181.
DR   EnsemblGenomes-Tr; EBT00001624182.
DR   EnsemblGenomes-Tr; EBT00001624183.
DR   EnsemblGenomes-Tr; EBT00001624184.
DR   EnsemblGenomes-Tr; EBT00001624185.
DR   EnsemblGenomes-Tr; EBT00001624186.
DR   EnsemblGenomes-Tr; EBT00001624187.
DR   EnsemblGenomes-Tr; EBT00001624188.
DR   EnsemblGenomes-Tr; EBT00001624189.
DR   EnsemblGenomes-Tr; EBT00001624190.
DR   EnsemblGenomes-Tr; EBT00001624191.
DR   EnsemblGenomes-Tr; EBT00001624192.
DR   EnsemblGenomes-Tr; EBT00001624193.
DR   EnsemblGenomes-Tr; EBT00001624194.
DR   EnsemblGenomes-Tr; EBT00001624195.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC4029289; 24883196.
DR   EuropePMC; PMC4143217; 25153194.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000458.
DR   SILVA-SSU; CP000458.
DR   StrainInfo; 844880; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635681
CC   Source DNA and bacteria available from James M. Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3483902
FT                   /organism="Burkholderia cenocepacia HI2424"
FT                   /chromosome="1"
FT                   /strain="HI2424"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:331272"
FT   gene            178..1755
FT                   /locus_tag="Bcen2424_0001"
FT   CDS_pept        178..1755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bcn:Bcen_2553 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06755"
FT                   /db_xref="GOA:A0K2M8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2M8"
FT                   /protein_id="ABK06755.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDASANTLSIAAP
FT                   NRFKLDWVKSQFSGRISDLAREFWNTPIEVQFVLDPKAGMRSAAASAAPAAPRAPLTPG
FT                   GPAATVAAIAANLTANAAAAPSAPADVPMTPSAAAAHHLNADDADIDLPSLPAHEAAAG
FT                   RRTWRPGPGAAPANGGEADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGIS
FT                   YNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKAFDDFK
FT                   RYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRL
FT                   ISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVNLSEDVAFFVAKHLRSNVRELEGALR
FT                   KILAYSKFHGREISIELTKEALKDLLTVQNRQISVENIQKTVADFYNIKVADMYSKKRP
FT                   ANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELH
FT                   VLEQTLKG"
FT   gene            1926..3032
FT                   /locus_tag="Bcen2424_0002"
FT   CDS_pept        1926..3032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bcn:Bcen_2554 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06756"
FT                   /protein_id="ABK06756.1"
FT                   /translation="MQLVKTERDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGDQIATTVAARKLLDILRAMPDGQVTLSLADKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDFGATLTVPQKSFRQLLGMVHFAMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAFSSMKLEGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQ
FT                   TQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRAAILTSDKFK
FT                   GVRCIIAPGQLKIMSTNADQEEAQEELEIAYQGDTVDIGFNVTYLLDVLANLKVDTVQV
FT                   SLGDASSSALITVPENDEFKYVVMPMRI"
FT   gene            3224..5698
FT                   /locus_tag="Bcen2424_0003"
FT   CDS_pept        3224..5698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bcn:Bcen_2555 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06757"
FT                   /protein_id="ABK06757.1"
FT                   /translation="MSEQHNSQPDNSSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGL
FT                   HHLVFEVLDNSIDEALAGYCNDIHVTIHADNSISVTDNGRGIPTDVKMNDKHEPKRSAA
FT                   EIVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSSWLRLTVRRDGKKRFMEFHRGVA
FT                   QDRVLEVVDGVEVSPMLVTGDTENRGTEVHFMADPTIFGTVEYHYDILAKRMRELSFLN
FT                   NGVRIRLTDLRSGKEDDFAFAGGVKGFVEYINKTKTNLHPTVFFANGEKDGVGVEVAMQ
FT                   WNDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYITDNEIAKKAKVETTGDDMR
FT                   EGLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPIDAKIICGKI
FT                   VEAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKCEIYIVEGDSAGGSAKQ
FT                   GRDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLVTALGCGIGKEDYNLDKLRYHRI
FT                   IIMTDADVDGAHIRTLLLTFLYRQMPDMIERGYVYIAQPPLYKIKAGKDERYLKDDVEL
FT                   NAHMLRLALQGSELVPGENAAAISGDALGELARSYLLSQSVIDRLSRLYDPAALEAVMD
FT                   GVVIDLSNEESTEASAKALHAALHDEALKNEVRVVPSYDAVREQRALHVERTHHGNVRV
FT                   SVIDQEFQHTADYQQLVTTANTFKGLIGEGAVIKRGERSMAVADFKSAMKWLLADAERN
FT                   VSKQRYKGLGEMNPEQLWETTMDPAVRRLLRVQIEDAIAADGIFTTLMGDDVEPRRAFI
FT                   ESNALRAGNIDV"
FT   gene            6509..8014
FT                   /locus_tag="Bcen2424_0004"
FT   CDS_pept        6509..8014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0004"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4956 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06758"
FT                   /protein_id="ABK06758.1"
FT                   /translation="MGILAKIRRMYFREKVPLREIARRTGLSRNTVRRWLRQTDAVEPK
FT                   YPKRVSPSVIDDWAAQLTGWLRADSHRPKRDRRTARFMFEAIRAEGYAGSYGRVSAFVR
FT                   RWHEEQAEAPRRKAFVPLAFEPGEAFQFDWSCEYAFVGGLRRRLEVAHVKLNSSRAFWL
FT                   VAYPTQSHEMLFDAHARAFAAFGGVPRRGIYDNMKTAVDKVGRGKERAVNARFEAMCSH
FT                   YLFEPEFCNRAAGWEKGIVEKNVQDRRRQIWHEASLRRWETLEILNEWVAGQCREAWHM
FT                   RHPQWPELTVEDVLQDERTRLMPNPRPFDGYVEQTLRVSSTSLIHFQRNRYSVPTEYTN
FT                   QLVSVRCYPAYLSVVVNAQEIARHERSFERHMTFYDWRHYITLVERKPGALRNGAPFIT
FT                   MPQPLQLLQRHLLKHPGGDRVMTQVLAAVREHGLDAVLLAVQAALDSGRPSAEHVLNVL
FT                   SRLKAPVTNGRLATTKLQLKEEPAADVGRYETLRANPPEDRHV"
FT   gene            8007..8804
FT                   /locus_tag="Bcen2424_0005"
FT   CDS_pept        8007..8804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0005"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bcn:Bcen_4955 IstB-like
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06759"
FT                   /protein_id="ABK06759.1"
FT                   /translation="MSNDIAAQLKGLKLHGMASTWPELLAQSRHTDFEPERFMKQLLMA
FT                   ETAERQVRSIAYQMTAARFPAHRDLKGFDFAQAHVDEALVRELSELSFLASAHNVVFIG
FT                   GPGTGKTHLASAIGIEAVQRHGKRVRYFSTVELTNALEQEKSIGKQGQIAHKLMYVDLV
FT                   ILDELGYLPFSQTGGALLFHLLSKLYEHTSVAITTNLSFGEWASVFGDAKMTTALLDRV
FT                   THHCHIVETGNESWRFRTSSAKAKTTRKRAEKPAGNEELSTPE"
FT   gene            complement(8871..8987)
FT                   /locus_tag="Bcen2424_0006"
FT   CDS_pept        complement(8871..8987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0006"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /note="KEGG: bcn:Bcen_2558 DNA
FT                   (cytosine-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06760"
FT                   /protein_id="ABK06760.1"
FT                   /translation="MGFEAHGGECVFTSEWNDFSKKTYLENYGDRHPFVGDC"
FT   gene            9308..9568
FT                   /locus_tag="Bcen2424_0007"
FT   CDS_pept        9308..9568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0007"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bcn:Bcen_2559 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06761"
FT                   /protein_id="ABK06761.1"
FT                   /translation="MKKRFTEEQIIGILKEAEAGLKPAELCRKYGISEATYYNWKAKFG
FT                   GMTVSEAQRLKELEQENNKLKRLLAESMLDNAALKDLLARK"
FT   gene            9607..9924
FT                   /locus_tag="Bcen2424_0008"
FT   CDS_pept        9607..9924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0008"
FT                   /product="putative insertion element protein"
FT                   /note="KEGG: bcn:Bcen_2560 putative insertion element
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06762"
FT                   /protein_id="ABK06762.1"
FT                   /translation="MTERAMGVTRACGLVGISRSLFHYESRRRVDDEALTGRMMAIAAQ
FT                   KRRYGYRRIHVLLQRDGCFANHKRIWRLYSKAGLSVRKRRRKRIAAVERTPLPLAIRHE
FT                   V"
FT   gene            complement(10007..10119)
FT                   /locus_tag="Bcen2424_R0001"
FT   rRNA            complement(10007..10119)
FT                   /locus_tag="Bcen2424_R0001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(10273..13154)
FT                   /locus_tag="Bcen2424_R0002"
FT   rRNA            complement(10273..13154)
FT                   /locus_tag="Bcen2424_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(13546..15023)
FT                   /locus_tag="Bcen2424_R0003"
FT   rRNA            complement(13546..15023)
FT                   /locus_tag="Bcen2424_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(15657..16187)
FT                   /locus_tag="Bcen2424_0009"
FT   CDS_pept        complement(15657..16187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0009"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: bcn:Bcen_0062
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06763"
FT                   /protein_id="ABK06763.1"
FT                   /translation="MKASTTFSLPARVLHWVMAAMILAMLFIGVGMVASVSGRHEILVA
FT                   IHKPLGVAVLVLVCVRIVVRMLSKPPALPEDLPWWQKVAAHGSHLVLYALMVAMPLIGW
FT                   AMLSAGGYPVTLGGGVQLPALVSADPVTFAWLRVAHRVLAYLFFLTFLAHFAAALYHGL
FT                   IRRDGVVRAMVGR"
FT   sig_peptide     complement(16086..16187)
FT                   /locus_tag="Bcen2424_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.500 at
FT                   residue 34"
FT   gene            complement(16187..17272)
FT                   /locus_tag="Bcen2424_0010"
FT   CDS_pept        complement(16187..17272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0010"
FT                   /product="Catalase domain protein"
FT                   /note="PFAM: Catalase domain protein; KEGG: bcn:Bcen_0061
FT                   catalase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06764"
FT                   /protein_id="ABK06764.1"
FT                   /translation="MKQSSSSPQREPGRGWWRWAVIGGAVAGVAAAFGYAGGWLAPARL
FT                   TPHRLVDALQTNSGIHPGYRRNHAKGVCVTGYFEGNGAASAYSVAPFFKAVRTPVVGRF
FT                   ALPGGNPYAPDSSVPIRSLALKLTAPDGQQWRTGMNAMPVFPVATPQAFYEQTLATRPD
FT                   PKTGKPDPAKVKAFFGAHPEAGAFLQWVKGAKPSASYVTESYYGLNAFYFVDVAGKRQA
FT                   VRWRVVPEQTAGAGDVATAADPNVLQQDVTQRIAAGPQKWKLLVTLAEPGDPVDDATKI
FT                   WPAQRTTIDAGTLVLDRVEAQDSGPCRDVNYDPTVLPQGIQVSGDPLLAARSAAYADSY
FT                   LRRTSEEAGVAGVARVSGEGR"
FT   gene            17431..17952
FT                   /locus_tag="Bcen2424_0011"
FT   CDS_pept        17431..17952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0011"
FT                   /product="RNA polymerase, sigma-24 subunit, RpoE"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   bcn:Bcen_0060 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06765"
FT                   /protein_id="ABK06765.1"
FT                   /translation="MPSTALDDEALRELIPRLRRFALWLARDVHAADDLVQSTLERALS
FT                   RWTSRRDDASLRSWLFTILYRQFLDGKRSAKRYSWLLGRIRDDDEAHWPSAEREFAARA
FT                   TLEAFGRLSDEQRSLLLLVAVEGFTYQEVADLLEVPIGTVMSRLSRARQALRQLSDGEL
FT                   PAPSLRLMKK"
FT   gene            17949..18707
FT                   /locus_tag="Bcen2424_0012"
FT   CDS_pept        17949..18707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0012"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: bcn:Bcen_0059 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06766"
FT                   /protein_id="ABK06766.1"
FT                   /translation="MNTPPNEHDLQAYVDGQLDDDARAAVERYLALHPERAEQVKQWQQ
FT                   DAQRLRAALESVRMPADNPALDPAAIRGRRAERARMRFAMAASFVFCVGLGTFGGWQAR
FT                   GWNAPPPIAPMSDAVKAYQMMVVDRTAKVDYRPTGAGDLQGWLTKGVGASAKLPDLSAA
FT                   GFRPVGGRLFTTDSGATAAMVLYQDDAGRTLSFYLRPAESKHRLLPNGQRVDGALLARY
FT                   GSVNGLNYAVVGPAGSLGEKAVVQALDQQT"
FT   gene            19024..19350
FT                   /locus_tag="Bcen2424_0013"
FT   CDS_pept        19024..19350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06767"
FT                   /protein_id="ABK06767.1"
FT                   /translation="MTDRLRRVRLRSPVECTGFRVASSQRYPQGIRRPDVATDSFAALF
FT                   HGRQSLAGQRIQADEPIETGTLTARMHRVSTGSCAGYPHTAAYASGHFVPTLPRISPVS
FT                   GAMT"
FT   gene            complement(19296..19613)
FT                   /locus_tag="Bcen2424_0014"
FT   CDS_pept        complement(19296..19613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06768"
FT                   /protein_id="ABK06768.1"
FT                   /translation="MSTLNFGTVDQCSVTLNTATLLGLKAAYEDFAATGQDLHNFEICI
FT                   TDKRASTVDPMPDDDVVTITFVAKLIPGMRGLGNANRLGKSIHYVIAPETGEILGRVGT
FT                   K"
FT   gene            complement(19796..20053)
FT                   /locus_tag="Bcen2424_0015"
FT   CDS_pept        complement(19796..20053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06769"
FT                   /protein_id="ABK06769.1"
FT                   /translation="MTYTVLMVSRGEIVLSDGKRTVRAPGEALSSGVDNGPAFVVYVDS
FT                   MKYVEPQGDGETIDNATREAVISAITDYFLSRRTTVDFES"
FT   gene            complement(20072..20401)
FT                   /locus_tag="Bcen2424_0016"
FT   CDS_pept        complement(20072..20401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06770"
FT                   /protein_id="ABK06770.1"
FT                   /translation="MKAPVNEMLVTDIAGRVAVVVTELTAAADVLKQLGFAQQSDRWER
FT                   AIADDHDRQALVAALIDLDVLFSAGRDWSPQALVEYYREIGVVRSGYRSVAWRGPSQYV
FT                   VERHD"
FT   gene            complement(20433..20693)
FT                   /locus_tag="Bcen2424_0017"
FT   CDS_pept        complement(20433..20693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06771"
FT                   /protein_id="ABK06771.1"
FT                   /translation="MTNASSPRLQALDIDTVVRRMQHHRGDIVFEQRVLIPEAEVLCCR
FT                   YEGERFNVKFDLDYGMFVERVGMLSAEDVAKIVGWLTKEAG"
FT   gene            21288..21364
FT                   /locus_tag="Bcen2424_R0004"
FT                   /note="tRNA-Val1"
FT   tRNA            21288..21364
FT                   /locus_tag="Bcen2424_R0004"
FT                   /product="tRNA-Val"
FT   gene            21686..22201
FT                   /locus_tag="Bcen2424_0018"
FT   CDS_pept        21686..22201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06772"
FT                   /protein_id="ABK06772.1"
FT                   /translation="MSEVTTAASSASNDEIAAYVGKNAAWFERKWAIADSRKSRQSWNW
FT                   AACFLGPVWLAYRCMYWQAAAVLAVTLGITLIELLYFPGYFESSVLDPATIAIAVSLGW
FT                   YGNGLYKRHVERQIGKLRPNATSRESFLALLEAQGGTNWLAAAGFAVATPLLGVLLFMM
FT                   GNAGGAMY"
FT   gene            complement(22304..23185)
FT                   /locus_tag="Bcen2424_0019"
FT   CDS_pept        complement(22304..23185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0019"
FT                   /product="RNA polymerase, sigma-24 subunit, RpoE"
FT                   /note="PFAM: sigma-70 region 2 domain protein; Sigma-70,
FT                   region 4 type 2; KEGG: bcn:Bcen_0051 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06773"
FT                   /protein_id="ABK06773.1"
FT                   /translation="MPNLDPASRRAEEQADAAASFDPLRRTLIRVAYRMLGSVADAEDM
FT                   VQEAFIRWMDVDRTEIRVPEAFLRRMVMRMCLDQLKSARHQRETYIGPWLPEPVVEEDE
FT                   PDDVTLPLLLALERLSPLERAAFLLHDVFGLEFDEVATTIQRDPAACRQLAARARTHVR
FT                   DARPRFHVEKQRGIELAEAFFAASRSGDMRALGAMLAEDVSLHSDGGGKRTAAGKPVFG
FT                   FELVMRVHAYLAELFATHASKLVRAGFINGLPGFITLEADGELQTTALEIDDGKIVAIY
FT                   VVRNPDKLKHLH"
FT   gene            complement(23185..23661)
FT                   /locus_tag="Bcen2424_0020"
FT   CDS_pept        complement(23185..23661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0020"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bcn:Bcen_0050 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06774"
FT                   /protein_id="ABK06774.1"
FT                   /translation="MTAKLNPFAAAPALMKSWMTVSVAAAGSLEPTLIELVKIRASQIN
FT                   ACANCLNMHTVEAREQGETEQRIYLLSAWREAPCYTDRERAALGWTEALTRLSEGHAAH
FT                   EAAYAALNDHFSEEEQVKLTVMINVINGWNRLAVGFGLWVDPADAKAAAAKMVA"
FT   sig_peptide     complement(23584..23661)
FT                   /locus_tag="Bcen2424_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.477 at
FT                   residue 26"
FT   gene            24004..24237
FT                   /locus_tag="Bcen2424_0021"
FT   CDS_pept        24004..24237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06775"
FT                   /protein_id="ABK06775.1"
FT                   /translation="MLSFFFHIRFTGNPIRDVHISGPYCSARADEVTPHPRPGARAGCP
FT                   TTQQQIARQPRALERKAFPFPATQRSESRRER"
FT   gene            24242..25468
FT                   /locus_tag="Bcen2424_0022"
FT   CDS_pept        24242..25468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0022"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   bcn:Bcen_0048 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06776"
FT                   /protein_id="ABK06776.1"
FT                   /translation="MSLLASQLQRRYQDVRAHSIALTATLSAEDQAVQSMPDASPTKWH
FT                   LAHTTWFFETVVLMRRVPGYAPFDAAFQFLFNSYYEALGPRHPRPQRGLLTRPSLDEVH
FT                   AYRQYVDDAMLRALAGADAALLDAIAPELVLGLHHEQQHQELIVTDMLHAFSCNPLRPA
FT                   FRPRTGDEAGCALAAGDAGPLRWLPQPGGLVEIGHDGDAFSFDNERPRHTALVRPYEIA
FT                   NRLVTNAEFAAFIADGGYTRPEFWLSDGWATVQREGWQGPAYWMPDDDDAAATRVRRTF
FT                   GLHGVEPLAPDAPVCHVSFYEAAAYAEWAGARLPTEFEWETAFAADGIRQMLGHVWQWT
FT                   RSSYEPYPGFRPLAGVAAEYNGKFMVGQQVLRGSSIATPPGHERPTYRNFFPPAARWQF
FT                   TGVRLARDV"
FT   gene            25452..26465
FT                   /locus_tag="Bcen2424_0023"
FT   CDS_pept        25452..26465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06777"
FT                   /protein_id="ABK06777.1"
FT                   /translation="MRETSDLTATSGGLQPARDSRPSAFERDLIDGLSRTPRSIPPKYF
FT                   YDAAGSALFDRICELPEYYPTRTELGILRDRAAEIVRRVGPHADIVEFGAGSLEKIRVL
FT                   LDAFANNYANAPARYVPVDISADYLHGAAARLRAAYPWLDVAPLAADYTKAEQLAALTE
FT                   TPRRRIGFFPGSTIGNFSPTEADTFLRDAARLLRGGGLLVGADLVKDERTLHHAYNDAQ
FT                   GVTAQFNLNLLVRANAEFGADFDVDAFSHCAFYDRGRQRIEMHLVSDVAQTVHVRGHVF
FT                   RFEAGERIHTENSHKFTIDGFHAMARRAGFEPDTVWTDADNLFSVHWLRSVDDIRA"
FT   gene            26759..27061
FT                   /locus_tag="Bcen2424_0024"
FT   CDS_pept        26759..27061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06778"
FT                   /protein_id="ABK06778.1"
FT                   /translation="MSKKLILGAVLGVAALAASGVASAHVDLSVGIGVPGVYTAPAPVY
FT                   VAPPPPVMYAPVGYRDDDWRARQWREHEWRRREWREHEWRERAWRDGGGWRGRWD"
FT   sig_peptide     26759..26833
FT                   /locus_tag="Bcen2424_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            27114..27326
FT                   /locus_tag="Bcen2424_0025"
FT   CDS_pept        27114..27326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06779"
FT                   /protein_id="ABK06779.1"
FT                   /translation="MNPIRHIGRYAAAAVVALATIGSAHAAGCMKGAVVGAVGGCIVGH
FT                   HMAKKQAQEQAAQHKAAAQGMQAAQ"
FT   sig_peptide     27114..27194
FT                   /locus_tag="Bcen2424_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            27514..27870
FT                   /locus_tag="Bcen2424_0026"
FT   CDS_pept        27514..27870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06780"
FT                   /protein_id="ABK06780.1"
FT                   /translation="MKQQRYLSVLTAALLALGSVSAFAAAGGNGGGHGAGGSGGNAGGM
FT                   SGGHMSGQALSNSNGMHAADRDKGLARAADRSDMIADRAGTQPGRDHTHAHGHTAHAST
FT                   STHHSHRNAFGRTL"
FT   sig_peptide     27514..27588
FT                   /locus_tag="Bcen2424_0026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            complement(28136..31162)
FT                   /locus_tag="Bcen2424_0027"
FT   CDS_pept        complement(28136..31162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0027"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: type III restriction enzyme, res subunit;
FT                   KEGG: bcn:Bcen_0043 type III restriction enzyme, res
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06781"
FT                   /protein_id="ABK06781.1"
FT                   /translation="MRLHFEADLDYQREAIDAVCDLFRGQESYRGDFSVLANAAPGTTA
FT                   AAQGSLGFAVSEQGVGNRLSLTDDALARNLADVQLRGGLPPSGLPGSRDFTVEMETGTG
FT                   KTYVYLRTIFELNRRYGFTKFVIVVPSIAIKEGVHKTLAITEDHFRALYAGVPYDYFLY
FT                   DSAKLGQVRHFAASAAIQIMVMTVAAINKKEINNLYKDSEKTGGEKPIDLIRATRPIVI
FT                   VDEPQSVDGGLEGRGREALAAMAPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIE
FT                   IASAIVEDAHNKPYVRLVGVSNRRGAISARVELDVATAAGVKRQIVSATDGDDLERLTK
FT                   RALYAGLRIGEVHAVKGAEYVELRHPEGEAFLSLGEAFGDIDTLAVQREMIRRTIREHL
FT                   DKELRLAERGVKVLSLFFVDSVERYRRYDENGMPVKGDYALIFEEEYARAARVPAYRAL
FT                   FDGVDVALEVERAHNGYFSIDRKGGWTDTSESSAAARENAERAYGLIMREKEALLSFDT
FT                   PLKFIFSHSALKEGWDNPNVFQICTLRDIQTERERRQTLGRGLRLAVDQDGERVRDAGV
FT                   NTLTVIATERYESFAENLQKEIEADTGIRFGIVEEHQFAALPVQEDGGPAHALGIELSR
FT                   VLWNHLHEQGYVDAQGKVLDRLKDALRRSALVLPDAFEPLRAPIVATLRKLSGRFAVRN
FT                   ADERRAIALRRDASGKAVVFGEDFRALWDRIRHRTVYRVEFDNAKLVRDCTAALRDAPD
FT                   IARARLQWRKAEIDIGKAGIEAIEVAGAGTVLLDEGELPLPDLLTELQDRTQLTRRSLA
FT                   TILADSGRLDDFRVNPQQFIAVAADAINRCKRLALVAGIAYRKLGERHVHALESFESEA
FT                   LTGYLRNLRPDARKSIHEAVVCETDAERAFADALEAHDGVKLYAKLPAWFRVQTPLGSY
FT                   HPDWAVLAEQDGGERLYFVVDTPNADGHVPSEHERAKLACGEAHFRALVDGDGAARFVR
FT                   VTQADALFEPAAPTAGAGR"
FT   gene            complement(31162..33180)
FT                   /locus_tag="Bcen2424_0028"
FT   CDS_pept        complement(31162..33180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0028"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bcn:Bcen_0042 site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06782"
FT                   /protein_id="ABK06782.1"
FT                   /translation="MEKTMQKLDAASPQAMSTDFTADNVARLKALFPELVTEGPDGASV
FT                   DVDVLKALVGERTVGDADERYGFHWHGKRAARQAALTPSTGTLRPCPDDSVAWDDTRHL
FT                   VIEGDNLDVMKLLHKSYAGKVKLVYIDPPYNTGSDFVYPDDFSDSIRHYLAMTGQTEAG
FT                   VKRSTNTEANGRFHTDWLNMMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFG
FT                   EENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLERAPLKRPKRNAQRMLDAA
FT                   HDAVYRSGNPKDAQKAYRAWMKAQTNLSGGEVMYDRLSPEGRVYRLVSMAWPNKKKAPD
FT                   EYFTPLIHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPDETTQPQRIYYLDENMY
FT                   ENVPSVLPFAGSDDALLKTLGIPFDLPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGH
FT                   AVMQVNATDGGARRYILVQLPEALDRRDKTQTAAADFCAKLKKPLTLAEITKERLRRAA
FT                   QQVARDYPESYGDLGFRVYRLDTTNVIEWDPRRDDFDHALFASVEHVKTGRTEDDLLAE
FT                   LTLKLGLDLCTPVEHHQVAGKTVHLIGRAIVACFDARISRDDAGPLADGIVDLLDASGA
FT                   SRDVTCLFRDSGFVDDVAKLNLAALLEQHGVKRVRSL"
FT   gene            complement(33540..34667)
FT                   /locus_tag="Bcen2424_0029"
FT   CDS_pept        complement(33540..34667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0029"
FT                   /product="outer membrane protein (porin)-like protein"
FT                   /note="KEGG: bcn:Bcen_0041 outer membrane protein
FT                   (porin)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06783"
FT                   /protein_id="ABK06783.1"
FT                   /translation="MKRKTLALSIAAAGLCAGHAHAQSSVQLYGLMDLSFPTYRTHADA
FT                   NGKHVIGMGNEGEPWFSGSRWGLRGAEDIGGGTKIIFRLESEFVVANGQMEDEGQIFDR
FT                   DAWVGVEDERFGKLTAGFQNTIARDAATIYGDAYGSARLSTEEGGWTNSNNFKQMIFYA
FT                   AGPTGTRYNNGVAWKKLFSNGIFASAGYQFSNSTSFATGSAYQAALGYNGGPFNVSGFY
FT                   NHVNHNGFRNQTFSVGGNYTFDIVRLNAGYFRYNGDQGPLGQRHDDSWTVSMKIAPKGA
FT                   LDYELGYQQMRIKNAANNADGFTPNANLGAFSLTNGVANGFKETIYGSVFYHLSKRTEV
FT                   YLAGDYMKLHGGYTVSSTFGAKNQLELTSGIRTRF"
FT   sig_peptide     complement(34599..34667)
FT                   /locus_tag="Bcen2424_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(34950..35627)
FT                   /locus_tag="Bcen2424_0030"
FT   CDS_pept        complement(34950..35627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0030"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcn:Bcen_0040 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06784"
FT                   /protein_id="ABK06784.1"
FT                   /translation="MKLLLVEDNAELAHWIVNLLRGEDFAVDCVGDGERADTVLKTERY
FT                   DAVLLDMRLPGISGKEVLARLRRRNDNVPVLMLTAHGSVDDKVDCFGAGADDYVVKPFE
FT                   SRELVARIRALIRRQAGVGTTQLVCGDLVYAFGTREFRCGDAVLALRRREHAILETLML
FT                   QQNKTVSKARLMDSVFALDDEPSADAIDIYIHRLRKHLAGSTAEIITLRGLGYILRMKS
FT                   AHG"
FT   gene            complement(35641..37008)
FT                   /locus_tag="Bcen2424_0031"
FT   CDS_pept        complement(35641..37008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0031"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; Two-component sensor kinase N-terminal domain
FT                   protein; KEGG: bcn:Bcen_0039 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06785"
FT                   /protein_id="ABK06785.1"
FT                   /translation="MAHSLRGRLLWWLLLPLAVFVLIAGAMSYDTARTTAALVQDSALV
FT                   ASARTIGEDVEWRNGRPAADVPPAALEIFESPSGDSVFYKVIDGHDRLLTGNPALDLPA
FT                   RHGTEPTLYDTSLDGVPLRAVAYDRQLYDEGQVETVTVVVAKTTRSYGAMVATIWRPQL
FT                   VRLSLMLVLAVVLVYLGLTFELRPLMKLKDDVADRGPMELEPIRPERLQHELRPIVDAI
FT                   NQCIARLNMHTATQRRFIADAAHQLRTPIAVLDTQIQYAQQRGNGDHELASVLDSMQRS
FT                   SRKMADVTDKLLLLAHAEATPSTLLTHRVDLATVVSSVLEETIVLAQRRDIDLGADLGE
FT                   RLDVAGSDSLLTALVMNLVDNAVRYTQPGGCVTVCARRDGDAIVLDVVDDGPGIPAEAR
FT                   PHVFKRFYRVSADTEGSGLGLAIVREIALAHGGSASLAPGPGNRGVVVTVRLPAFD"
FT   sig_peptide     complement(36922..37008)
FT                   /locus_tag="Bcen2424_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.699 at
FT                   residue 29"
FT   gene            complement(37097..37954)
FT                   /locus_tag="Bcen2424_0032"
FT   CDS_pept        complement(37097..37954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0032"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_0038
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06786"
FT                   /protein_id="ABK06786.1"
FT                   /translation="MTDMTLPPTALPATTLEDESRAAQTRLRRRRQLIIGLRIAVLVVV
FT                   LGGWELAARLKWIDPFFFSMPSLIFEQIQDWFVNGTSQGPLLTQVWVTLEETTIGFLIG
FT                   SVAGVICGIVLGRNKLMADVFGLYIQIANSIPRVVLGSVFVIALGLGMASKIALAVVMV
FT                   FFVVFGNAFQGVREADRYLIANAQILGASRRQITTSVVIPSALSWILASLHVSFGFALV
FT                   GAVVGEFLGSKQGIGLLISTAQGAFNASGVFAAMIVLAVVALAADYLLTRIEKRLLKWR
FT                   PAAF"
FT   gene            complement(38014..38811)
FT                   /locus_tag="Bcen2424_0033"
FT   CDS_pept        complement(38014..38811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0033"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_0037 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06787"
FT                   /protein_id="ABK06787.1"
FT                   /translation="MNQAVSPSTPAIEFRNVSCRFISPEGKATVALRDFSMSVARGEFI
FT                   AIVGPTGCGKSTTLNLITGLLKPASGEVRVMGRPVDGIDPRIGFVFQADAVFPWRNVID
FT                   NVAAGPLFRGRSKDVAYAQAEEWIRKVGLDKFTKHYPHQLSGGMRKRVALAQTFINQPE
FT                   ILLMDEPFSALDMQTRTLMQDELLQLWSANKGSVVFVTHDLEEAIALADRVFVLTARPA
FT                   TLKRVVEIDLPRPRVMSEVRYDARFIEISRDIWHDLREEVQIG"
FT   gene            complement(38933..39937)
FT                   /locus_tag="Bcen2424_0034"
FT   CDS_pept        complement(38933..39937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0034"
FT                   /product="ABC nitrate/sulfonate/bicarbonate transporter,
FT                   periplasmic ligand binding protein"
FT                   /note="KEGG: bcn:Bcen_0036 ABC
FT                   nitrate/sulfonate/bicarbonate transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06788"
FT                   /protein_id="ABK06788.1"
FT                   /translation="MRPILRTLAVAASLSCALAAHPAFADDGGKITIMVGGIAKLIYLP
FT                   ARLTQELGNFKAEGLDVELLSQPAGVDAENELLAGAVQGVVGFYDHTVDLQSKGKDVKA
FT                   IAVLCQVPGEVEMVSTKAAPTFKSMADAKGKTLGVTGLGSSTSFLTQYLALQHGVPSTQ
FT                   YTMLPVGADASFIAAIKQGRIDAGMTTEPTVSALEKMGDAKVLVDLRTLEGTRAALGGT
FT                   YPAASLYVQSAWADAHKAEATKLAHAFAKTMQFIHTHSAEEIAAKMPADYQKDKALYVA
FT                   ALKASLPMYTADAKMPADGPALVLKVLSAFNPSVKGKHIDLARTYTNDFVNAK"
FT   sig_peptide     complement(39860..39937)
FT                   /locus_tag="Bcen2424_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(40123..40905)
FT                   /locus_tag="Bcen2424_0035"
FT   CDS_pept        complement(40123..40905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0035"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; KEGG:
FT                   bcn:Bcen_0035 flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06789"
FT                   /protein_id="ABK06789.1"
FT                   /translation="MFSVTYAQLNGWLTAFLWPFVRMLALVATAPMVGHAAVPVRVKIG
FT                   VAAFMALVVAPTLGAMPDVTVFSAQGIWILVNQFLIGVAMGFTMQLVFAAVEAAGDFIG
FT                   LSMGLGFATFFDPHSSGATPAMGRFLNAVAMLAFLAVDGHLQVFAALAASFQSLPVSAD
FT                   LLHAPGWRTLAAFGATVFEMGLLLSLPVVVALLIANLALGILNRAAPQIGMYQIGFPVT
FT                   LIVGLLLVQLMIPNLVPFVSHLFDMGLDAMGRVLIGWR"
FT   sig_peptide     complement(40795..40905)
FT                   /locus_tag="Bcen2424_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.633) with cleavage site probability 0.620 at
FT                   residue 37"
FT   gene            complement(40930..41202)
FT                   /locus_tag="Bcen2424_0036"
FT   CDS_pept        complement(40930..41202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0036"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ, family 3; KEGG: bcn:Bcen_0034
FT                   flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06790"
FT                   /protein_id="ABK06790.1"
FT                   /translation="MTPEQVMTLAHQAMMVGLLLAAPLLLVALAVGLVVSLFQAATQIN
FT                   EATLSFIPKLLAVAATLVIAGPWMLTTMLDYLRQTLLHVATLGAG"
FT   sig_peptide     complement(41110..41202)
FT                   /locus_tag="Bcen2424_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.573 at
FT                   residue 31"
FT   gene            complement(41220..41981)
FT                   /locus_tag="Bcen2424_0037"
FT   CDS_pept        complement(41220..41981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0037"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein; KEGG:
FT                   bcn:Bcen_0033 flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06791"
FT                   /protein_id="ABK06791.1"
FT                   /translation="MKHAFLRHAARVAPVLILCLAPALAYAQANGLPAFNASPGPHGGT
FT                   TYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLAMF
FT                   LTFFVMSPVLDRAYNDGYKPFSDGSMPMEQAVQRGVAPFKTFMLKQTRETDLALFAKIS
FT                   KAAPMQGPEDVPLSLLVPAFVTSELKTGFQIGFTVFIPFLIIDMVVASVLMSMGMMMVS
FT                   PSTVSLPFKLMLFVLVDGWQLLIGSLAQSFS"
FT   sig_peptide     complement(41898..41981)
FT                   /locus_tag="Bcen2424_0037"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.865 at
FT                   residue 28"
FT   gene            complement(42018..42599)
FT                   /locus_tag="Bcen2424_0038"
FT   CDS_pept        complement(42018..42599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0038"
FT                   /product="flagellar biosynthesis protein, FliO"
FT                   /note="PFAM: flagellar biosynthesis protein, FliO; KEGG:
FT                   bcn:Bcen_0032 flagellar biosynthesis protein, FliO"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06792"
FT                   /protein_id="ABK06792.1"
FT                   /translation="MNVVMSGRRACRAIAAAALAAAASLVCAPAGAADMNAVNHPGSIA
FT                   SSVTVGSAAPSLGIGAVLQTLVGLAVVIGLVFACAWLARRFGFQPARRGGPLKVVSSVG
FT                   LGAKESATIVEIGDTWLVLGVAPGNVRLLHTLPAGSAAATATATAGSAPADASVGGTSS
FT                   DAGLPGTFGSRFRDALAGEAAKRLGRGKDR"
FT   sig_peptide     complement(42501..42599)
FT                   /locus_tag="Bcen2424_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            complement(42596..43084)
FT                   /locus_tag="Bcen2424_0039"
FT   CDS_pept        complement(42596..43084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0039"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   bcn:Bcen_0031 flagellar motor switch FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06793"
FT                   /protein_id="ABK06793.1"
FT                   /translation="MSELNQTPDDDIQAMADAALAASAADAKAPAAAEEDPGMDDWAAA
FT                   LAEQNEQPVQAGATGAGVFQPLSKAAASSTHNDIEMILDIPVKMTVELGRTKIAIRNLL
FT                   QLAQGSVVELDGMAGEPMDVLVNGCLIAQGEVVVVNDKFGIRLTDIITPAERIRKLNR"
FT   gene            complement(43077..44075)
FT                   /locus_tag="Bcen2424_0040"
FT   CDS_pept        complement(43077..44075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0040"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; flagellar motor switch protein FliM; KEGG:
FT                   bcn:Bcen_0030 flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06794"
FT                   /protein_id="ABK06794.1"
FT                   /translation="MGHQEFMSQEEVDALLKGVTGETDAVDEQRDTSGVRPYNIATQER
FT                   IVRGRMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNL
FT                   VHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFE
FT                   HYTTAWKSVRPLQFEFVRSEMHTQFANVATPNEIVIVTQFSIEFGPTGGTLHICMPYSM
FT                   IEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAEVELTANLAEISSTFEKILNLRAGD
FT                   VLPLEIEDTITAKVDGVPVMECGYGIFNGQYALRVQKMIGASDSMKEGGYE"
FT   gene            complement(44098..44631)
FT                   /locus_tag="Bcen2424_0041"
FT   CDS_pept        complement(44098..44631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0041"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: bcn:Bcen_0029 flagellar basal body-associated protein
FT                   FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06795"
FT                   /protein_id="ABK06795.1"
FT                   /translation="MHATRHHARIHMATTATPTADKPASSGKFKRIALIAVIALGAAAA
FT                   AAGGMYVFLNKAGVGHPSAPAEPAPLAAPVFFPLDPLTVNLQSDDGAQHYLRVGLSLKL
FT                   TDPKAQEQLTARMPEIRSRILLALSNKHPEELATPEGKRSLATELRELIEQPTQPGNQR
FT                   AKVDDVLFTEFVVQ"
FT   sig_peptide     complement(44488..44631)
FT                   /locus_tag="Bcen2424_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.570 at
FT                   residue 48"
FT   gene            complement(44844..45566)
FT                   /locus_tag="Bcen2424_0042"
FT   CDS_pept        complement(44844..45566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0042"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: bcn:Bcen_0028
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06796"
FT                   /protein_id="ABK06796.1"
FT                   /translation="MLAALSNLPADRVNTAISVGCFVLTIVLYFASKRLYAYKKTLLFS
FT                   PLVFVPGVLVLLVLLTGIPYSVYFRDTRWLMWLLGPATIAFAVPIYDYRDLIRRHWLSL
FT                   SVGVAVGIAAGVCGSLLLAKLLHLSPELQRSLMTRSVSTPFALAVSDKIHAPKDLTALF
FT                   VIATGICGMLLGELVLALVPMRTRLARGALFGAAAHGVGTAKAREIGNEEGVVSSLTMM
FT                   IAGVAMVLIAPLLTLLPI"
FT   gene            complement(45580..46053)
FT                   /locus_tag="Bcen2424_0043"
FT   CDS_pept        complement(45580..46053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0043"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: bcn:Bcen_0027 LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06797"
FT                   /protein_id="ABK06797.1"
FT                   /translation="MNKPTATAAARPAASGSLAHTGRIVLQATALGVLWMAVDWAVRTV
FT                   GLPVPSGVIGLAVLLVLLFSGRVAPAWVKDGANWLLSDMLLFFVPAAVAAVQYGGLFRE
FT                   DGWRIALVMLAGTAFVMVAVAVAVDLAAKLERRLAAQRVFAERRRARLSAVAH"
FT   sig_peptide     complement(45994..46053)
FT                   /locus_tag="Bcen2424_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.959 at
FT                   residue 20"
FT   gene            46195..47121
FT                   /locus_tag="Bcen2424_0044"
FT   CDS_pept        46195..47121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0044"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_0026 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06798"
FT                   /protein_id="ABK06798.1"
FT                   /translation="MELRALRYFVEVVRQQSFTAAADRLFVTQPTISKMVKALEDEIGS
FT                   PLLLRDGRQMVLTDAGRIVFQRGQDVLAAQAQLQSELNDLGTLGRGELTIGIPPLGGSL
FT                   FTPIIAAYKQRYPNIELKLFEQGARMIEAALMSGELELGGLLEPVDPGTFERLPMVRAP
FT                   LWLVAPRESRWEDHAAVPLADLARESFVFYAESLALHDAVLDACRQAGFMPSIVSRSGH
FT                   WDFMAALVHAGVGIALLPEPYCRRLDASQFTCRPIVEPEITWAIALGWLKKGYLSHAAR
FT                   AWLDVARATLPLAPADDLAFGGLRARE"
FT   gene            complement(47146..47532)
FT                   /locus_tag="Bcen2424_0045"
FT   CDS_pept        complement(47146..47532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0045"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bcn:Bcen_0025 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06799"
FT                   /protein_id="ABK06799.1"
FT                   /translation="MKLLLDTHLILWAAADATELPDRARTLIEDPAYTLLFSVASLWEI
FT                   VIKRGLDRNDFQVDPHVLRRNLLDAGYVESPITSAHVLAVEQLPLVHRDPFDRLLIAQA
FT                   IAEGVTFLTHDHTVARYPGPIRHV"
FT   gene            complement(47529..47777)
FT                   /locus_tag="Bcen2424_0046"
FT   CDS_pept        complement(47529..47777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0046"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: bcn:Bcen_0024
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06800"
FT                   /protein_id="ABK06800.1"
FT                   /translation="MQTYNMHDAKTNLSRLIDEAVHAGEPFVIAKAGKPLVKVVPIDAP
FT                   EATRPARIGFMKGQIVVPADFDTMGDDAIRKLFEGDA"
FT   gene            complement(47883..49445)
FT                   /locus_tag="Bcen2424_0047"
FT   CDS_pept        complement(47883..49445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0047"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_0023 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06801"
FT                   /protein_id="ABK06801.1"
FT                   /translation="MSATTASAPSPAAEPAPLTGGALALLTVGLALGTFMEVLDTSIAN
FT                   VAVPTISGSLGVATSEGTWVISSYSVASAIAVPLTGWLARRVGEVRLFTLSVLAFTIAS
FT                   ALCGFATNFETLIAFRLLQGLVSGPMVPLSQTILMRSYPPAKRGLALGLWAMTVIVAPI
FT                   FGPLLGGWISDNYTWPWIFYINLPIGVFSATCAYFLLRGRETKTSKQRIDAIGLALLVI
FT                   GVSCLQMMLDLGKDRDWFNSTFIVALALIAVVSLAFMLVWEATEKEPVVDLSLFKDRNF
FT                   ALGALIISFGFMAFFGSVVIFPLWLQTVMGYTAGKAGLATAPVGLLALVLSPLIGRNMH
FT                   RLDLRMVASFAFIVFAGVSLWNATFTLDVPFNHVILPRLVQGIGVACFFVPMTTITLSS
FT                   ISDERLASASGLSNFLRTLSGAIGTAASSTFWENDAIYHHARLSESVSIYAQNTTDYQG
FT                   ALAQLGIVGQTANAQLNQLVTQQGFMMATNDFFHLSAGVFVALAALVWITKPKKGAGPA
FT                   MGH"
FT   gene            complement(49622..50110)
FT                   /locus_tag="Bcen2424_0048"
FT   CDS_pept        complement(49622..50110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0048"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: bcn:Bcen_0022
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06802"
FT                   /protein_id="ABK06802.1"
FT                   /translation="MTGGLYDPENIALETSLGYYLSKAKQALVERMDRALEPFDLTAQQ
FT                   IGVILLLSRGYARTPFELSRKMSYDSGSMTRMLDRLERKGLIARARSEQDRRMIELTLT
FT                   ERGIEAARALPSLVATVLNAQLEGFSADELATLTGLLQRFIANGPGSTGCPKPDEPDC"
FT   gene            50285..50572
FT                   /locus_tag="Bcen2424_0049"
FT   CDS_pept        50285..50572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06803"
FT                   /protein_id="ABK06803.1"
FT                   /translation="MLFLKNAAGALRRNLTDTAHHVFSGPHRGWKIALYVTMLVVPGGS
FT                   LAALGFAWFDHRRQRNAKNAARRTSQPAATEPSTWRAAAAEPVPVPVRCH"
FT   gene            50854..52425
FT                   /locus_tag="Bcen2424_0050"
FT   CDS_pept        50854..52425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0050"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_0020 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06804"
FT                   /protein_id="ABK06804.1"
FT                   /translation="MPYASLPRAVRPLSAAVAIATAVLLAGCAVGPDYHRPDTSIPAAF
FT                   KEAPAGWKVAQPADRTDRGAWWTVYNDPQLDALIGRLNASNQTIAQSAAAYRQARALVT
FT                   EARAAYFPTVGLTASGSRARTPRTSLSSGSSSNFGSGSTGSINNSYSVGLDASWEPDLW
FT                   GKVSRTVSAQRAGEAAAAADLANARLSQQALLAQTYFQLRTSDALQKLLDDTVKSYERS
FT                   LQLTQNQYAQGVAARADVIQAQTQLQSAQAAQIDNGVARAQYEHAIATLIGEPASTFSL
FT                   PPNPLAAEPPVTPVDVPSAILERRPDIAAAERRAAAANEQIGVAISAFFPTLTLSATGG
FT                   SQSSVWSQLFTLPARFWTVGPQLAATLFDAGLRAAQTDAARATYDQDVAAYRLAVLTAF
FT                   QDVEDNLASQRILAQEIDVQRQAVDSAEHALAIVTNQYKAGTVAYLNVLTAQTTAFTAQ
FT                   QKLATIAGQRMVSSVGLVKALGGGWNVSEMARENGDMAAPAPLPASGTAAPAATAPSAA
FT                   APLAQK"
FT   gene            complement(52457..53281)
FT                   /locus_tag="Bcen2424_0051"
FT   CDS_pept        complement(52457..53281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06805"
FT                   /protein_id="ABK06805.1"
FT                   /translation="MTAVDDANEGRPMRPWVRRLVTVLPWVLAGGLATAVTLVALAPAA
FT                   WIAPQFARATGGHVNLADPDGSLWHGSGTLMLAPGADQSAATLLPGRVEWTTRFWPLLT
FT                   GRVQMRMRQTEAMPDAVTLDATWRGAVLSAGTMAVPASLLTGLGTPFNTLDLQGDVRLG
FT                   WSDWRLIGNNAFGQLTVTIDSMSSRVSRVKPLGSYRAVLQAKGVGADLDLSTTQGPLFL
FT                   DGHGSFGPGQGSFRGTAHAAPEQQANLAGLLNLLGHPIGNNQVSLIFGDAQR"
FT   gene            complement(53282..53788)
FT                   /locus_tag="Bcen2424_0052"
FT   CDS_pept        complement(53282..53788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0052"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   bcn:Bcen_0018 general secretion pathway M protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06806"
FT                   /protein_id="ABK06806.1"
FT                   /translation="MKAEQLNQTLAQFWGERTPREKTLLGWGGAVLAIAIAYSVLWSPA
FT                   QEGRARIQRELPAMRHELAQMTAQANEAKSLATAAQGVAPTGLALKDALTASLSDHGLQ
FT                   GAQVQIVGNGVQIQMKNVSFPAWAQWLDDARRQFKVQVGEAHATALKEDGQVDLTAVMQ
FT                   PSVQK"
FT   gene            complement(53785..55158)
FT                   /locus_tag="Bcen2424_0053"
FT   CDS_pept        complement(53785..55158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0053"
FT                   /product="general secretion pathway protein L"
FT                   /note="TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway L; KEGG: bcn:Bcen_0017 general
FT                   secretion pathway L"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06807"
FT                   /protein_id="ABK06807.1"
FT                   /translation="MSTLIVSLPPREPAVPLQEWQWPELPFTLVDKAGQVQRAGRAALA
FT                   LLPRANATVLIVAARDVLLLAATVPPLKGPKLRQALPNIVEDQLIQDPLGCHIALDPAA
FT                   LPDGRRVLAVVDRAWFRTICDAFTAAGHRHLSAVPATRCLPAPRASAEAASAVLADGQA
FT                   TDAAALVADVTEPPARPPTVAAVLGLATAVEPVLVEAGALPAAAGAPRLELAVARGALG
FT                   EGFAAPASRAAGTLAALAGGGDVELYELGEPGAEPRLASVGRTDAALLPGAAPLSFDTF
FT                   ARRALTEPFDLCQFEFESQPWRFDRATVKRLRVPIALAAATLGVAVIGMNLHWWKLSRE
FT                   RDALSAQITETLLSAFPKTTTVLDPPAQMQRQLDQLRLAAGELSPNDFLALSSGLSRSM
FT                   GALPLNGIASLDYHDRRLDVGFKPEVKVDPDFTQRLARNGLSGEVDSNTGKWTIRSRS"
FT   gene            complement(55185..56294)
FT                   /locus_tag="Bcen2424_0054"
FT   CDS_pept        complement(55185..56294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0054"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   bcn:Bcen_0016 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06808"
FT                   /protein_id="ABK06808.1"
FT                   /translation="MRARPFRRMPARRQRGAAIITALLVVALSAILVSGMLWRQQVQIR
FT                   RIENQRVIAQAQWVARGALDWTRMILRSEGDTAPGITYLGGIWGVPIAKTKLSDFLGRI
FT                   GAPNETGGGDTYLSGSIEDAQAKFNLRNLVSSPAPGVLQLNVTQMQAFQRLLTTLGYDS
FT                   AFAKRIALQVRAGLLHSATRFQMPNLPGGGGTAANAATAPVTSGDMQGSGFTDDPGMAG
FT                   GDRGPAPLMMTRVDSLLDVDGVTPEMVARLRPFVTVLPTTTPVNMNTAPAEVIAALIPG
FT                   MSVSSAQALVSRRETVFFRNVGDVQLALRGAGAPPNVTIDSSLVDVNSSYFIVHGRIQH
FT                   ERAEVDRTSLVYRDPTTHSTRVVRIRDQL"
FT   sig_peptide     complement(56190..56294)
FT                   /locus_tag="Bcen2424_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.463 at
FT                   residue 35"
FT   gene            complement(56297..56995)
FT                   /locus_tag="Bcen2424_0055"
FT   CDS_pept        complement(56297..56995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0055"
FT                   /product="general secretion pathway protein"
FT                   /note="KEGG: bcn:Bcen_0015 putative general secretion
FT                   pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06809"
FT                   /protein_id="ABK06809.1"
FT                   /translation="MKPAVRSDAPMRRPSALSSRAARGFTLIELMIAIAIIAVVAILAW
FT                   RGLDQIMRGRDKVAAAMEDERVFAQMFDQMRIDARLAATDDEAGQPAIGVAGNTLQIVR
FT                   ELDVPGVAPRLQVVRYRIAGGRVVRYASPPIDDTNRLRTVLKDSSVEGWSWVALMGGVG
FT                   AIDAKLYVPRVGWTTNLQTADDALAQNNDALKVPQIGNAPPARAVTGLQVSIGATSLRV
FT                   PITRIFLVGE"
FT   gene            complement(56973..57374)
FT                   /locus_tag="Bcen2424_0056"
FT   CDS_pept        complement(56973..57374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0056"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J; KEGG: bcn:Bcen_0014
FT                   general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06810"
FT                   /protein_id="ABK06810.1"
FT                   /translation="MRRRLPFPVSSARGFTMIEVLVALAIIAVALAASIRAVGTMATNA
FT                   SELHRRLLAGWSADNALAQLRLTHAWPEVGEQSFDCSQGNVQLVCTQRVSTTPNPVFRR
FT                   VRISVSMPGRAGVLAQMVTVVANETSRPL"
FT   sig_peptide     complement(57261..57374)
FT                   /locus_tag="Bcen2424_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.363 at
FT                   residue 38"
FT   gene            complement(57377..57946)
FT                   /locus_tag="Bcen2424_0057"
FT   CDS_pept        complement(57377..57946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0057"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; KEGG:
FT                   bcn:Bcen_0013 general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06811"
FT                   /protein_id="ABK06811.1"
FT                   /translation="MLAIRTTSRCGRDCRVRRGAVPFVPARTDGGLMKHGAARRRTRGF
FT                   TLLEMLVVLVIAGLLVSLASLSLTRNPRTDLREEAQRIALLFETAGDEAQVRARPIAWQ
FT                   PTAHGFQFDVSSPDGWRTLRDDLLRPRDWDGGVIGADIDYPGSDTRASRVVFGTESIDT
FT                   PVRVTLHSAAGSATIIGTGNGRYEVQ"
FT   gene            complement(57986..58438)
FT                   /locus_tag="Bcen2424_0058"
FT   CDS_pept        complement(57986..58438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0058"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: bcn:Bcen_0012
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06812"
FT                   /protein_id="ABK06812.1"
FT                   /translation="MQTWITRRNAAVRRQRGFTLIEIMVVVAILGILAALIVPKIMSRP
FT                   DEARRIAAKQDIGTIMQALKLYRLDNGRYPTQEQGLNSLIQKPTTDPIPNNWKDGGYLE
FT                   RLPNDPWGNGYKYLNPGVHGEIDVFSYGADGKEGGDGNDTDIGSWQ"
FT   gene            58614..59024
FT                   /locus_tag="Bcen2424_0059"
FT   CDS_pept        58614..59024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06813"
FT                   /protein_id="ABK06813.1"
FT                   /translation="MNALSIRILSLALFAGLCATATYWVVTLSAREAPLPAAAARLPIR
FT                   TEDAAALFGGQLDKNPVQDIHLFGILALDHGGAAIVSVGGEPPRAVSLGADVTSGAKLA
FT                   EVRPRSIIVDRNGARAEIQLPANTPSPAIYMR"
FT   sig_peptide     58614..58706
FT                   /locus_tag="Bcen2424_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.540 at
FT                   residue 31"
FT   gene            complement(59062..60279)
FT                   /locus_tag="Bcen2424_0060"
FT   CDS_pept        complement(59062..60279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0060"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   type II secretion system protein; KEGG: bcn:Bcen_0010
FT                   general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06814"
FT                   /protein_id="ABK06814.1"
FT                   /translation="MPAFRFEAIDAAGRAQKGVIDADSARAARGQLRTQGLTPLVVEPA
FT                   ASATRGARSQRLAFGRKLSQREQAILTRQLASLLIAGLPLDEALGVLTEQAERDYIREL
FT                   MAAIRAEVLGGHSLANALGQHPRDFPEIYRALVAAGEHTGKLGIVLSRLADYIEQSNAL
FT                   KQKILLAFTYPGIVTLIAFGIVTFLLSYVVPQVVNVFASTKQQLPILTVVMMALSEFVR
FT                   HWWWAILIAVALIVWFVKATLSRAGPRLAFDRWVLTAPLAGKLVRGYNTVRFASTLGIL
FT                   TAAGVPILRALQAAGETLSNRAMRANIDDAIVRVREGSALSRALNNVKTFPPVLVHLIR
FT                   SGEATGDVTTMLDRAAEGEARELERRTMFLTSLLEPLLILAMGGIVLVIVLAVMLPIIE
FT                   LNNMVQ"
FT   gene            complement(60284..61783)
FT                   /locus_tag="Bcen2424_0061"
FT   CDS_pept        complement(60284..61783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0061"
FT                   /product="type II secretion system protein E (GspE)"
FT                   /note="KEGG: bcn:Bcen_0009 type II secretion system GspE;
FT                   TIGRFAM: general secretory pathway protein E; PFAM: type II
FT                   secretion system protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06815"
FT                   /protein_id="ABK06815.1"
FT                   /translation="MSDVLASSAHDGAPGERQPPSPLAARLLPYGFAKSGQVLIAHQLD
FT                   DTLEVWISERTSDAALAEIARNFGSIAVHRVPADELAQAINQAYARQDGSAAQVVGEVE
FT                   GEVDLSRLMQDIPEVEDLLESEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRF
FT                   RVDGTLRDVVRPKKALHGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTL
FT                   PTGHGERAVLRLLEKDAQRLNLEALGMGRDTLVQFDKLIGRPHGIVLVTGPTGSGKTTT
FT                   LYASMSRLETATTNIMTVEDPIEYDLSGIGQTQVNERIGMTFARALRSILRQDPDVIMI
FT                   GEIRDLETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQR
FT                   LVRQLCPVCKEERHEDGRTVWHPVGCAKCGHSGYAGRRGVYELLVIDDSIRSLIHRNAA
FT                   DAEILAAGRAEGMRTLRDDAERWLASGATSLEEVLRVTGGA"
FT   gene            complement(61780..64104)
FT                   /locus_tag="Bcen2424_0062"
FT   CDS_pept        complement(61780..64104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0062"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: bcn:Bcen_0008 type II secretion system GspD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06816"
FT                   /protein_id="ABK06816.1"
FT                   /translation="MTRNRFVMRRIATTLLVAGIIVSQAAYAQVTLNFVNADIDQVAKA
FT                   IGAATGKTIIVDPRVKGQLNLVAERPVPEDQALKTLQSALRMQGFALVQDHGVLKVVPE
FT                   ADAKLQGVPTYIGNAPQARGDQVITQVFELHNESANNLLPVLRPLISPNNTVTAYPANN
FT                   TIVVTDYADNVRRIAQIIAGVDSAAGAQVQVVPLRNANAIDLAAQLQKMLDPGAIGNSD
FT                   ATLKVSVTADPRTNALLLRASNASRLAAAKRLVQQLDAPSAVPGNMHVVPLRNADAVKL
FT                   AKTLRGMLGKGGNDSGSSASSNDANSFNQNGGSSSSGNFSTGTSGTPPLPSGGLGSSSS
FT                   SSGYGGGSSGGGLGTGGLLGGDKDKSGDDNQPGGMIQADSATNSLIITASDPVYRNLRS
FT                   VIDQLDARRAQVYIEALIVELNSNTSGNLGIQWQVASGQFLGGTNLNPTGGLGNSIINL
FT                   TTGGTAATAGLAANLANLNQGLNIGWLHNMFGVQGLGALLQYFAGVSDANVLSTPNLIT
FT                   LDNEEAKIVVGQNVPIATGSYSNLTSGTTSNAFNTYDRRDVGLTLHVKPQITDGGILKL
FT                   QLYTEDSAVVAGTTNAQTGPTFTKRSIQSTILADNGEIIVLGGLMQDNYQVSNSKVPLL
FT                   GDIPWIGQLFRSETKQRAKTNLMVFLRPVIISDRSTAQAVTANRYDYIQGVTGAYKSDN
FT                   NVMRDKDDPVVPPMPLGPSQGGTPAGNLFDLDKMRRQQLQRQVVPVPAQPLPEATPAQP
FT                   QSVPQQAVPQQPLTTAPGASQ"
FT   sig_peptide     complement(64018..64104)
FT                   /locus_tag="Bcen2424_0062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            64473..64967
FT                   /locus_tag="Bcen2424_0063"
FT   CDS_pept        64473..64967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0063"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   bcn:Bcen_0007 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06817"
FT                   /protein_id="ABK06817.1"
FT                   /translation="MNRRFASIALIAAGAWFASGNARADCFDEAAKYQQVNPLILRAIA
FT                   WQESRNRPEALNKNTNGSVDYGLMQINSIHLPTLSRYGIGRDTLMEPCKNVYIAAWHLK
FT                   QKMNRYGNTWQAVGAYHSETPSLRDKYARQIAGILTQWKLLPPAQTTQAAQAAQAPQAA
FT                   Q"
FT   sig_peptide     64473..64547
FT                   /locus_tag="Bcen2424_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 25"
FT   gene            65121..66434
FT                   /locus_tag="Bcen2424_0064"
FT   CDS_pept        65121..66434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0064"
FT                   /product="cobalamin synthesis protein, P47K"
FT                   /note="PFAM: cobalamin synthesis protein, P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bcn:Bcen_0006
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06818"
FT                   /protein_id="ABK06818.1"
FT                   /translation="MNPAMKQPLPVTVLSGFLGAGKTTLLNHVLANRAGLKVAVIVNDL
FT                   AAVNIDASLVRDAQALSHVEERLVEMSNGCICCTLRDDLLVEIRNLASEGRFDAIMIES
FT                   TGIAEPMPIAETFTFVDDDGASLSAIARLDTLVTVVDAYNFLRDYGSDDALATRGIAAS
FT                   EDDDRTLVELLIEQIEFCDVLVINKADLVGADDLARLQHILARLNPRAHQVVSTFGNVP
FT                   LDEVLNTGRFDFDEAANAPGWLASLDHDHTHCDDPDCHDDHHAHVHGEADEFGIGNFVY
FT                   RARRPFHPARLWALLHQEWPGVLRSKGFFWLATRNDIAGSLSQAGGVCRHGPAGLWWAA
FT                   QDRAEWPDDDELLAEIRTEWLGDLDDRTVGDRRQELVLIGIALDADAWRAKLDACLLTD
FT                   AEFALGAAGWAAFDDPFPAWDVDSHDDDDHGDTQIVHA"
FT   gene            complement(66563..66841)
FT                   /locus_tag="Bcen2424_0065"
FT   CDS_pept        complement(66563..66841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0065"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bcn:Bcen_0005 histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06819"
FT                   /protein_id="ABK06819.1"
FT                   /translation="MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLI
FT                   GFGSFGSGKRAARTGRNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR"
FT   gene            67230..69161
FT                   /locus_tag="Bcen2424_0066"
FT   CDS_pept        67230..69161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0066"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; protein of
FT                   unknown function DUF752; KEGG: bcn:Bcen_0004 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06820"
FT                   /db_xref="GOA:A0K2U3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2U3"
FT                   /protein_id="ABK06820.1"
FT                   /translation="MPDRLVSATLALRDDGTLVSPEFGELHRGASGTLARAHRTFVAGN
FT                   GLPARWQRRRTFTIVTTAFGAGAGFLAAWAAWRDDPARCERLHVVAVEPHPFSRDDLHR
FT                   AVSHMVVDTTISADVDALLDAWPILVPGLHRLEFDEGRVVLTLAFGDTIDLLKKLVARA
FT                   DAFFLDGAAASGDGIRALAKLAGEHATFATHAKSDDVKHALGETGFTFREVDDRLVGDY
FT                   APRWRARRHEPPRALPVAARRAIVIGAGLAGCAVVERLAARGWDVTLIERHERIASEAS
FT                   GNPAGVFHPLMTRDDNVASRLTRGGFLHALARWRALERAGHAFSRSTHGMLHLAESADD
FT                   FARMRDAFDAFGPPSDYATLLDADAARAHLNLPVAQGGLLFPHGGAVWPAGLCVAQYAA
FT                   AGERVRLLASTCVARLERRDDTWHALDDTGATLADAPVVVLANAGDAARLAGLRHVTLQ
FT                   PVRGQLTLLPPGTTAPLPCPAIGDGYAVPLDDGTLLIGATFEPDDTDPAMRAAGHAENL
FT                   DRVRHLLPGLIGALPDPATLRGRVAFRWVVGDRLPLIGPLADETQATANARALGGAQAR
FT                   DLPRMPGLYGAFGFGSRGLVWAALGAELIASQLEGEPWPLERELADAVDPARFLIRALR
FT                   ARRVGSAG"
FT   gene            69463..69789
FT                   /locus_tag="Bcen2424_0067"
FT   CDS_pept        69463..69789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06821"
FT                   /protein_id="ABK06821.1"
FT                   /translation="MKPKTCGAAQRRESIQSVPERKSCGTIGFLRVRSAKRRTCFNGTV
FT                   GTISNLNLRDCAVRSHTRPTIQIGNLNDVPPCGGTGGPHVPPSSSTTITFGAIPSRRAS
FT                   IPVA"
FT   gene            69833..71047
FT                   /locus_tag="Bcen2424_0068"
FT   CDS_pept        69833..71047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0068"
FT                   /product="transporter, CPA2 family"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: bcn:Bcen_0002
FT                   sodium/hydrogen exchanger; TC 2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06822"
FT                   /protein_id="ABK06822.1"
FT                   /translation="MKSAFSFLPNWPLAPDAVFWAGLALFAAGLCGELCYRAWRLPRIT
FT                   GYAVIGLIAGSFGFGVIDTSTDETSRLLMDVALGLLLFELGSRLDLRWIRRNPWLVASS
FT                   LAEATLTFVLVLFVMLALGVSGMVALVLSAIAIATSPSMVIQLKTELRAEGQVSQRLIT
FT                   LTALNSVYAIVLTKLVTSWLHQEAYGNVFATILQPLYLLAGSFIVAYLVARSCNYLFRH
FT                   MTATMRDEHSFVALFGLVMLAIAVAQALKLSTLLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVVLFVLTLTSFTWGDIALGGLLAIVLIVTRLVAKLAGVVAFAKPSGLGMKQGV
FT                   ALGIALTPMSALSYLLVDDTYQLYPNFDPHLRAIVMCSIVILQLVSPFVVYRCLSAVGE
FT                   RSDSN"
FT   gene            71062..72177
FT                   /locus_tag="Bcen2424_0069"
FT   CDS_pept        71062..72177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0069"
FT                   /product="uncharacterized enzyme"
FT                   /note="TIGRFAM: uncharacterized enzyme; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: bcn:Bcen_0001
FT                   enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06823"
FT                   /db_xref="GOA:A0K2U6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2U6"
FT                   /protein_id="ABK06823.1"
FT                   /translation="MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLMRLIQGET
FT                   FPGNITPEITESMIELSTGICHSHEQAVSELHAIRDVLVKAADQLNVGLAGGGTHAFQQ
FT                   WSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHSMSRFIPHFIA
FT                   LSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPFVLTWDSFEEYFTKMVNTGVVNSMKD
FT                   FYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLTDRPLKLSEDDYLVYT
FT                   FNRFEACRFGLEGTCVNPQTGERRTIAEDILDTLDRIAPHAAALGSRAALDEIGALAKA
FT                   RVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
FT   gene            72682..73320
FT                   /locus_tag="Bcen2424_0070"
FT   CDS_pept        72682..73320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0070"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; regulatory protein,
FT                   ArsR; KEGG: bcn:Bcen_2985 transcriptional regulator, MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06824"
FT                   /protein_id="ABK06824.1"
FT                   /translation="MSEGVYGNQAAGRVTHSLLRLSTAMRSEAWDWAEGAGLTPTQGEI
FT                   LVLLLQRKGPMRLGEIARETQLTAATTSDAVSTLETKGLVEKRRALDDGRALAVRLSAR
FT                   GRTAAKKALQWPEFLTKAVGKLGADEQGTLYRALLKTLRELQVAGATPPQRMCLTCTHF
FT                   QPSKPSKKTVHHCAVLDIAMSDSDLRLDCSVQEEADAATQKKTWKIFAG"
FT   gene            73349..74059
FT                   /locus_tag="Bcen2424_0071"
FT   CDS_pept        73349..74059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0071"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   bcn:Bcen_2984 glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06825"
FT                   /protein_id="ABK06825.1"
FT                   /translation="MNAEVVAIRHVHFEDLGSFEQVLGERGRRVRYVDVGSSRVEVLDV
FT                   LEPSLLVVLGGPLSVYDDAQYPTIAPLLALVRQRIDAGLPILGICLGAQFIARALGARV
FT                   YPAAQHELGWAPLTLTDAGRASSLRHLDGATTSMLHWHGDTFDLPGGAIHLASTPACRH
FT                   QAFAWGQHVLALQCHPEIRTDRFEPWLIANAGEIAATPGVDARQLRADTIQHGPALETA
FT                   ARHMFAEWLGGVGL"
FT   gene            74288..75400
FT                   /locus_tag="Bcen2424_0072"
FT   CDS_pept        74288..75400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0072"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bcn:Bcen_2983 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06826"
FT                   /protein_id="ABK06826.1"
FT                   /translation="MTALFSPFTLRGVTLPNRIVISPMCQYSAERGEATDWHMIHLGHL
FT                   ALSGAGLLCIEATAVEPDGRITHGDLGLWDDVTEAALKPVLAAIRKHSPIRVAMQLSHA
FT                   GRKASSAAPWEGGQLVPVADGGWLPHGPSAVPHKDGETPPLALDAAGLNRIREAFAASA
FT                   RRAARLGIDAIEVHAAHGYLLHQFLSPLANRRTDEYGGSRENRMRFPLEIFEIVRAAFP
FT                   EDRPVGVRVSATDWVEGGWELDDTIAFAHELKRRGCDWIDVSSGGVSPLQKIPLSPGYQ
FT                   VPFAQAVKRSVGMPTIAVGLINEPAHANRLIEAGDADFVAMARAMLYDPRWPWHAAAEL
FT                   GAQVTAPPQYWRSQPREHKALFGDVSFGQR"
FT   gene            75578..76108
FT                   /locus_tag="Bcen2424_0073"
FT   CDS_pept        75578..76108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0073"
FT                   /product="nuclear protein SET"
FT                   /note="PFAM: nuclear protein SET; KEGG: bcn:Bcen_2982
FT                   nuclear protein SET"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06827"
FT                   /protein_id="ABK06827.1"
FT                   /translation="MSSRRIAVRRSGVHGKGVFAVAPIKAGERVVEYKGERISWKEALR
FT                   RHPHDPSEPNHTFYFALDEGGVIDGKIDGNSARWINHSCAPNCEAEEVKGRVYIHALRD
FT                   IGPEEELFYDYGLVIDAKLTKKLKREYACHCGAESCRGTLLATSDEGGKKKKKKDKKDG
FT                   KPASGSKDKKNKK"
FT   gene            complement(76270..77754)
FT                   /locus_tag="Bcen2424_0074"
FT   CDS_pept        complement(76270..77754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0074"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   Two-component sensor kinase N-terminal domain protein;
FT                   KEGG: bcn:Bcen_2981 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06828"
FT                   /protein_id="ABK06828.1"
FT                   /translation="MSPDPAVTTSLRRSLLRRLAAPLSMLALMSGLIAYWLAWQYTQHV
FT                   IDRSLADLATAISKQIQIAGPDAPFTVPPLAQAMFSDPAEALIYRISDGEQELAGDPKL
FT                   PLQGINVRRMHHAYVFEAEYDNRAVRVAQVRVDDVEGGKPMVVEVAQPVRHRYRIAAEF
FT                   LVAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETDVPLEIRP
FT                   LTSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAVKLHAEQAAVARDPHQTFAAVRE
FT                   LRAAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAAMAFETGAEWVPRALASHVDLGF
FT                   QRSDEPGDDEKLIVRGNPVLLREVIANLLDNALKYVPLARPDGARITVNVARASLEGSQ
FT                   PAAEIVVEDNGPGVPANQQADLFKRFFRGDAQSGNGVETGAGLGLAIVHDIIAMHGGTV
FT                   SYEDASEGGSRFVVRVPLAAHTERPASETPAAAPTH"
FT   sig_peptide     complement(77650..77754)
FT                   /locus_tag="Bcen2424_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.941 at
FT                   residue 35"
FT   gene            complement(77876..78568)
FT                   /locus_tag="Bcen2424_0075"
FT   CDS_pept        complement(77876..78568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0075"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcn:Bcen_2980 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06829"
FT                   /protein_id="ABK06829.1"
FT                   /translation="MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNRH
FT                   ELVILDLGLPGIDGMTLLTRFRQTNRHTPVIVLTARDELNDRIQGLNSGADDYMLKPFE
FT                   PAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAVLEM
FT                   LLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFGYLLQ
FT                   EIRQTASV"
FT   gene            78661..78921
FT                   /locus_tag="Bcen2424_0076"
FT   CDS_pept        78661..78921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06830"
FT                   /protein_id="ABK06830.1"
FT                   /translation="MAASERLNLIMSDISIHDLEAAINFWRARSPSSGDELKLCEEASA
FT                   LSKPYALLIVQRESALQLEGLDPKARKAYETYVRLKDGLES"
FT   gene            complement(79021..79329)
FT                   /locus_tag="Bcen2424_0077"
FT   CDS_pept        complement(79021..79329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0077"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: bcn:Bcen_2978 transcriptional
FT                   coactivator/pterin dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06831"
FT                   /db_xref="GOA:A0K2V4"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2V4"
FT                   /protein_id="ABK06831.1"
FT                   /translation="MIHKLTSEERKTRLEGLPHWTAVPGRDAIQRRLRFADFNEAFGFM
FT                   TRVAIKAQEMNHHPEWFNVYNRVDITLSTHDADGLTERDIELARFIDGAAAHAQPGA"
FT   gene            complement(79461..80423)
FT                   /locus_tag="Bcen2424_0078"
FT   CDS_pept        complement(79461..80423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0078"
FT                   /product="Phenylalanine 4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /note="TIGRFAM: phenylalanine-4-hydroxylase; PFAM: aromatic
FT                   amino acid hydroxylase; KEGG: bcn:Bcen_2977
FT                   phenylalanine-4-hydroxylase, monomeric form"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06832"
FT                   /protein_id="ABK06832.1"
FT                   /translation="MRPIRAQPALHLHGSNPSVQSLIMSTVVTAKLQEQFDAGLETRAD
FT                   FTIDQPLQRYGQVDHAVWQQLYARQSALLRGRACDAFVAGLGKIALPADRVPSFADVNR
FT                   QLKPATGWEIVAVPGLVPDRVFFEHLANRRFPVTWWMRRPDQLDYLQEPDCFHDLFGHV
FT                   PLLIDPVFADYMQAYGRTALAVADDEAALARLARLYWYTVEFGLIRDPRGTNGLSIYGA
FT                   GIVSSKGESLYSLESAAPNRLGFDLERVMRTKYRIDTFQKTYFVIDDFAQLFALADVDG
FT                   RALADRLAALPEFAAGAVLDTDRVLHRGTGEGWPDDADA"
FT   gene            80493..80978
FT                   /locus_tag="Bcen2424_0079"
FT   CDS_pept        80493..80978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0079"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bcn:Bcen_2976 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06833"
FT                   /protein_id="ABK06833.1"
FT                   /translation="MLELDHFDLALLDVLQRFGRATHQQLGEEVPLSPSQIGRRLQRLE
FT                   AAGVIEGYRVMLRPEKLGLGVTAFTSLKLKHHGDSIIEQFQQQIDVLPEVLECHAVVGD
FT                   ADYLLRIVAPDLNALSQFVMKKLMRVPGVDSVRSNIVLTTFKRNGALPLAHLAPGAA"
FT   gene            complement(81045..81578)
FT                   /locus_tag="Bcen2424_0080"
FT   CDS_pept        complement(81045..81578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0080"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: bcn:Bcen_2975
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06834"
FT                   /protein_id="ABK06834.1"
FT                   /translation="MARNIEIKARAREFDRLREQAAQLATEAPLFYRQQDFFYDVPRGR
FT                   LKLRRFEDGTPAELIFYQRDDRDGPKASYYTRSPVTNPDAMHSLLATALTTRGIVTKER
FT                   HVYLAGRTRIHLDRVDGLGDFIELEVVLGPDDDEAGGEAEAHEVFAKLGVAQDDLVAVA
FT                   YVDLLNADTEPETA"
FT   gene            complement(81787..82725)
FT                   /locus_tag="Bcen2424_0081"
FT   CDS_pept        complement(81787..82725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0081"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_2974 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06835"
FT                   /protein_id="ABK06835.1"
FT                   /translation="MLNCVISHAHITTMDLTLLRAFATVAREGNLTRAAAQLHVTQPAV
FT                   SLQIKHLQETLGVALFTRTSRGLALTRDGQTLLPHAERALAAAADVQRAAAALRHEVRG
FT                   RLRIGTILDPGFLRLGGFLRALVETHPQIETALRHGMSGWVIEQVRAQALDVGYYIGRP
FT                   EEDSPRDDALFHTVTLTRFEYRVLAPAGWKERVQRAHDWRALAALPWIWTPPASAHHRL
FT                   LSRRFAAAGAQPVKVAEVDQEQSMLDLVKSGIGLTLARDSTALAEAHAHALTIVEPVTV
FT                   PTELTFVTLAARRDEPAIAAALRLIEAQWAI"
FT   gene            82916..84652
FT                   /locus_tag="Bcen2424_0082"
FT   CDS_pept        82916..84652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0082"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bcn:Bcen_2973
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06836"
FT                   /protein_id="ABK06836.1"
FT                   /translation="MTRVSAKALTRVDRRHAVSTQRTLEGEFDYVIVGAGTAGCVLANR
FT                   LTEDPDISVLLLEAGGKDDYHWIHIPVGYLYCIGNPRTDWLYKTQPEAALNGRALSYPR
FT                   GRVLGGCSSINGMIYMRGQREDYDNWAQETGDAGWSWDSVLPIFKRSEDHHAGASDAHG
FT                   AGGYWRVEKQRLRWEILESFAQAAQQTGIPATDDFNRGDNAGVGYFEVNQKRGVRWNTS
FT                   KAFLRPAMARPNLTVITGAHAQRVIFDGRRAVGVEYHGGGTDYVARARSEVLLTSGAVN
FT                   SPQLLELSGIGDGRRLQALGIDVVQDLPGVGENLQDHLQLRMAFRVDGVRTLNTLSARW
FT                   WGKLMIGAEYALLQRGPMSMAPSQLGAFAKSDPDDPALTRPDLQYHVQPLSLERFGEPL
FT                   HGFNAFTASVCHLRPSSRGSVHVTSADPASAPAIAPNYLSTDHDRHVAANALRLTRRIA
FT                   AAPALARYRPEEILPGPQYRTEAELIDAAGAVGTTIFHPVGTCRMGRADDARAVVDSRL
FT                   RVRSIAGLRIVDASVMPFITSGNTNSPTLMIAERASDMIRADRRAAREAMAVRTEAAVT
FT                   AA"
FT   gene            85086..85865
FT                   /locus_tag="Bcen2424_0083"
FT   CDS_pept        85086..85865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0083"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_2972 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06837"
FT                   /protein_id="ABK06837.1"
FT                   /translation="MILGDTILETRGLTKEFRGFTAVNGVNLRVRRGAIHALIGPNGAG
FT                   KTTCFNLLTKFLTPTAGQIVFNGIDITDERPAQVARRGIIRSFQISAVFPHLTALQNVR
FT                   IGLQRALGTEFHFWRSERTLKRLDDRAMDLLTQVGLTDFAHVPTVELAYGRKRALEIAT
FT                   TLAMEPELMLLDEPTQGMGHEDVDRVTALIKKVASGRTILMVEHNMNVIAGISDTITVL
FT                   QRGEVLAEGSYAEVSKNPLVIEAYMGSADAALAGAHA"
FT   gene            85862..86617
FT                   /locus_tag="Bcen2424_0084"
FT   CDS_pept        85862..86617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0084"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_2971 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06838"
FT                   /protein_id="ABK06838.1"
FT                   /translation="MKHSEREERELSGVESGTPALEITGLEAWYGESHILHGVDLTVHR
FT                   GEVVTLLGRNGAGRTTTLRAIMGLTGRRSGSIKVAGHETIGLATHRIAHFGIGYCPEER
FT                   GIFSSLSCEENLMLPPLIGPREHAMSLDEIYAMFPNLASRRQSQGTRLSGGEQQMLAVA
FT                   RILRTGANLLLLDEISEGLAPVIVQALARMIVALKARGYTIVMVEQNFRFAAPLADRFY
FT                   VMEHGSIVEHFRASELEGKMPTLHDLLGV"
FT   gene            86695..87894
FT                   /locus_tag="Bcen2424_0085"
FT   CDS_pept        86695..87894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0085"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: bcn:Bcen_2970 ABC branched-chain amino acid
FT                   family transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06839"
FT                   /protein_id="ABK06839.1"
FT                   /translation="MKMKTLAQACLALATAALTAGAAHAADTVKIGFITDMSGLYADID
FT                   GQGGLEAIRMAVADFGGKVLGKPIEVVYADHQNKADIAASKAREWMDRGGLDLLVGGTN
FT                   SATALSMNQVAAEKKKVYINIGAGADTLTNEQCTPYTVHYAYDTMALAKGTGSAVVKQG
FT                   GKSWFFLTADYAFGKALEKNTSDVVKANGGQVLGAVRHPLSASDFSSFLLQAQSSKAQI
FT                   LGLANAGGDTINSIKAAKEFGITKTMKLAALLMFIDDVHSLGLETTQGLVLTDSWYWNR
FT                   DAASRQWAQRYFGKMKKMPSSLQAADYSSVTTYLKAVQAAGTTDSDKVMAELKKIKISD
FT                   FYAKGYIRQDGSMIHDMYLMEVKKPSESKEPWDYYKVLATIPGDQAFGTKQETRCALWK
FT                   "
FT   sig_peptide     86695..86772
FT                   /locus_tag="Bcen2424_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            87945..88907
FT                   /locus_tag="Bcen2424_0086"
FT   CDS_pept        87945..88907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0086"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_2969 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06840"
FT                   /protein_id="ABK06840.1"
FT                   /translation="MCPLRRPRARCRNVAHATKLILTAKSMDIFGIPLPAMLSQLLLGL
FT                   VNGSFYAILSLGLAVIFGLLNVINFAHGALFMLGAMLAWMGLSYFGLPYWAMLVLAPVL
FT                   VGAFGIAIERSMLRWLYKLDHLYGLLLTFGLTLVVEGVFRSIYGSSGQPYDVPSQLSGA
FT                   TNLGFMFLPNYRAWVVVASLAVCLATWFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMM
FT                   ITLTYGFGVALAAFAGVLAAPVIQVSPLMGQPMIITVFAVVVIGGMGSILGSIVTGLLL
FT                   GVIEGFTRVFYPEASATVVFVIMAIVLLFRPAGLFGKEK"
FT   gene            88907..89884
FT                   /locus_tag="Bcen2424_0087"
FT   CDS_pept        88907..89884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0087"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_2968 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06841"
FT                   /protein_id="ABK06841.1"
FT                   /translation="MQRKVLYGVLLAALLAAPFIGAYPVFVMKVLAFALFAAAFNLLIG
FT                   YTGLLSFGHAMFLATAGYATGYSMQTLGFTPELGVLAGTVAATVLGLVVGLFAIRRQGI
FT                   YFAMITLAFAQMVYFIYLQAPFTHGEDGLQGVPRGRLFGLLDLSNDVALYYVVLAVVVA
FT                   ACAFIVRVVHSPFGQVLVAIKENEARAISLGYDTDRFKLLAFILSAGLAGLAGSLKVLV
FT                   LGFETLSDAYWTMSGLVVLMTLVGGMGTLFGPLLGAALIVALEDRLGDIGEWLASTTGV
FT                   AWFHSLGESATIVTGLIFIACVLAFRRGIVGEMVARIKPLRASS"
FT   sig_peptide     88907..88975
FT                   /locus_tag="Bcen2424_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.673 at
FT                   residue 23"
FT   gene            89996..90295
FT                   /locus_tag="Bcen2424_0088"
FT   CDS_pept        89996..90295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06842"
FT                   /protein_id="ABK06842.1"
FT                   /translation="MRRCTIGVNAKLSWCLSLFKIHLSSDAPRNEFAGGERGDNRGTKC
FT                   PDPKALLDGIQQRFFICVHGFPRWCIGPRDGHLPRLRSHRVFPRFAAFSVFPFQ"
FT   gene            90949..92106
FT                   /locus_tag="Bcen2424_0089"
FT   CDS_pept        90949..92106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0089"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bcn:Bcen_2966 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06843"
FT                   /protein_id="ABK06843.1"
FT                   /translation="MKMNRWMEALLAAGLVCAAATASAQVKIGVTLSATGPAASLGIPE
FT                   KNTIALLPKEIAGKSVQYIVLDDASDTSRAVQNVRKLIDEDHVDAIIGSSVTPNSLAML
FT                   DPVSQGKTPAISLAASAQIIAPMDAKRAWMFKVPQNDQLMADAIAGYMAKHGVKTVGFI
FT                   GFADAYGDSWYKTFDAAAAKNGLKLVSNERYNRTDASVMGQVLKLLGANPDAVLIAGSG
FT                   TPAALPAKTLKERGYKGKVYQTHGVANNDFLRVCGKDCEGEILPAGPVLVTDQLPDSNP
FT                   VKKPALGYKAAYEKAYGAGSLSTFGGHAWDAGLLLQRAIPEALKKGQPGTEAFREALRA
FT                   SLESVKDLPVSHGVINMTATDHNGFDTRARVMVQIVDGKWKLQAE"
FT   sig_peptide     90949..91023
FT                   /locus_tag="Bcen2424_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 25"
FT   gene            92176..93360
FT                   /locus_tag="Bcen2424_0090"
FT   CDS_pept        92176..93360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0090"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_2965 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06844"
FT                   /protein_id="ABK06844.1"
FT                   /translation="MAAAVPPGTTGARRMTRRADRVARAPAVSAFRFSAAFSRYTKRMD
FT                   LSIAAILAQDGITTGAIYALLSLALVLVFSVTRVIFIPQGEFVAYGALTLAALQAQKFP
FT                   ATCWLLFVMGIACFLLEVGGLIRHRERRHQLGRTLATLGSRYILLPLAVFAITRSFAAQ
FT                   PMPMLAQIALTLAIVVPMGPFVYRLVYQPIAEGTTLLLLIVSVAVHFAMVGLGLVMFGA
FT                   EGSRTNGFSDASLAIGSMTVSVQSVLVVVTALVLIGALYVYFGRTIAGKALRATSVNRL
FT                   GARLVGIGTTEAGRLAFTFAAGLGVLSGILVGPLTTIYYDSGFLIGLKGFVGAIIGGLV
FT                   SYPLAAAGSLLVGVLESYSSFWASAYKEVIVFTLIIPVLLWRSFVTPHAEEEEE"
FT   gene            93365..95149
FT                   /locus_tag="Bcen2424_0091"
FT   CDS_pept        93365..95149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0091"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family / amino acid/amide ABC transporter
FT                   ATP-binding protein 1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: bcn:Bcen_2964 ABC
FT                   transporter related; TC 3.A.1.4.-; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06845"
FT                   /protein_id="ABK06845.1"
FT                   /translation="MKTMVRNKTFWLFLVVLFALPVLPGALQVPEYWITLLNYIGLYAI
FT                   VAIGLVLLTGVGGMTSFGQAAFVGIGAYATAFLTTRYGVSPWLALIVGVVLTALVALVL
FT                   GAVTMRLSGHFLPLGTIAWGLALFYLFGNLELLGKYDGINGIPALNLFGIVLESGRSLY
FT                   FLIWAVVLAAIVSVQNLLNSRPGRAIRALRGGGVMAEAMGVNTAWMRVVIFVYAAVLAA
FT                   VSGFLYAHLQRAVNPTPFGLNHGIEFLFMAVVGGVSHVWGAVLGAAILTVLQDYLQTLL
FT                   PKLLGSEGNFEIIVFGVLMVLLLQYARQGVWPFVARLFPRGPRAHVPEQADPLPQRAKP
FT                   VAGEPLLVVDNARKQFGGLVAVNDVSFDVKAGQIIGLIGPNGAGKSTTFNLVTGVLRPT
FT                   GGAITFRGERIDGLTSRQIVRRGIGRTFQHVKLLPAMTVLENVAIGAHLRGHTGVWRSI
FT                   ARLNAHEEAQLLAEAARQIRRVGLEKHMYDEAGSLALGQQRILEIARALCCDPTLLLLD
FT                   EPAAGLRYQEKQQLADLLRRLKAEGMSVLLVEHDMDFVMNLTDRLVVMEFGTRIAEGLP
FT                   QDVQQDPAVLEAYLGGVE"
FT   sig_peptide     93365..93445
FT                   /locus_tag="Bcen2424_0091"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.502 at
FT                   residue 27"
FT   gene            95149..95904
FT                   /locus_tag="Bcen2424_0092"
FT   CDS_pept        95149..95904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0092"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_2963 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06846"
FT                   /protein_id="ABK06846.1"
FT                   /translation="MTDTTMPILEVRGLAVRYGKVEALHGAAIKVGAGQIVSVIGPNGA
FT                   GKSTLLNAIMGALPVTGHASGAVVYRGNDVGALPVEQRVARGMCLVPEKRELFSTMTVE
FT                   DNLVLGAYRRKQAGESNFLDQLDHVFALFPRLKERRRQAAGTLSGGERQMLAVGRALMG
FT                   KPDLLMLDEPSLGLAPLIVKEIFHIISALRGTGVATLLIEQNARAALQISDYGYVLETG
FT                   EFALEGPAAELAQNPQVIETYLGLAKKTA"
FT   gene            96438..98408
FT                   /locus_tag="Bcen2424_0093"
FT   CDS_pept        96438..98408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0093"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: bcn:Bcen_2962
FT                   glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06847"
FT                   /db_xref="GOA:A0K2X0"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2X0"
FT                   /protein_id="ABK06847.1"
FT                   /translation="MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKI
FT                   HVGLNNYTGGRAGDPAAVSLSSRLKELKLPQGRLKTGTPPRIDGRTIDFSKLDEQPGDL
FT                   DPIPVFSFLGRADQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSI
FT                   EDKIHRFASKESHQIFLEPEGLTTHEFYPNGISTSLPFDVQLELVHSMRGLENAHILRP
FT                   GYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEK
FT                   DAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGL
FT                   VDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPVEEATALLGKAIDHEYSLAELLRRP
FT                   GVSYDGVCGLKGGECGPAEPLADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANE
FT                   NTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKRRGLG
FT                   RRNGTAAEAAEQGDGAVPTQQ"
FT   gene            98405..99091
FT                   /locus_tag="Bcen2424_0094"
FT   CDS_pept        98405..99091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0094"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; Methyltransferase type 11;
FT                   KEGG: bcn:Bcen_2961 methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06848"
FT                   /db_xref="GOA:A0K2X1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2X1"
FT                   /protein_id="ABK06848.1"
FT                   /translation="MTARRAPAVNRDVLEGMLVEGTAALDLTLTDTQRNQLLDYVALLG
FT                   KWNAVYNLTAIRDPMQMLIQHILDSLSIVPHLRGRTSARVLDVGSGGGLPGIVLAIVEP
FT                   GWQVTLNDIVQKKSAFQTQMRAELKLANLSVVTGRVESLQPGVEVPEKFDMIVSRAFAD
FT                   LSDFVKLARHLVAPGGSIWAMKGVHPDDEIARLPEGSRVTQTIRLAVPMLDAERHLFEV
FT                   AVDDAN"
FT   gene            99143..99922
FT                   /locus_tag="Bcen2424_0095"
FT   CDS_pept        99143..99922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0095"
FT                   /product="chromosome segregation ATPase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   bcn:Bcen_2960 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06849"
FT                   /protein_id="ABK06849.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNA
FT                   TMGSGIDKAACEATVYEVLVDGVSVADARVRPEGVTYDVLPANRELSGAEIELISIDNR
FT                   ERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVN
FT                   TIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQLKAHFGDKVFDAVIPRNVRLAEA
FT                   PSYGLPGVVFDRSSRGAQAYIQFGAEMIERVRAFEVS"
FT   gene            99930..100847
FT                   /locus_tag="Bcen2424_0096"
FT   CDS_pept        99930..100847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0096"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: bur:Bcep18194_A3278
FT                   ParB-like partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06850"
FT                   /protein_id="ABK06850.1"
FT                   /translation="MSEARKKDMNAVPKKKGLGRGLEALLGGSADITEAVKIEGAPNTL
FT                   ALGKLQAGKYQPRTRMDEGSLQELAASIRAQGVMQPILVRPISSDKYEIIAGERRFRAA
FT                   RLAGLDEVPVLVKDVSDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFGFTHEQAAE
FT                   SVGRSRSAVSNLLRLLNLASPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRM
FT                   SVRETEKLVSHTTKEAPAVKARAKDDGGRDTRRLEEELSDLLASTVKIKLGRRGRGQVL
FT                   IDFGNLDALEGILARLRGNVATEE"
FT   gene            100858..101988
FT                   /locus_tag="Bcen2424_0097"
FT   CDS_pept        100858..101988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0097"
FT                   /product="transporter, YbiR family"
FT                   /note="PFAM: Citrate transporter; KEGG: bcn:Bcen_2958
FT                   citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06851"
FT                   /protein_id="ABK06851.1"
FT                   /translation="MEETGAPAPRRWLGWLAQEPVLSVLALGLIVLQWVRPQPFSVLAD
FT                   RVDWQTVATLGGLLMLTKALELSGCLMWLAHRIVHHVHSERGLAMLLVGFAAVLSMWLT
FT                   NDVALFVVVPLMVSLRALTPLPFRRLVIVVALAVNAGSVATPLGNPQNLFLWQLSGVSF
FT                   GRFVVTLGPLALALMALLLVLTALMFRAKPLDLSGDAAALPVQRMHALIAAVLFAAFVL
FT                   LADAHHPLPGLVGVAIVLFAVKRDAVLKIDWLLLLIFVLMFVVLRSAAALPVVHDAIAH
FT                   AQLDSPLRVYAAGAVLSQVISNVPAAILLSEFTHDWRALAFGVSVGGFGFAIGSLANLI
FT                   AVRLAKEPRMWLPFHLVSIPFALASAALGAWLLMHG"
FT   gene            102123..102440
FT                   /locus_tag="Bcen2424_0098"
FT   CDS_pept        102123..102440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06852"
FT                   /protein_id="ABK06852.1"
FT                   /translation="MNRCANIRRISRVARDGSVTVRCLFHRVAPSHSRWLACSPFPAAI
FT                   VPLPPGPHQASFPRHLPRHRTFSRKKYRCEKPTLQLSSYVVESGVFSHHEASFYAGFCR
FT                   V"
FT   gene            102555..103079
FT                   /locus_tag="Bcen2424_0099"
FT   CDS_pept        102555..103079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0099"
FT                   /product="F0F1-type ATP synthase subunit I-like protein"
FT                   /note="KEGG: bcn:Bcen_2956 F0F1-type ATP synthase subunit
FT                   I-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06853"
FT                   /protein_id="ABK06853.1"
FT                   /translation="MAGQAPDDRHDDQRTQRTASAVGARRESDDDWDVEQQDNNIVPLT
FT                   RAEAERLFGPNVSKPSRMTPYKVVFAQVVLSLVATLAWWLFSKSPGAAAQSAFLGGAIG
FT                   WVPSAVFVARLKAGGTATVMSWVMGEALKLALTIGMFTAVAFGWAGVHWVPFLVTYLVV
FT                   LKTYWIALAWR"
FT   gene            103190..104041
FT                   /locus_tag="Bcen2424_0100"
FT   CDS_pept        103190..104041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0100"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   bcn:Bcen_2955 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06854"
FT                   /protein_id="ABK06854.1"
FT                   /translation="MAASEGTRGPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFWS
FT                   IVCGIVTIVLLRLAARKATSGVPGRFQCAIEMLVEMVEDQSKAIVHGNRTFIAPLALTV
FT                   FVWVALMNSLDFLPVDLPGRVIGLLGLSDVISHHRIVPTADLNGTLGIALGVFVLMIYY
FT                   SIKIKGAGGFAHELLSAPFGGHPALWIPNLALNIVEYVAKTVSLGMRLFGNMYAGELLF
FT                   LLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYLGQAHD
FT                   TH"
FT   gene            104117..104386
FT                   /locus_tag="Bcen2424_0101"
FT   CDS_pept        104117..104386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0101"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   bcn:Bcen_2954 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06855"
FT                   /protein_id="ABK06855.1"
FT                   /translation="MQAYIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQ
FT                   PELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG"
FT   gene            104516..104986
FT                   /locus_tag="Bcen2424_0102"
FT   CDS_pept        104516..104986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0102"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   bcn:Bcen_2953 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06856"
FT                   /db_xref="GOA:A0K2X9"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2X9"
FT                   /protein_id="ABK06856.1"
FT                   /translation="MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLA
FT                   AAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQ
FT                   AKAEAEQQIVKAREALRGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL"
FT   gene            104989..105528
FT                   /locus_tag="Bcen2424_0103"
FT   CDS_pept        104989..105528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0103"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: bcn:Bcen_2952 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06857"
FT                   /db_xref="GOA:A0K2Y0"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2Y0"
FT                   /protein_id="ABK06857.1"
FT                   /translation="MAELATIARPYAEALFRVAEGGDIAAWSTLVQELAQVARLPEVLS
FT                   VASSPKVTRTQVAELLLAAVKSPVAAGAEAKNFVQMLVDNHRIALLPEIAEQFEALKNE
FT                   REGAADAEIVSAFPLNGADLDSLVSGLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLD
FT                   TSVRARLASMQAALTA"
FT   gene            105573..107114
FT                   /locus_tag="Bcen2424_0104"
FT   CDS_pept        105573..107114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0104"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: bcn:Bcen_2951 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06858"
FT                   /db_xref="GOA:A0K2Y1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2Y1"
FT                   /protein_id="ABK06858.1"
FT                   /translation="MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLS
FT                   DVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELV
FT                   GRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQ
FT                   RELIIGDRQCGKTAVALDAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTI
FT                   VVAASASDSAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDD
FT                   LDVKQVLPFEKGLRDNLKTSHADLIKRIEDTKDLSKDDEGALRSAIEAFKKSGAY"
FT   gene            107184..108059
FT                   /locus_tag="Bcen2424_0105"
FT   CDS_pept        107184..108059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0105"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: bcn:Bcen_2950 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06859"
FT                   /protein_id="ABK06859.1"
FT                   /translation="MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPY
FT                   ADKVRAIAAHMSRANPEYRHPFMVANDGAQTAGIILVTTDKGLCGGLNTNVLRATVQKF
FT                   KELEEKGQKVEATAIGGKGLGFLNRFGAKVMSQVVHLGDTPHLDKLIGAVKTQLDLYSE
FT                   GKLSAVYIAYTRFVNTMKQEAVIEQLLPLSSDHFEADDGTPATSWDYIYEPDAQAVVDE
FT                   LLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLVYNKSRQAAITKEL
FT                   SEIVGGAAAV"
FT   gene            108126..109520
FT                   /locus_tag="Bcen2424_0106"
FT   CDS_pept        108126..109520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0106"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: bcn:Bcen_2949 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06860"
FT                   /db_xref="GOA:A0K2Y3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K2Y3"
FT                   /protein_id="ABK06860.1"
FT                   /translation="MSTAALVEGKIVQCIGAVIDVEFPRDSMPKIYDALILDGSELTLE
FT                   VQQQLGDGVVRTICLGASDGLRRGLTVKNTAKPISVPVGKPTLGRIMDVLGRPIDEAGP
FT                   IESDVTRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNM
FT                   MELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLR
FT                   VALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGK
FT                   LQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDP
FT                   LDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARK
FT                   IQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFE
FT                   KAKKIQ"
FT   gene            109641..110066
FT                   /locus_tag="Bcen2424_0107"
FT   CDS_pept        109641..110066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0107"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: bcn:Bcen_2948 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06861"
FT                   /protein_id="ABK06861.1"
FT                   /translation="MATIKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITRI
FT                   RPGAVRIEVEGGNDEFVFVAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEET
FT                   LQNAKSDLDLAKAQSELATAMAQLEAIQRLAKIRSRH"
FT   gene            110330..112057
FT                   /locus_tag="Bcen2424_0108"
FT   CDS_pept        110330..112057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0108"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_2947 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06862"
FT                   /protein_id="ABK06862.1"
FT                   /translation="MAADLGKGALIAPENGLSYVRGATDVPLSDATIGRFLLDTAGRFP
FT                   DRPAVVFREQQVRWTWREFANEIDVLAAGLAALGIVKGDCVGIWSPNRSEWLLTQFATA
FT                   RIGAVLVNINPAYRLSELEYALNKVGCKAVIAAERFKSSAYVEMLQTLAPELATATPGD
FT                   LHAARVPKLRTIVSMGEVAPAGMFRFADVMARGRQAVDPALLDAIGAALTANDPINIQF
FT                   TSGTTGSPKGATLTHRNVVNNARSIAMAMRFTEQDSLCIPVPLYHCFGMVLAVLACVST
FT                   GAAMVFPGEAFDPVATLAAVAEERCTALHGVPTMFIAELDHPAFPTFHLSTLRTGIMAG
FT                   SPCPIETMKRVVSQMHLSEITIAYGMTETSPVSFQSSTDDPLEKRTTTVGRIQPHLEVK
FT                   IVDPSGDIVPVGATGELCTKGYSVMLGYWDDDAKTREVLVDGWMHTGDLATLDADGYCN
FT                   IVGRLKDMVIRGGENVYPREIEEFLFRHPKIQSAQVFGVPDAKYGEELCAWIVLRADEQ
FT                   MTEDDVRAFCTGQIAHYKIPRYIRFVDELPMTVTGKVQKFVMRERMIEELKLDVQKTA"
FT   gene            complement(112343..112720)
FT                   /locus_tag="Bcen2424_0109"
FT   CDS_pept        complement(112343..112720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06863"
FT                   /protein_id="ABK06863.1"
FT                   /translation="MGTDPAAAARAVTHCRRCAGPSRGAKPDELAEWPTSPHSDHVSKS
FT                   FRRMNRHARYRSRRALSRVKIGNSSRPIRMKNASCAYLENAAENMGKNDLFQDPENSKK
FT                   SRKALSGGRYNLKHFVTATGH"
FT   gene            complement(112747..113559)
FT                   /locus_tag="Bcen2424_0110"
FT   CDS_pept        complement(112747..113559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0110"
FT                   /product="cyclohexadienyl dehydratase"
FT                   /EC_number="4.2.1.91"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_2945 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06864"
FT                   /protein_id="ABK06864.1"
FT                   /translation="MKTFATLATLAAAAAFCCAAAHAQGTTTPAPASAAAAGSRLDDVL
FT                   ARGALRVCTTGDYKPYSYYRADGRFEGIDIDMAESLAKSLGVKTDYVKTSWSNLTNDFV
FT                   AKCDIAVGGVSTTLERQKRVFFTQPYVVDGKTPIVRCADADKYQTVAQIDRPETRVIVN
FT                   PGGTNERFAKQFFTHANLTVFPDNVTIFKQILAGKADVMVTDASETLLQQKLNPGLCSV
FT                   HPDKPFQFGEKAYMVPRGDVTFQQYVDQWLHLALSTGEYQAISDKWLK"
FT   sig_peptide     complement(113488..113559)
FT                   /locus_tag="Bcen2424_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            113625..114803
FT                   /locus_tag="Bcen2424_0111"
FT   CDS_pept        113625..114803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0111"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: bcn:Bcen_2944 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06865"
FT                   /protein_id="ABK06865.1"
FT                   /translation="MAAIASACAARSRLSGKMPLCLRIVAPTVAHNLLNDTFLRALLRE
FT                   PTDYTPIWLMRQAGRYLPEYNATRARAGSFLGLAKNPDYATEVTLQPLERFPLDAAILF
FT                   SDILTIPDAMGLGLDFQVGEGPKFAHPVRTEADVAKLAVPDIEETLGYVTGAVREIRRA
FT                   LTDGQGRQRVPLIGFSGSPWTLACYMVEGGGSDDFRTVKSMAYSRPDLMHRILDVNAQA
FT                   VAAYLNAQIEAGAQAVMIFDTWGGALADGAYQRFSLDYIRRVVSQLKREHDGERVPVIT
FT                   FTKGGGLWLEEIAATGVDAVGLDWTVNLGAARERVAGRVALQGNLDPTILFAPPAAVRE
FT                   QVRAVLDSYGNHPGHVFNLGHGISQFTSPDHVAELVDEVHTHSRAIRSGAAG"
FT   gene            115255..117516
FT                   /locus_tag="Bcen2424_0112"
FT   CDS_pept        115255..117516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0112"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: helicase
FT                   domain protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; KEGG: bcn:Bcen_2943
FT                   primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06866"
FT                   /protein_id="ABK06866.1"
FT                   /translation="MSGTYLRVALDHPLATLFDYRCDVQPAPVPGTLVQVPFGKRQAVG
FT                   LVCEVTTHTDVPPSRLRAVDAICTELPPLSADWLALVSFAADYYQRGRGEVALPALPQA
FT                   LRDAGRWGRLLAPEVRYRPNEAGRAALPDALPARGAALRRLAQALVDTGSLTLPDARAL
FT                   HPKAAATLDDWAARGWVDVEEIGWADAPVVNPVDNLSTGSGRAVPPALTDQQAEALDAI
FT                   RAAQGFAPFLLHGVTGSGKTEVYLHALASLLDARPDAQALVLVPEINLTPQFEAAFRAR
FT                   FAGALADDAIVTLHSGLAEGERARNWLAAHTGRARIVLGTRLAVLASMPTLALIVVDEE
FT                   HEPAYKQQEGLRYSARDLAVWRAKQLGITVVLGSATPSLESWWQAEQGRYTRLTLSRRA
FT                   VADATLPTVRLIDLEEERRRGRASMGGLSGPLVAALKARLERGEQSLVFLNRRGYAPQL
FT                   ACDACGWVAGCPRCSAYVVLHKPEHALRCHHCGWEARIPRSCPECGNVDIAPLGRGTQR
FT                   IEEALAEAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFQRVS
FT                   LVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVMVQTRYPRHALYHALGR
FT                   QDYVGFANSTLAERRDAHLPPFVYQALLRAEGRTLDAALAFLLQAAAALPGLPGADRVT
FT                   VYDAVPMTIVKVANVHRAQLLLESASRAALQHALRAWQPELRALKGVLRWSVEVDPLDI
FT                   "
FT   gene            117943..121875
FT                   /locus_tag="Bcen2424_0113"
FT   CDS_pept        117943..121875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0113"
FT                   /product="L-proline dehydrogenase /
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /EC_number="1.2.1.88"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: aldehyde dehydrogenase; Proline
FT                   dehydrogenase; KEGG: bcn:Bcen_2942
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06867"
FT                   /protein_id="ABK06867.1"
FT                   /translation="MASTTLGVKVDDLLRSRLKDAAARLERTPHWLIKQAIFAYLERIE
FT                   HGQLPPELSGHSGVTELADGQATDGDDDNSPHPFLEFAQNVQPQSVLRAAITAAYRRPE
FT                   PECVPFLLGQARLPANLQADVQALATKLVEALREKSSGGGVEGLIHEFSLSSQEGVALM
FT                   CLAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSE
FT                   AGLSSALTRLIGRGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSY
FT                   DMLGEAATTEEDAQRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQD
FT                   RTMSELLPRVRALALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFV
FT                   VQGYQKRCPFVIDYLIDLARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIY
FT                   TDVSYLACAKKLLGAPDAVYPQFATHNAHTLAAIYHLAGQNYYPGQYEFQCLHGMGEPL
FT                   YEEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVPVKELVA
FT                   DPVDEASKVVPLGAPHAKIPLPRNLYGDERPNSMGLDLSNEHRLASLSSALLASAHHPW
FT                   RAAPMLADDALADAPARDVRNPADQRDVVGTVSEATSEHVSAALAHAVAAAPIWQATPV
FT                   DARADCLVRAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYAAQIRGEFS
FT                   NDTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLREA
FT                   GVPAGAVQLLPGTGETVGAALVADPRTRAVMFTGSTEVARLINKTLAARLDPDGKPIPL
FT                   IAETGGQNAMIVDSSALAEQVVADVMQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKG
FT                   AMHELALGNPDRLSTDVGPVIDAEAKQTIDTHVAAMKDKGHAVTQLPMPDACAHGTFVP
FT                   PTLIEIGSIDELKREVFGPVLHVVRYRRSQLDKLLEQIRATGYGLTLGIHTRIDETIAH
FT                   VISNAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPSGLPRAL
FT                   AQSLVADGATESDARGNPAAALTTLRDWLIEQREPALAARCDGYLAQVPAGATAVLSGP
FT                   TGERNTYTLGPRGTVLCVAATPGGARAQFAAVLATGNRALFAGAAGEALVAALPASLKA
FT                   HAAVRKQADAPFDAVLFEGDSDELQTLVKDVAQRPGPIVSVQGVSAGAFENGDAEDYAL
FT                   ERLLTERSVSVNTAAAGGNANLMTIG"
FT   gene            121960..123099
FT                   /locus_tag="Bcen2424_0114"
FT   CDS_pept        121960..123099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0114"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bcn:Bcen_2941 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06868"
FT                   /protein_id="ABK06868.1"
FT                   /translation="MQHTMKKVAGATFVAVMSLAGTAHADDVKIGYAGPMTGAQAHYGK
FT                   DMQNGIVLALEDFNATNPKIGGKAVKFVLDTQDDQADPRTGTTVAQKLVDDGIKGMLGH
FT                   FNSGTTIPASRIYANAGIPEIAMATAPEYTQQGYKTTFRMMTSDTQQGSVAGTFASKDL
FT                   GMKKIAIVDDRTAYGQGLADQFEKAAKAGGATIVDREFTNDKAVDFKAILTKLKAAKPD
FT                   LVYYGGADSQAAPMVKQMKTLGITAPLMSGEMVKTPTFLKIAGNAAEGTIASLAGLPLE
FT                   EMPGGKAYADKYKKRFGEDVQTYSPYAYDGAMAMLNAMKKADSTDPAKYLPVLAKTDMA
FT                   GVTSTHVAYDAKGDLKNGGITMYKVEKGDWKPLKSIGGK"
FT   sig_peptide     121960..122037
FT                   /locus_tag="Bcen2424_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(123306..123716)
FT                   /locus_tag="Bcen2424_0115"
FT   CDS_pept        complement(123306..123716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06869"
FT                   /protein_id="ABK06869.1"
FT                   /translation="MPKFIVSLYLITSSPVFACIASENFDIYFSRDSSHISNAEIVRIA
FT                   KWTIDQKLNYANHLTKETTLISGHAEESEPEALALAQSRLQTAYALLEQLGFLRGTIKK
FT                   SVRVYSHGDVDNGRRVEISFLPDCPNKCCDGK"
FT   sig_peptide     complement(123660..123716)
FT                   /locus_tag="Bcen2424_0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.978 at
FT                   residue 19"
FT   gene            complement(123936..125444)
FT                   /locus_tag="Bcen2424_0116"
FT   CDS_pept        complement(123936..125444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0116"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_2939 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06870"
FT                   /protein_id="ABK06870.1"
FT                   /translation="MNLVAALDRAARATPDKPFLVSESATITYAAARERSHRAAAVLSA
FT                   LGVAAGDRVAAMCFNTPAFVDLMFGAWRLGAAFVPINHKLQAPEVDYVLEHSGSTALLF
FT                   DVALAPVVERIVHPARRLVTEGELDGVPNFDTMCATMDGLPGIEPADDDVAQILYTSGT
FT                   TGRPKGCVHSHRTVTLAAMQAALATGIGRNERTLMAMPIWHSSPLNNWFGGTLVAGGTV
FT                   VLLREYHPLRFLQTVERERVTLYFGAPVSYTLPLDTIDGFAAFDLSSVRAWLYGGGPIG
FT                   AAQAERLAQAYRSHAFFQVYGMTETGPAGTTLYPDEQIAKAGSIGRQGGPGVDLRVVRM
FT                   DGVDAQPGETGEIWLKADSMMLGYLDDAAATRAAFAPDGWYRTGDIARIDQDGYLFIVD
FT                   RLKDMIVTGGENVYSKEVEDVLGAHPDIAEAAVVGVPHPDWGETVVAHVVLRANAARDA
FT                   DALRTFCGERLAAYKIPREFTFAQALPRTPTGKLQKFLLRVRGD"
FT   gene            complement(125495..127147)
FT                   /locus_tag="Bcen2424_0117"
FT   CDS_pept        complement(125495..127147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0117"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bcn:Bcen_2938 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06871"
FT                   /protein_id="ABK06871.1"
FT                   /translation="MTDSTHAVTNQFDELVDYNLFATDLALRDALARAGADWAVPQLDA
FT                   YGARLGSADTAQLADEANQHTPELHAFDRRGRRIDRVDFHPAWHALLGQYRHEGFVSLA
FT                   FRDPRRGRWAATAAGFYLHGQIEAGTLCPATMTQAAIPVLQKEPALWDLLRDKLYSDDY
FT                   DPRDVPVADKRAIWFGMGMTEKQGGSDVRANTTLATPVGAGGRGGEYRLRGHKWFFSAP
FT                   MCDAHLVVARTEAGSPSCFYVPRWRPDGTKNAVEIQRLKNKVGNRSNSSSEIELNDAWG
FT                   IMLGDEGRGIPTIIEMATYTRLNCVLGSAAMLRQGVVQAIAYTRQRHAFGRALAEQPLM
FT                   RTVLADLALESEAALSLAMRLADAFERDDSPRERAWKRIVTPAAKFWVCKRAVELTGEV
FT                   MEVFGGNGYVDDGPIARLFREAPVNSIWEGSGNVMCLDVLRAVSREPDAAAALFDELAD
FT                   LGAGEPRIRAALDGLRAMLAAPADTLEASGRVFAQRLAVVAQACLLRRDAPAAVSDAFV
FT                   ATRLAAPDWGRIAGGFDPHAIDVAALLQRAYPA"
FT   gene            127279..127947
FT                   /locus_tag="Bcen2424_0118"
FT   CDS_pept        127279..127947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0118"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_2937
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06872"
FT                   /protein_id="ABK06872.1"
FT                   /translation="MPPRHVQVPAPPGSPAAQPAPALRRRPRQSRAQASSDALQQAFVQ
FT                   LLLERGYAKATIREIAAVAGVSIGTFYEYFGDKQSLAALCIHRRVLALADRLRDTVQRL
FT                   RGAPRAELAVALVDLQVDTIAADAALWGALLALERQVSPLAAYRRHYDAYVALWRDALA
FT                   QAADPPPAARLDGLARMAHTICYGGLSQALLTLGPALDFAAQRRELRAVLLAYLAAADA
FT                   "
FT   gene            128154..129308
FT                   /locus_tag="Bcen2424_0119"
FT   CDS_pept        128154..129308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0119"
FT                   /product="2-keto-4-methylthiobutyrate aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   bcn:Bcen_2936 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06873"
FT                   /protein_id="ABK06873.1"
FT                   /translation="MRSATAPRSKLPDVGTTIFTVIGQLAAQHDALNLSQGAPNFAPDP
FT                   ALVEGVARAMRDGHNQYAPMAGVIALRERLAEKTEALYGARYDPATEITVIASASEGLY
FT                   AAISALVHPGDEVIYFEPSFDSYAPIVRLQGATPVAIKLSPEHFRVNWDEVAAAITPRT
FT                   RMIIVNTPHNPTATVFSADDLERLAQLTRDTGIVVLSDEVYEHVVFDGAQHQSVARHRE
FT                   LAERSVIVSSFGKSFHVTGWRVGHCLAPAELMDEIRKVHQFMVFSADTPMQVAFAEILA
FT                   RPDSYLGLSAFYQAKRDLLARELADSRFELLPSEGSFFMLARFRHFSDESDSDFVLRLI
FT                   RDARVATIPLSAFYTDGTDAGVIRLSFSKDDATLVEGARRLRSL"
FT   gene            129366..130154
FT                   /locus_tag="Bcen2424_0120"
FT   CDS_pept        129366..130154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0120"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_2935 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06874"
FT                   /protein_id="ABK06874.1"
FT                   /translation="MKHTATLKLAFALACAIGSGAALADAPTLRFGLEAQYPPFESKAP
FT                   NGDLQGFDIDVGNAVCQTAKLSCKWVETSFDGLIPALKGRKFDAINSAMNATEQRRQAI
FT                   DFTTIIYRVPTQLIARTGSGLLPTPESLKGKRVGVLQASIQETFAKAHWEPAGVAIVAY
FT                   QDQNQAYADLVAGRLDATLVLAPSGQRGFLSRPDGKGFSFVGQPVHDDKILGSGIAFGL
FT                   RKGDDALKAKLDAAIDKLKADGTVKSLGLKYFGDIDISTK"
FT   sig_peptide     129366..129440
FT                   /locus_tag="Bcen2424_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            130170..131600
FT                   /locus_tag="Bcen2424_0121"
FT   CDS_pept        130170..131600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0121"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bcn:Bcen_2934 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06875"
FT                   /protein_id="ABK06875.1"
FT                   /translation="MPTSNRTAAGSAPDGRPLPDEAVDAVLAAELGDALVTRAADIDPR
FT                   YFTAYNEPAGVRPRALVRPCSVDDVSRTLALCSRLGQPVVPQGGLTGLARGAVALGGEV
FT                   VLSMERFAGIEALDAAAGTITVRAGTPLQTVQEAAEAAGFTFGVDLGARGSCQIGGMLA
FT                   TNAGGTRAIRYGMMREQVLGLEAVLADGTIVSSMNRMLKNNAGYDLKQLFIGSEGTLGV
FT                   VTRAVLRLHPLLAAPATALCRVRDYDAVVALWNRVRTLPEVVSFEAMWPAFYDYVARHT
FT                   PGVSAPFIGDGGFVVLIECATSAPGGDAHQALETGLAAGFDAGLVDDAVLATSERQARD
FT                   LWTLREGLAIDALPQLVNFDVSLPTGELGTFAERCEAALRARWPALTCLFFGHVGDGNV
FT                   HIGVSLAEMTDADADALDHCVYAVVRDMGGSVSAEHGIGVLKRPYLAHTRSDAEIGLMR
FT                   RLKAALDPRGILNPGKVL"
FT   gene            complement(131646..132218)
FT                   /locus_tag="Bcen2424_0122"
FT   CDS_pept        complement(131646..132218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0122"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: bcn:Bcen_2933 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06876"
FT                   /protein_id="ABK06876.1"
FT                   /translation="MSTSRPSPLALAVLATLTETPMHPYGMLQQLKARGYDEVVNVRQR
FT                   TSLYQTIDRLLRDGLIAVHDTERDGAFPERTVYALTEAGHTAGQAWLHALLAEPAREFP
FT                   AFGAGLAFLPLLDAEDARHQLELRIARLDAERERLEALRATAQADQVPRLFLLQNEHAL
FT                   VLLNAELNWARSVVEHLKIGALRWVDG"
FT   gene            complement(132287..132718)
FT                   /locus_tag="Bcen2424_0123"
FT   CDS_pept        complement(132287..132718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0123"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   bcn:Bcen_2932 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06877"
FT                   /protein_id="ABK06877.1"
FT                   /translation="MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRNYTDVHVE
FT                   RLRFIRNCRALDMAHDEIRALLQLTDTPADRCDSINSLLDDHIGHVDARLAELTHLRDQ
FT                   LTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRSHLG"
FT   gene            132800..135340
FT                   /locus_tag="Bcen2424_0124"
FT   CDS_pept        132800..135340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0124"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: bcn:Bcen_2931 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06878"
FT                   /protein_id="ABK06878.1"
FT                   /translation="MTDAKRPHDPRHRHAGGADACCADARDTQTATIADAAPAAGEHAH
FT                   GHDHDHGHGHDHTAHGEAGHDHGHGHAGDDQHVHGATCSHDHAAHDHAGHDHDHDHDHD
FT                   HDHDHAAGDCCAPAALTLAPLPVAQATASGHVRSAFRIMQMDCPTEETLIRRKLGGMGE
FT                   VSALEFNLMQRMLTVEHVPGAQPALESAIRSLGMTPEAASTDAPAAPTAPPPAKPWWPL
FT                   ALAGVAASASEGATWAGLPVWLSAALALAAVLACGLTTYKKGWIAIRNGNLNINALMSI
FT                   AVTGAMAIGQWPEAAMVMVLFTIAELIEAKSLDRARNAIQGLMQLAPDTATVQQPDGAW
FT                   RTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITGESLPVEKASGDAVYAGT
FT                   INESGSFDYRVTAVAANSTLARIIHAVEEAQGAKAPTQRFVDQFARVYTPIVFAVALLV
FT                   AVVPPLVMGGAWHDWIYRALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYL
FT                   EEGRKLAWLALDKTGTITHGKPVQTDFDVHADDADAARVRHLGASLAARSDHPVSQAIA
FT                   AAARAAGTAAFADVQDFEAIVGRGVRGTIDGTRYWLGNHRLVEELERCSTALEAKLDAL
FT                   ERQGKSVVVLVDATRVLGIFAVADTIKDTSRDAIADLHALGIRTAMLTGDNPHTALAIA
FT                   RQAGIDDARGNQLPEDKLAAVEELAAGGAGAVGMVGDGINDAPALARADIGFAMGAMGT
FT                   DTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNIGFALGVKVVFLGLTVAGLGTMW
FT                   MAVFADAGASLIVVANGLRLLSSSGAFGGAPAKR"
FT   gene            135351..135734
FT                   /locus_tag="Bcen2424_0125"
FT   CDS_pept        135351..135734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06879"
FT                   /protein_id="ABK06879.1"
FT                   /translation="MSFLKRILGGHGGGHGSGHGNSGNGGHGGHGGGHHGGSRQGGHDA
FT                   RGRDRHGWGWQAPADAGGGQGGQRGNVPLSQLACAGCGALNAADARFCAQCGVAQRGKA
FT                   CSRCHAALAADARFCPGCGTQAA"
FT   gene            complement(135893..136774)
FT                   /locus_tag="Bcen2424_0126"
FT   CDS_pept        complement(135893..136774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0126"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; transcription activator, effector binding; KEGG:
FT                   bcn:Bcen_2929 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06880"
FT                   /protein_id="ABK06880.1"
FT                   /translation="MTPAETKTDPPAWVRYAASVARVHAYISAHLDGPLDLNRLAEVAC
FT                   LSPYHWQRVYRALYGESIVLTVRRMRIVRASEDLVCTARPLDEIARRAGYGSTHAFARA
FT                   FRDAYGVLPAQHRRTGTHRPIYPLQRGEADMFKHEVEIRRLPELRGYAVTHTGAYMKVG
FT                   DAFGRIGAWVGQHGLIGPGAKMIGIFYDDPDTTPEAQLRAKACFMPADGAPDVAPVPPV
FT                   ERVTIAGGEYAVLLHTGPYADLKTAYQWLYGDWLRHSGREAADAPPFELYLNTPMDTAP
FT                   ADLRTEIHLPLR"
FT   gene            137050..138513
FT                   /locus_tag="Bcen2424_0127"
FT   CDS_pept        137050..138513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0127"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: bcn:Bcen_2928 conserved TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06881"
FT                   /protein_id="ABK06881.1"
FT                   /translation="MDASSFITSLQATLGGYLPKIAGAIGILVIGWLIAVAVRAGALRL
FT                   LNALKVDQRITDSTGQGACVERIIASGLFWLVLLVTAVGIFNVLNLYAVSNPFSLLVTH
FT                   IVNYLPNLIGGAALTLIAWLIASLLRSLANRALKASKVDATLSESAGMQPMSGYLGDVL
FT                   FWLVILMFLPAILGSFALSGLLSPVQGMVDKLLAIVPNIFAAAVIGFVGWVVARVLRGL
FT                   VTNLLVAAGADRLTQGIDSPTPVRVSSLVGTIVYVFVFVPTLISALDALKIDAISIPAT
FT                   NMLNQFLGAVPDIVAAIVIVLVTFYFARFVASLAQKLLEAAGVDGLPAVLGVERVFSGI
FT                   LQPSVLVARLIVFFAMLFASVEAANRLGFTQVRDVVTLFIEFGGHVLMGGVILVIGVWL
FT                   AGLARRVIEQADREHSVLFARIAQFAILGLVFAMGLRAMGIANEIVQLAFGLVLGAIAV
FT                   AVALSFGLGGREAAGKLLDRWFNQRGGGQ"
FT   gene            138745..140157
FT                   /locus_tag="Bcen2424_0128"
FT   CDS_pept        138745..140157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0128"
FT                   /product="ethanolamine:proton symporter, EAT family"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: bcn:Bcen_2927
FT                   ethanolamine permease; TC 2.A.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06882"
FT                   /protein_id="ABK06882.1"
FT                   /translation="MKAESNGRPAAGAKSSGQPALQQTLGTWQLWGIAVGLVISGEYFG
FT                   WSYGWASAGTLGFVITALFVAAMYTTFIFSFTELTTSIPHAGGPFAYARRAFGPTGGYL
FT                   AGAATLVEFVFAPPAIALAIGAYLHVQFPGLEPKHAAMGAYLVFMALNIVGVQIAATFE
FT                   LVVTLLAIFELLVFMGVVSPGFAWSNFTKGGWSGADHFSVGAFHGMFAAIPFAIWFFLA
FT                   IEGVAMAAEEAKNPKRSIPIAYVAGILTLVALAIGVMVFAGGAGDWTKLANINDPLPQA
FT                   MKYIVGANSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALAREGYLPEWLGKVHPRFK
FT                   TPHRAILAGGVVGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIVSMAALFKLRRS
FT                   QPNLERPFRAPLYPIFPAFAILAALVCLGTMVYFTGLVALVFVGFLAVGYAYFLATRSQ
FT                   RASAPGDALLEE"
FT   gene            140258..141655
FT                   /locus_tag="Bcen2424_0129"
FT   CDS_pept        140258..141655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0129"
FT                   /product="Ethanolamine ammonia-lyase heavy chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: bcn:Bcen_2926 ethanolamine ammonia lyase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06883"
FT                   /protein_id="ABK06883.1"
FT                   /translation="MSYTETIGPRTYRFADLKTLLAKASPLRSGDQLAGVAAASEEERV
FT                   AAKIALAGVPLKAFLNEAVIPYEDDEVTRLIIDDHDAQAFAEISHLTVGDFRNWLLSPA
FT                   ADGAALERIAPGLTPEMVAAVSKLMRNQDLIAAARKRRVVTRFRNTVGLAGRMSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGCGDAMIGINPATDSLAAIVKLLAMIDGFRERYGVPTQS
FT                   CVLTHVTNTIAAIEKGAPVDLVFQSIAGTEKANASFGISLALLGEAREAALALKRGTVG
FT                   NNLMYFETGQGSALSANAHFGVDQQTCEVRAYAVARKFEPFLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGAAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDQLYVREVLGLRRAPEFEEWLETMEIADAHGALRAATARVPLLAGAN
FT                   DWMGISA"
FT   gene            141652..142449
FT                   /locus_tag="Bcen2424_0130"
FT   CDS_pept        141652..142449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0130"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   bcn:Bcen_2925 ethanolamine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06884"
FT                   /protein_id="ABK06884.1"
FT                   /translation="MSDAVEKNPWAQLKSFTNARIALGRAGNSLPTAPLLAFNLSHAQA
FT                   RDAVHQPLDADALRREIEAAGLLPTLRVQSAAPDRDHYLRRPDLGRKLSDDSRGLLAGY
FT                   GAALDDAPDVVFVVGDGLSAFAAAKQALPLLQAVRPRLDADGWRIGPVVVATQARVALG
FT                   DEIGELLRAKVVAMLIGERPGLSSPDSLGVYLTWAPKVGCHDALRNCISNVRPEGLPHA
FT                   AAAHKLHYLMTHARRLQLTGVGLKDDSDALLPAAEAERIGATT"
FT   gene            complement(142442..143326)
FT                   /locus_tag="Bcen2424_0131"
FT   CDS_pept        complement(142442..143326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0131"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_2924 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06885"
FT                   /protein_id="ABK06885.1"
FT                   /translation="MENLTGIVAFVRTAEALSFVAAGRALGISASAVGKTIAKLEQSLG
FT                   VRLFNRTTRRVTLTDEGRHFYERCQRILEDFRDAEATVTASAQRPRGKLRVSLPVIGYR
FT                   FLLPVLPEFRQRYPDVELDLDFNDRMVDVVEGGFDAVIRSGPLSDSSLMSRRLGPFAFV
FT                   LCATPAYLAQAGTPRTPRELEAHDCVRYCFPTTGKLQDWALAADDGTPLTLRTAMTCNN
FT                   MEALRGAVLAGLGIGYMPDFLARDALEYGTLVTVLDDYRIAPGQFSIVWPSSRQLSPKL
FT                   RVFVDFLCERLFR"
FT   gene            143491..145116
FT                   /locus_tag="Bcen2424_0132"
FT   CDS_pept        143491..145116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0132"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_2923 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06886"
FT                   /protein_id="ABK06886.1"
FT                   /translation="MDHPVSAAPAHVAHAARRRAWVLAAVCMAAVALPLSFSGGAVATP
FT                   AIGRDLHGSPVAMNWITNAFMLAFGSFLMASGALADQFGRKRLFAIGVGGFTLMSIALA
FT                   FAPSMLAVDLLRAAQGLAAAAALAGGTAALAQEFDGAARTRAFSLLGTTFGIGLAFGPV
FT                   IAGGLIGHYGWRAIFVTSAVAGVLSLAFGLPRMHESRDPHATGLDWPGTAAFTAALSLF
FT                   TFGVIEAPARGWSSPLVIALLAGAALGACAFVTIETRVARPMLDLSLFRIARFVGVQVL
FT                   PVSTCCCYIVLLVVLPLRFIGIDGFSEIDAGWLMLAISAPMLVVPLVAATLTRWLSAGV
FT                   ISGLGLLVAAAGLVWLGIALRGGAGPAAIAPMLAIGVGAGMPWGLMDGLSVSVVPKERA
FT                   GMATGIFSTTRVAGEGIALAIVGAVLAALAQAGLAHAAGAAATPDATLRAAARLATGDL
FT                   AGAAAALPGVGRAALIASYTHAFGRLLIGLAVVTVLCAVVVFGFLGGRPAADETGDEAD
FT                   GHAQADASAARSRGEPACVETQGR"
FT   sig_peptide     143491..143622
FT                   /locus_tag="Bcen2424_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.822) with cleavage site probability 0.804 at
FT                   residue 44"
FT   gene            complement(145358..145918)
FT                   /locus_tag="Bcen2424_0133"
FT   CDS_pept        complement(145358..145918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0133"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: bcn:Bcen_2922 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06887"
FT                   /protein_id="ABK06887.1"
FT                   /translation="MRPVFGISTVRGGVRPADARRAAWHVACIRITDPHATAHAPTDTM
FT                   NDRGPLTDDAIAFIREQAFLIVATADAAGNADCSYRGRQPRADGSFTPLVDIPDRCTLV
FT                   LPDFAGNHLLNTIGNLLVNPAIALLFVDFVRQTTWLVQGRATLDEDAQGRAHLWPDALR
FT                   YLVIEVKRAEARADAGLPPLVLA"
FT   gene            146118..147644
FT                   /locus_tag="Bcen2424_0134"
FT   CDS_pept        146118..147644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0134"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_2921
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06888"
FT                   /protein_id="ABK06888.1"
FT                   /translation="MNPFDLKQLGLDVEYPYRQQYDNYIGGKWVPPVKGEYFENVSPIN
FT                   GQPFCRIPRSGADDIELALDAAHAVRRQWGKTSVAERANLLLAAADRMEKNLKLLAVAE
FT                   TIDNGKPLRETMAADLPLAIDHFRYFAGCIRAQEGGISEIDDNTVAYHFHEPLGVVGQI
FT                   IPWNFPLLMAAWKLAPALAAGCCVVMKPAEQTPASVLVLMELIGDLFPAGTINIVNGFG
FT                   KEAGEALATSKRIAKIAFTGSTPVGKHILRAAADSLIPSTVELGGKSPNIFFADVLDQD
FT                   DAFLDKALEGLAMFALNQGEVCTCPSRILIQESIYERFIEKAVARVERIKSGHPLDLQT
FT                   MIGAQASQQQLDKILSYIDIGRGEGAQCLTGGERAAPAADLGTGYYVKPTMLLGNNKMR
FT                   VFQEEIFGPVASVMTFKDEQEAIELANDTFYGLGAGVWTRNGTRAYRMGREVEAGRVWT
FT                   NCYHLYPAHAAFGGYKQSGIGRETHKMALSNYQQTKCLLVSYQAEALGFF"
FT   gene            147803..148375
FT                   /locus_tag="Bcen2424_0135"
FT   CDS_pept        147803..148375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06889"
FT                   /protein_id="ABK06889.1"
FT                   /translation="MRATTTTSMAELPRSFPRHPVFHPGELDAQHRFGVADEAERMSDA
FT                   VTTRLSLGVRQFVESQPFMFVGAACGGGASMTCDIVQSRRDANGDLLPVVRVIDTKTLR
FT                   FALPAAHDGDGGRIDAAACDGSGVGLLFVDFVRGLRYRINGRATLRTDLPEADAAPWAV
FT                   GSAIVELTIVQAYGNCGTRVVRLKQAR"
FT   gene            148553..149608
FT                   /locus_tag="Bcen2424_0136"
FT   CDS_pept        148553..149608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0136"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_2919 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06890"
FT                   /protein_id="ABK06890.1"
FT                   /translation="MDTHGSAQVREDTMNQHVACTAEPTAEDTRRSAQGDDAFAGQAVV
FT                   SVAHDADEQARNLIGWRQTYDQLAAGRFVGTLTELPLDTMKLFRESTSHLLRQACEVRG
FT                   DAYWFGIPLVCDGSARVDACRIGPGALAFRPGNVEFELVTPAQFSIYGVVVRGDVLRRY
FT                   AEEVERRALDERLFTQRVMQVGDARLARLCALLGRRLDGAVAMAGPLPDAQRDDLQAEV
FT                   LAALFDACAQPADDGSGAAPSTRRWIVDQARDYVLAHRTRPVGVPELCEQLHVSRRTLQ
FT                   YCFQDVLGMAPATYLRTLRLNGARRDLCGRAAGSVQDVAEAWGFWHLSQFATDYRRLFG
FT                   KRPSETLRDRA"
FT   gene            complement(149835..150926)
FT                   /locus_tag="Bcen2424_0137"
FT   CDS_pept        complement(149835..150926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06891"
FT                   /protein_id="ABK06891.1"
FT                   /translation="MTVARHIAPPVAALSHDDALAYPGTLLAPDGTLVAPYDLEHGERA
FT                   EGHAAAAPALGMLHAAHRPFRLDYSEARHVHVINGMGVTLGDSVIGLTALAALRAAHAD
FT                   VRFTLYRPARAPRYVDALYALATDVVAPSRALPCPADALPADAHCIDVGNHLYWPAFAR
FT                   LPMIDFFLDALGVDPAAVPAAAKRNRWLARLPLPALPAEWQRPYVLFCPNASTAVRSVP
FT                   PALCVAFVERLAQRYGLPVVGFGPLAHPAYVDVSRDATDTARFIAWIKGASVLFAPDTA
FT                   ALHLADGFDVPTLACFTTIGPALRVRDYPHCVPVALDVPAELHGLHRSERPDDLAAVEA
FT                   AYRAIDWDALAWPAARDVAAPAI"
FT   gene            complement(150923..152626)
FT                   /locus_tag="Bcen2424_0138"
FT   CDS_pept        complement(150923..152626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0138"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: bcn:Bcen_2917 thiamine pyrophosphate enzyme-like
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06892"
FT                   /protein_id="ABK06892.1"
FT                   /translation="MSHSKDLEPHATTGARLLVDALLANHVERVFCVPGESFLAVLDAL
FT                   ADDTARIQTVVCRHEAAAANMAEAVGKLTGRPGIAFVTRGPGATHASIGVHTAFQDSTP
FT                   MILFVGQCAREHLDREAFQEIDYRRMFGQMAKWVAQIDDPRRIPEYLSHAFHVATSGRP
FT                   GPVVLALPEDVLSDACAPQPVVPAAKRIAAAPSPAQIDELRERLARAERPFAIVGGSGW
FT                   TPDACANLRTFVERWQLPVACAFRFQDTIDNAHPNYAGDVGLGINPALAKRIRDADLLL
FT                   VIGPRLGEATTGGYTLLDIPKTRQTLIHVHQGADELGRVYAADLPIVSGMPEIAAPLAA
FT                   LEPPERPAWAGAAADSHRAYREWHAPLPMPGDVQLGDVMVQLRERLPHDAILTNGAGNY
FT                   AIWLHRHFAYRHFRSQLAPTSGAMGYGLPAALAAKSLYPQRAVVALAGDGCFMMAGNEL
FT                   ATAMQYGLNIVAIVVNNGHFGTIRMHQERNYPGRVHGTGLTNPDFAAYARAFGAHGETV
FT                   ERTADFAPALERALTCGLPAVIEIRIPQDASTPAATLEQIREQGRRARGA"
FT   gene            152905..153366
FT                   /locus_tag="Bcen2424_0139"
FT   CDS_pept        152905..153366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06893"
FT                   /protein_id="ABK06893.1"
FT                   /translation="MTTETIDQKTLTELVEAGAVRAARVVGCGNGWALSARCGAHERFL
FT                   SAKRGDVRVFRRFETLVGFLRDIGINRFDVDASAFDPDAAGRATRPDRAAALKAAHEAA
FT                   AHDRWFREQVQQALDDPRASIPDAEVSANFASRRAALRERLAGKRGDAS"
FT   gene            153363..153647
FT                   /locus_tag="Bcen2424_0140"
FT   CDS_pept        153363..153647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0140"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: bcn:Bcen_2915
FT                   addiction module toxin, RelE/StbE"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06894"
FT                   /protein_id="ABK06894.1"
FT                   /translation="MTLALHWNPKAYEDRAAIMEYLAEDDPLAALELDELLEERAAALP
FT                   AHAELYRQGRVAGTRELVVAPNYVLVYRLRPAEDIVEILRVLHARRQWP"
FT   gene            153831..154067
FT                   /locus_tag="Bcen2424_0141"
FT   CDS_pept        153831..154067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0141"
FT                   /product="SpoVT/AbrB-like protein"
FT                   /note="KEGG: bcn:Bcen_2914 SpoVT/AbrB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06895"
FT                   /protein_id="ABK06895.1"
FT                   /translation="MRTTRVFWNGSAQVVQIPADLAYERSDIELEIKRVGDEIRIRPVR
FT                   RPLTHVLEKFAQFGPNFMAEGHGDQEQAERTDG"
FT   gene            complement(154127..155515)
FT                   /locus_tag="Bcen2424_0142"
FT   CDS_pept        complement(154127..155515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0142"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: bcn:Bcen_2913 L-serine dehydratase 1; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06896"
FT                   /protein_id="ABK06896.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAALMFVQGLERDGLLDATAH
FT                   VKVELYGSLGATGKGHGTDRGVMLGLLGDAPDTVDPDTIDARLEDIRKTKQLALLGTHP
FT                   VPFVLKENIAFYRQALPEHPNGMKLRASDANGAVLVERTYLSVGGGFVVTAGAPNTKVL
FT                   SAAEQMTHPFRTGAELLALTASTGKSIAQLMWENERAWHTEEETRDGLLKIWAVMQSCV
FT                   SRGCGIGNPEAEGNLPGPFQVKRRAPQLYRTLTGSPERALQDPLSMIDWINLYAIAVNE
FT                   ENAAGGRVVTAPTNGAAGIIPAVLHYYTRFTPGANEQGVIDFLLTAAAIGILYKLNASI
FT                   SGAEVGCQGEVGVACSMAAGALAAVLGGTPQQVENAAEIGMEHNLGLTCDPVGGMVQIP
FT                   CIERNAMASVKAVNAARMALRGDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVN
FT                   IVEC"
FT   gene            complement(155546..156688)
FT                   /locus_tag="Bcen2424_0143"
FT   CDS_pept        complement(155546..156688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06897"
FT                   /protein_id="ABK06897.1"
FT                   /translation="MVRPMFPGHGATARRPRPRAGRYVPMLVAALSLAAAGLGVSGSAR
FT                   AAMNFCAAPALQASETTQAEPGVQALIRSVDARIGEQPKAMARVHTEGTLPHEGIYDQS
FT                   AAALKDMDLMRDAALAWRVTNAPRYLQLVDRFLSAWVSTYQPSFNPIDETRFESLIVAY
FT                   DMTASALPVKTRNATAAFIAKLGAGYVAQVDAQKRPLTGTWRNNWQSHRIKLIALSAFT
FT                   LGDRKMMNAAQRLFVEHLADNIGPDGKTWDFEERDALHYAVYDLQPLVTAALAARRFNR
FT                   NWLRERGANGATLAAALDWLVPYALGEKTHEEFVNSPVPFDAKRREAGLPGYTGQWDPK
FT                   NATELFHLAARLDGRYARVAQQLSLTPPAWLAACLPLQAR"
FT   sig_peptide     complement(156548..156688)
FT                   /locus_tag="Bcen2424_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.976 at
FT                   residue 47"
FT   gene            complement(156843..159770)
FT                   /locus_tag="Bcen2424_0144"
FT   CDS_pept        complement(156843..159770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0144"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="KEGG: bcn:Bcen_2911 glycine dehydrogenase; TIGRFAM:
FT                   glycine dehydrogenase; PFAM: glycine cleavage system
FT                   P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06898"
FT                   /db_xref="GOA:A0K321"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K321"
FT                   /protein_id="ABK06898.1"
FT                   /translation="MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTL
FT                   GFASRAALIDAVIPASIRRAETLPLGPFAQPKSEAEALAALRALADKNQVFRSYIGQGY
FT                   HDTHTPAVILRNVLENPAWYTAYTPYQPEISQGRLEALLNFQQMVADLTGLAISNASLL
FT                   DEATAAAEAMTLLQRTGKPKSNVFYVADDVLPQTLEVIRTRALPIGIEVKTGPAADAAQ
FT                   ANAFGVLLQYPGVNGDVRDYRALTDAIHAAGGHVVVAADLLALTVLTPPGEWGADVAIG
FT                   NTQRFGVPMGFGGPHAAYLAVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRR
FT                   EKATSNVCTAQALLAIMASMYAVYHGPHGLKTIALRVNRIAALLAAGVKQLGFATVNDT
FT                   FFDTLTIDTGARTAQVHEFAKAKRINLRRVSDTQVGVSVDETTTRDDLADLLDVFAQAA
FT                   GGTAPAVDALDAGLAGVAALPAGLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLAL
FT                   DRSMIPLGSCTMKLNATSEMLPVTWPEFGGIHPFAPAEQTVGYREMIDQLEEMLVAATG
FT                   YAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPASAHGTNPASAHMAGMKVV
FT                   VVACDAQGNVDIADLKAKAEQHSANLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVY
FT                   VDGANMNAMVGLTAPGQFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVGAHLAKFLPNQR
FT                   STGYARAEDGIGAVSAAPYGSASILPISWMYIAMMGAKNLTAATETAILNANYIAKRLA
FT                   PHYPVLYSGPGGLVAHECILDLRPIKETSGISVDDVAKRLMDYGFHAPTMSFPVPGTLM
FT                   VEPTESESQEELDRFIAAMIAIREEIRAVEEGRADREDNPLRHAPHTAAVVTANEWPHA
FT                   YSREQAAYPVASLGTNKYWPPVGRADNAYGDRNLFCSCVPMSDYA"
FT   gene            complement(159832..160212)
FT                   /locus_tag="Bcen2424_0145"
FT   CDS_pept        complement(159832..160212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0145"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: bcn:Bcen_2910 glycine
FT                   cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06899"
FT                   /db_xref="GOA:A0K322"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K322"
FT                   /protein_id="ABK06899.1"
FT                   /translation="MSNVPADLKYTDEHEWIRTEADGTLTVGITDHAQSTLGDIVFLEL
FT                   PEVGKSVNAGDAVGVVESVKAASDIYSPVSGEVVAVNEAATDAPEEVNGDAYGVWLFKI
FT                   KLAAGASTDKLIDADAYSKLID"
FT   gene            complement(160339..161544)
FT                   /locus_tag="Bcen2424_0146"
FT   CDS_pept        complement(160339..161544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0146"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase); KEGG:
FT                   bcn:Bcen_2909 glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06900"
FT                   /protein_id="ABK06900.1"
FT                   /translation="MYRIARGYQPRRSAHGRSDPRASALPEASMTALNHTPLNAAHRAL
FT                   NARMVDFGGWDMPVNYGSQIEEHAAVRTDAGMFDVSHMCVVDFTGSRVRAFFEHAIANH
FT                   VGKLKTPGKALYSCLLNPQGGVIDDLIVYYFTEEFFRVVVNAGTAEKDIAWFNQLNEQG
FT                   GYGLTIAPRRDFAIVAVQGPNAREKVWATVPSARAATSELRPFNAAQVAGTPFGDLTIA
FT                   RTGYTGEDGFEVIVPAVHVEVLWNALQQHGVRPCGLGARDTLRLEAGMNLYGQDMDDTV
FT                   SPLDAGLAWTVDLTAPRDFVGRAALEANGTRAAFVGLILQKENGKAGGVLRAHQKVVTP
FT                   HGEGEITSGTFSPSMQESIAFARVPAAVQVGDIVQVQIRDKNLPARVVKLPFVRNGKVL
FT                   AA"
FT   gene            complement(161928..162293)
FT                   /locus_tag="Bcen2424_0147"
FT   CDS_pept        complement(161928..162293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06901"
FT                   /protein_id="ABK06901.1"
FT                   /translation="MQRLIRAAACCVLVSSLAACIVQPQRPARQAPPPPQPNPQVVAND
FT                   RMQEVQGRIDNLHRRIDARVNGGYYPPPYGAQLHHRLDVIRQEANDMSAQHNGGLSGDE
FT                   QRVLNQELDTAARAIGE"
FT   sig_peptide     complement(162234..162293)
FT                   /locus_tag="Bcen2424_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.604 at
FT                   residue 20"
FT   gene            complement(162515..163567)
FT                   /locus_tag="Bcen2424_0148"
FT   CDS_pept        complement(162515..163567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0148"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: bcn:Bcen_2907 oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06902"
FT                   /protein_id="ABK06902.1"
FT                   /translation="MSSLLRIGLMGFGFAGATFHAPVIATSGRTEVAAIATGQPDRAQA
FT                   AYPGARIVPDLDTLLGLDDIECVVIATPNDTHFTLARQVLEAGRHVVVDKPVTLTADEA
FT                   LALARLANARSRLFAPFHNRRWDGDFLTVRRIVESGELGRLTYFASHFDRFRPTPRTRW
FT                   REEPARGGGLLLDLGPHLIDQALALFGTPETVSATVKTRRDNGTAPDFVHLLLGYPDKD
FT                   VALHASALSAIEPARFTLHGTRGSYQKFGLDTQEDQLKAGLTADDVEFGGGNPPGLLRV
FT                   LDGEVELERPVPTLDGQYAEFYRALAASIRDGAPFPVTAQDAVDVMTIIELAAQSEHDG
FT                   RRVPFVRRTV"
FT   sig_peptide     complement(163490..163567)
FT                   /locus_tag="Bcen2424_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.889 at
FT                   residue 26"
FT   gene            complement(163959..164666)
FT                   /locus_tag="Bcen2424_0149"
FT   CDS_pept        complement(163959..164666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06903"
FT                   /protein_id="ABK06903.1"
FT                   /translation="MGYPFATAALGPLLFAQGRYVRRVTPRLPEAAGPRDGVAGDGPPL
FT                   RVLVVGDSAAAGVGVATQHDALAGQLANALAATHRVHWKLLARTGLTTRELVDWLAAEP
FT                   AEPFDVAVTSLGVNDVTGGVPPARWLAQQAELVRLLATRFQVGHAILSAVPPMERFPAL
FT                   PQPLAWYLGRRAKRLNAALAGWAGGQPHCTFLRVDLPLERHLMAADGFHPGTAACAVWA
FT                   AQVAAAVRQRPGG"
FT   gene            164978..167065
FT                   /locus_tag="Bcen2424_0150"
FT   CDS_pept        164978..167065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0150"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: bcn:Bcen_2905
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06904"
FT                   /protein_id="ABK06904.1"
FT                   /translation="MSAGLNPAQNEAVRYLDGPCLVLAGAGSGKTRVITQKIAHLIEAK
FT                   GFEPRHIAAVTFTNKAAAEMRERVSKLLEGKTLTTPGKEGRKVPVNQLTVCTFHSLGVQ
FT                   ILRQEAEHVGLKPQFSIMDSDDCFGMIQEQLGTTDKGLIRKIQSIISLWKNGLIMPDEA
FT                   MAIAANEDEHQAALVYRNYVATLHAYQAVDFDDLIRLPAELFAKNEQVRDRWQNKLRYL
FT                   LIDEYQDTNACQYELLKQLAGPRAAFTAVGDDDQAIYGWRGATLENLAQLGKDFPKLHV
FT                   IKLEQNYRSTVRILTAANNVIANNPKLFEKKLWSEHGMGDSITVTACNDEEHEAESVVF
FT                   RLSAHKFERRAQFRDYAILYRGNFQARIFEQVLRRERIPYVLSGGQSFFDKAEIKDLCA
FT                   YLRLIANADDDPAFIRAVTTPRRGIGNTTLEALGSFAGQAKVSLFEAVYMGGIEARLSA
FT                   RQVEPLRMFCDFIQRLTERADKEPATVVLDDMMEAIHYEAYLYDAFDERQAQSKWQNVL
FT                   EFLEWLKRKGTKPERDAVDGEAEGFHNADGLADTGKNLLGLIQTVALMSMLEGKDEDPD
FT                   AVRLSTVHASKGLEYPHVFLVGVEEGIMPHRGGSEDDGPIDNERIEEERRLMYVAITRA
FT                   QRSLHLNWCKKRKRARETVVCEPSRFIPEMGLDEAPPPTPEEAPMSPKDRLASLKALLQ
FT                   K"
FT   gene            complement(167175..168062)
FT                   /locus_tag="Bcen2424_0151"
FT   CDS_pept        complement(167175..168062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0151"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: bcn:Bcen_2904
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06905"
FT                   /protein_id="ABK06905.1"
FT                   /translation="MSEAPHESPVKTPGQLIAVIIASFAIPIILIVLFANYANHAFRSG
FT                   AGTDALSDEQVAARIAPIAKVEVKDANAPRTYKTGEEVYKAVCVTCHGTGAAGAPKFGN
FT                   KDDWAPRISQGFDTLLKTALAGKGAMPARGGTSPDDVSDYEIARAIVYMANNDGANFPE
FT                   PAAPAANAAQPASGAPASGADASNAQAAAAMAAIAAIPKAGEKPAAAPAGADAATAGKA
FT                   LYASTCQACHAAGVLGAPKFGSKEDWAPRLKDSMDTVYNYALHGKGAMPPKGGSNASDA
FT                   DVKAAVDYMVNSAK"
FT   gene            168314..168389
FT                   /locus_tag="Bcen2424_R0005"
FT                   /note="tRNA-Arg1"
FT   tRNA            168314..168389
FT                   /locus_tag="Bcen2424_R0005"
FT                   /product="tRNA-Arg"
FT   gene            168700..169842
FT                   /locus_tag="Bcen2424_0152"
FT   CDS_pept        168700..169842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0152"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   eci:UTI89_C1093 possible prophage regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06906"
FT                   /protein_id="ABK06906.1"
FT                   /translation="MQVRVELPADPLIEYLSLCTAIAEAVHPASARHYQGIECIVNKMV
FT                   THHVPMAPPTPNEKWPFPVEFQSVLLSDGGRTLDQLLPDRADAGQMSALDLPLEPGQPR
FT                   QMVELAMPYRLDENDRRALQEILHNLPPLQYPISDADQAAFLDAWFRLKERPAWEPVLV
FT                   TTAYVGRRKAAQPAALAEHQQALQEEFKSGRIEALNGHHVPVPVLMGGSFISRQQAIAY
FT                   LERRGFSYVSAELAAGAEAKNGPAAPEAERKRESKRASVGPRVREKQSPANPQAEEGDS
FT                   QGARKIESTGSESSGNGASQSSANNSSVTAGKVARLKRVMELTGLGRSSIYNRMDEGSK
FT                   HYDSTFPRSFKLGSGEAGATGWDEDAVKSWVAAQAAARPK"
FT   gene            complement(170343..171272)
FT                   /locus_tag="Bcen2424_0153"
FT   CDS_pept        complement(170343..171272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_4959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06907"
FT                   /protein_id="ABK06907.1"
FT                   /translation="MHRSMFARFHRYLRSRGVTVAEFGTAHIDGFFVELDRDCAPGTST
FT                   RLRYLKLLDRLSRHLSLLDLRSDNPAASMLPQEHWPEDEPMPVFLSPDEDVGLQATGLI
FT                   GTMAALVLGLLISSAKSSFDTVDSELVHNAANIVLLDRVLARYGTETQEVRRLIKQSYG
FT                   RSIQILASRDHAQIARLRGAEIRKQMEDLQRKLEELSPHTEAQRQLRASAIEIAAEVLA
FT                   MRRLVLLQAVGSVPMPLLITLVLWLSVIFGAFGTFAAPNGTVIAALLLGALSASAAIFL
FT                   ILEMNTPLDGVIGISLAPMREALDMLGQ"
FT   gene            complement(171556..172761)
FT                   /locus_tag="Bcen2424_0154"
FT   CDS_pept        complement(171556..172761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0154"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bxe:Bxe_A3731 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06908"
FT                   /protein_id="ABK06908.1"
FT                   /translation="MVMTNVRIPAALSIIVGGGLTMTLAVAAAGAVCVDAALTHAEAAL
FT                   WSARGVRDVDVITPLADLRHLRHIALPCLAAFTAASILLAFAARRWLDTKVVRPLDCAM
FT                   RSVNAIALGELHETIVIDESTQARRLFAALAQMQRGLVETLSLVTSEAVAIDDCASHLS
FT                   SQNQRLASGTESQAAAIEQTAATMQQISDGVHRSAHVAAQTNRLADNAATLADESRTRV
FT                   RAVTDAMDSIARDSRQISAVVSVVNGLAFRTNILALNAAVEAARAGHQGKGFAVVAAEV
FT                   RSLAQRSAIAAREIEDLIANARSAIEKGARLCEDVGTAMDNVVAAAHEVVELSDDMSRS
FT                   ASEQSLGVQQLNEAIKAIDSVTQQNAAMVQHFVETTEDLNGRARALAGAVGAWKLGRDA
FT                   AS"
FT   sig_peptide     complement(172678..172761)
FT                   /locus_tag="Bcen2424_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.493 at
FT                   residue 28"
FT   gene            complement(172777..173889)
FT                   /locus_tag="Bcen2424_0155"
FT   CDS_pept        complement(172777..173889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0155"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B2492 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06909"
FT                   /protein_id="ABK06909.1"
FT                   /translation="MKPSLASVAQFVAPLASLAAALVTPAAYAQSSVTLYGIIDTAVQV
FT                   ANTGGQTVVREASSSVAPNRWGLFGKEDLGAGYSAIFKLENGFNLNNGAMASANTLFNR
FT                   EAWVGIRGPFGQIQAGNNYTPLFRTYVTYSIGELNALAWGNATNNYVFVPVARTANSIL
FT                   YTSNDLAGFTLRALYARGANGTSGVPASLGDTLSAGVNFKAGQFSADVDYLQQRFANTA
FT                   TPTTTTPVGTGRYYLIGASYDFGVVKTAALYQLHRNATGVSTSISSAYATPNHDFYEVN
FT                   ALVRHVLDGSLLVSFGQYFLKSGGDGHATSWALRYDYLLSKRTGFYVGVAGVRNHGTTA
FT                   FTVTDAAGPGIAVAAGKNITTEILGIVHTF"
FT   sig_peptide     complement(173800..173889)
FT                   /locus_tag="Bcen2424_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 30"
FT   gene            complement(174096..174821)
FT                   /locus_tag="Bcen2424_0156"
FT   CDS_pept        complement(174096..174821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0156"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mlo:mlr4761 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06910"
FT                   /protein_id="ABK06910.1"
FT                   /translation="MSRIVANQAAPNGSGGASVATLATNLYDRIRADLLDGKLEPGRKL
FT                   QIEFLCDHYQAGQTPVREALNRLTSDGLVERRDQRGFAVAGISASDLREITKTRCWLEE
FT                   VALREAFASRSTEWEEDVVLAYHRLSKVPRSLSETEYKENPEWERRHREFHRAVIGGCQ
FT                   SRWLINFCEQLADQLYRYRQLSVRRVFPKRHEGAEHKEILDAVVAGDAARAIQLLTTHY
FT                   QQTADIILGDVNLFPPGAR"
FT   gene            174992..175417
FT                   /locus_tag="Bcen2424_0157"
FT   CDS_pept        174992..175417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0157"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   bmb:BruAb1_1757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06911"
FT                   /protein_id="ABK06911.1"
FT                   /translation="METLTLDQAKRAVDAALQAARRESFRPMAMVVLDEGGQVKFVARE
FT                   DGATPLRVDIAHGKAAAAFGMGVSSRTLQERANANPVFFNAIAPAAGGKFIPQTGAVVI
FT                   VSASGQVLGAIGASGGTGEEDEAICIEGLRAAGLAHR"
FT   gene            175431..176471
FT                   /locus_tag="Bcen2424_0158"
FT   CDS_pept        175431..176471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0158"
FT                   /product="Aminocarboxymuconate-semialdehyde decarboxylase"
FT                   /EC_number="4.1.1.45"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mxa:MXAN_0918
FT                   2-amino-3-carboxylmuconate-6-semialdehyde decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06912"
FT                   /protein_id="ABK06912.1"
FT                   /translation="MQPTFAAATGCACHGVDVHTHIVPAEFPRYLGVHAPRDWPSTRPA
FT                   HACHRHVVIDEKIYRTISDLCWDTHKRVVDMDAQRVQIHAISPMPELLSYWMSPGDALP
FT                   LLQYLNDTIGAMVDTSAGRMIGLGAVPLQDVDLAIRELEQLMATPGFAGVEIGSNINGA
FT                   PIGAAQFDAFFEAAEALGAAVFVHALRPVGKERLVGPAQLVQALAYPSDVGLAAASAIT
FT                   SNLIVRHPKLRIAFSHGGGTLASLLPRLEQASQVFEPLRGALQASPREQARRLWYDALV
FT                   FDPATLRHLVDTFGDTRVMLGTDYPFGFRERDPVASVEALDLDVAAEERLIYRNAREFL
FT                   GIRNGA"
FT   gene            176473..177384
FT                   /locus_tag="Bcen2424_0159"
FT   CDS_pept        176473..177384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0159"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mes:Meso_0821
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06913"
FT                   /protein_id="ABK06913.1"
FT                   /translation="MTQCLVTGLRGIEIGVPDLELAARFYADTWHLTELTRRPEKVYFR
FT                   GTGAAHHILTLTQSDRADVRAIEFSVAEVEHLDTIAAQVAQNGGTVLSGPEPTTMPGAG
FT                   TLLEVLDPQGRTLRFIAGGRSHADTEAVKDHPIKITHVVLNSENVALAQAFFENALGFR
FT                   LSDRTRIMAFMRCCTDHHSIALADAQENSLNHIAFVMPDLDSVMRGGGRMNDAGYPIEW
FT                   GVGRHGPGNNVFAYFLGPFEFVIEYTAEVQQVDETYRTGGPDDWKWPPGRIDQWGVGRN
FT                   PSDRLKAAQRTILFRAPQPESR"
FT   gene            177438..178304
FT                   /locus_tag="Bcen2424_0160"
FT   CDS_pept        177438..178304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0160"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bpa:BPP3154 putative fumarylacetoacetate-family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06914"
FT                   /protein_id="ABK06914.1"
FT                   /translation="MKLVTFRSGDTTRLGVLDGDDVVDLNKADASVPADLRAALKAGVD
FT                   LNAAARRAIASGEHRAPYASLKLAPVVPEPGKVVCLGHNFYDHAKEGGNLKPVYPLIFF
FT                   RGTSSLIAHEDPVIRPRVSEKLDYEAELLVVIGKRARHVKRENALDYVFGYACFNDVSV
FT                   RDYQKRTSQWTIGKNFDGTGASGPWLVTADDLPPGAEGLSLRLILNGQVMQQASTSDMI
FT                   WGVAETIELLTECLTLEPGDVVAMGTPAGVGWAREPSVWLKAGDRVEVDIERIGRLQNT
FT                   VQDEAGA"
FT   gene            178301..179893
FT                   /locus_tag="Bcen2424_0161"
FT   CDS_pept        178301..179893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0161"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG:
FT                   bxe:Bxe_C0990 putative flavoprotein monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06915"
FT                   /protein_id="ABK06915.1"
FT                   /translation="MTMERNEHFDVVVVGFGPSGAVAAGLLGQRGRKVLCVDRAREVYD
FT                   KPRAIAVDHEIMRVFQGLGVVERIAQHVAVFPPSEYYGVDGQLIKRIDTVPKPWPLGYM
FT                   PTMVFTQPPVEAALREHASAYESVEVSLGTALVGFEETADGVTVQLKDDTEGAVTRTVT
FT                   CDYLIGCDGASSTVRTQLSIEYEDLVFDEPWLVVDLRVNERGIEKLPKVAIQYCEPSRP
FT                   CTYIVGPGGHRRWEIMLMPGEDPREMQTEEQVWKLLSRWLTREDAELWRAASYRFHALV
FT                   AKEWRRGRVFIAGDAAHQQPPFIGQGMCQGIRDVVNLVWKLDAVMDGSAQPELLDTYGA
FT                   ERSLHVRQLTTRIKEIGKLICERDVTAARERDARLLREAGGQVKTIARQDIVPKLDAGL
FT                   LSPIPHASNGSLFPQPRVRHADDSALLDAVAGGNWRVVTLGGAMVSEQVASAAASIGAQ
FT                   VIELAPDGNAHRAAVLPDTRSIVEVDGVLAAWFERNQCGAAIVRPDHYVYGVASSAQSL
FT                   AEALAQLDTALHG"
FT   gene            180076..181479
FT                   /locus_tag="Bcen2424_0162"
FT   CDS_pept        180076..181479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0162"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_C7161
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06916"
FT                   /protein_id="ABK06916.1"
FT                   /translation="MTTPLNVREELAHARIGRFHLRFAVLVAFIMFFDGYDLFNAAYVI
FT                   PLVRHEWQPSPTMIGIMLSSGIVGLSIGSVLQGLIADRIGRRKVMLGALWTLTLSSGLL
FT                   ATVVHSAESFALARLVMGTALGMVTPLALTCINEWAPRRNANTFATWVFQFGFSAGGIF
FT                   AGIAGLTLTPHLGWQSLYFVGVLSALVAAAAMKWLPESAQYLALRGRTDDVLALLKAVR
FT                   PEREAVYRDAHIQLMRATSRPGSISDLLSAEYRRNTLVHWIAGALSLFCIHGLTGWLPT
FT                   MVVNKGGGVSSAFGYGTVVMIASVFGGISMGWVADRMHSRIRAMVVGYIVAALFMAGLA
FT                   LTLGKTGSMVLVACVGFFIFGAQAIMNNYQAMCYRTEIRGTGMGVAVGLNRIGGILGPV
FT                   IVGVVASLNPDPLWTFAVFTGALILAAGVIALGKTEIAALPASWPNAATQQDDEALPAG
FT                   ARHDHGVAG"
FT   gene            181560..182471
FT                   /locus_tag="Bcen2424_0163"
FT   CDS_pept        181560..182471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0163"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: ppu:PP3196 nodulation protein D1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06917"
FT                   /protein_id="ABK06917.1"
FT                   /translation="MRFNRLDLNLLVTLDALLDDRRITRAAERLNLSQSAISGMLAKLR
FT                   EYFDDELLVPVGRNLELTPLARELVQPVRDLLLQVQTIVAIDPAFEPANARRHFKIATS
FT                   DYVINVLMHRLIPVIEPLAPYLTLELMPQEDAPERLRRGEYDFLIIPEPFKADDHPAIA
FT                   LFDDSYVGVVWNGNRAVGASIDVARYEQLDHVATLLGWPRLPSYDSRYVEAQGIRRRVR
FT                   VTTSDFTSMAPVLIGTQMIATMHRRLATELTRRMPLRLVELEFPIPQMREFLQWHEYRE
FT                   KDPCHRWLREQIISVAAGLAAQ"
FT   gene            complement(182532..183452)
FT                   /locus_tag="Bcen2424_0164"
FT   CDS_pept        complement(182532..183452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll6430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06918"
FT                   /protein_id="ABK06918.1"
FT                   /translation="MNTKLMAKLAGACVIAAAVAAPAHAFEGDVAPYPAGANGSAIASM
FT                   PPIPGLFVMQQFNYSFANGLYGNDGQKLPIPFHTSVFSSTTRLLAAYPATVLGANLYSQ
FT                   LVIPVVSLHTDVQGYKSTQNGLSNITVTPVLLRWSVNNLAIATGVDLALPTGSYSPTKS
FT                   SSVAVGYLSVQPVLSFRYRVPDGIDLGISNRLLLNQKNSDTNYQSGNGYTAEFIAGWHF
FT                   GKFEFGVLGNYVNQFSDDKVNGVAVNGNGNRMRSLALGPSIDYQAGPVNINLNYQHGLY
FT                   AVNTSKSHNVWLNVAIPLWVLGGDK"
FT   sig_peptide     complement(183375..183452)
FT                   /locus_tag="Bcen2424_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(183649..184551)
FT                   /locus_tag="Bcen2424_0165"
FT   CDS_pept        complement(183649..184551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0165"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rpb:RPB_3106 esterase/lipase/thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06919"
FT                   /protein_id="ABK06919.1"
FT                   /translation="MNHTDPHTVARLDALIRATGAVIDPPLVKGWYAPYRENQPTAGVE
FT                   VRRDVVYGEDERHRLDVYLPTEASATPRPLLVFVHGGGFIRGDKRERANVGLRFARAGF
FT                   VTVVPGYRLGPAHQWPAGAQDVASAWAWAFANAHALGADPGRIYVAGESAGAAHVAAAT
FT                   LIGQLRPPRVPAPRAAVLISGVYNVQLEKLARRQFGTPSPDPRNDAYFGSDFARYPSMS
FT                   TVERVDVAPFPLLITWAELDPPQMQVQAGELFARLTTRHGFDPDLAVIKGHNHLSQLEA
FT                   INTVDDVLPNVLLDYMKRT"
FT   gene            complement(184577..185833)
FT                   /locus_tag="Bcen2424_0166"
FT   CDS_pept        complement(184577..185833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0166"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   rha:RHA1_ro04297 possible dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06920"
FT                   /protein_id="ABK06920.1"
FT                   /translation="MAGIVFTNVRVFDGSGSAPFPSQVRVEGNRVAALAAPSAPSLALA
FT                   GDALYDCGGATLMPGLVEAHAHLSWPSSVEQFVPGMALPPEELVLTTARNARILLDHGF
FT                   TSAYSAGSLSKRVEVALREQIDSGGMPGPRLVASSIERTPPVAADEQELNPGEVDPHGV
FT                   GPDAVRAFVRSCAEMGARSVKFLLSGEDALQPGASQQLLYSEAEAKAAGDEAAATGVWL
FT                   AAHAQAAEAVKMALRNGFRVLYHCTYADDEALDMLEAAREQIFVAPAIGIIQATLDAVP
FT                   PPHFDMTHMKQSAAEVRELQQRLVPELRRRGVRVLPGGDYGFPFNPNGRNARDLQLFVE
FT                   LFGYTPAQALHAATALGGALMGMPGELGMIAPGYLADLLIVDGDPTADVAILQDRQRLV
FT                   GIMKDGAFHKAPLAMLRTA"
FT   gene            complement(185870..187057)
FT                   /locus_tag="Bcen2424_0167"
FT   CDS_pept        complement(185870..187057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0167"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:bll6424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06921"
FT                   /protein_id="ABK06921.1"
FT                   /translation="MPARRGSNGALVVAHVAGMIDLVALPVWVNTLIEHFHFDAQSAGA
FT                   LATAYLACAVLCSVCIAPLITRVPGRLSAAAGFALAACGFGVAAHSASFVGMLGAHALA
FT                   GLGIGCGLSVAHGAIGRSPNPHRLFALSHLALALFGVGYFAVVPALIAADGGAALFSAF
FT                   VVLSGVAALALALAWPARTSAGAAAADATSHPAAPTATTGARLERGCWSAIIGIVFMAV
FT                   NQAMVFSFVQRIGLSRGFGDAHVNAVLVAVGLVNLLPPVLAALLQRKLDARNVALAGPL
FT                   AQALLAWVISNTTSFAPYAVAVSLWVFAMIFTHTFLFGFLAKLDASGRAVAYTPAMLMA
FT                   GSALGPLLGGVLIVRFGFGALGVAALVIGALSLLFFSRLRALAVAQTAFDLPPAR"
FT   gene            187257..189908
FT                   /locus_tag="Bcen2424_0168"
FT   CDS_pept        187257..189908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0168"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; KEGG: afm:Afu3g02880
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06922"
FT                   /protein_id="ABK06922.1"
FT                   /translation="MPTHPGDTRVRARSTLTPSAGLAAALAGAALTLAACGGASSSLSG
FT                   DSSGGTNGAPWPASVSAAQYLPDTGDLRPVKVVSVFGSVTGAESLLSGGALTLKYVAGG
FT                   TPPTVVLDYGREVGGLPGFGITAQSGEPTLSATFSESFTHAASGDVSAGLTVSVDPERT
FT                   SLFPVSAAGTLKARAVQGGERYETLSLTTPGELTLNSVTIQSLYTPPTATTLGSFVSSS
FT                   DLLNRIWSAGAYTVELDRLAASALPLAWQVSSDGVTIGTSGAGIVQKSGTWPADYAMAF
FT                   DVRIDRNSAGWTMRDAGNLTGLRFVLHSQSDTQGTPNTLELDGFSTFAGGTVKVGSLPI
FT                   AAGVATGTWHSVTTSLAGNQVSVTLDGTTLGTLDASAAASMLLTSYGSAGFFNVPASQA
FT                   TYRNLAVTASGTALYANSLQGASALADFAADTNALPLLIDGAKRDRTVWSGDIAVAAPT
FT                   LFYTSAQSDAVAGSIRLLGSYRLANGEVSTTHSPQDPLISTAADPYGSSSFYSTQYSMY
FT                   FIAILHDYVQYTGDTSLLQEQWSTAQGELAYLRTLVDGNGLIAVGASDAQDWLPNFTSP
FT                   VTGEVTSTNMLYYQVLNQAADLATQLGDSSAATAYTQRAAELKQAINARLYNASSGYYG
FT                   VSATSLTALAQDANALAIWTGVAPQGSAATILANVEKQLANPYGRLAFASDSGRSAVVS
FT                   PFASDMEVRARFASGDTRGALSLIGTLWGNMVAAGDNYTGTTWEALGTDGLPVSVQTSL
FT                   AHGWSSGPTSALPRYVLGVRPAAPGYRQWLIKPQPGDLQWAVGAVPTPYGAISVKWGRA
FT                   SSGTFTLNLEVPAGTTGSVALPASGTVRVNGTVASSASSSALDPLGAASDGVAYQYLDK
FT                   LAPGSYTIVVGG"
FT   sig_peptide     187257..187391
FT                   /locus_tag="Bcen2424_0168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.723 at
FT                   residue 45"
FT   gene            complement(189884..190468)
FT                   /locus_tag="Bcen2424_0169"
FT   CDS_pept        complement(189884..190468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr4613 ECF-family sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06923"
FT                   /protein_id="ABK06923.1"
FT                   /translation="MQTWTGKRYRPGAWGLRVFAQRQRRAQCCEPPQASIPIRHRSRIA
FT                   KCSRNSARRSCLSNASPVSATIALQVAQAIPGATREPAHLPLPARTNQGQPVRATARAR
FT                   RVRRPVRRSPRPTRGARRARADANDPRLADYQPYWAARADLPCSRAGATADSLRMYDLA
FT                   IGIERDPAARRFLQHRRIALTPTHQPPTTIV"
FT   gene            complement(190575..190850)
FT                   /locus_tag="Bcen2424_0170"
FT   CDS_pept        complement(190575..190850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_3749 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06924"
FT                   /protein_id="ABK06924.1"
FT                   /translation="MIGADPRAALTSLSLFDGGKRHAAVANARAELAGNDAKYRETVLT
FT                   AFQQVEDELALLHHLGEESKNLDDALASASSVAIQALRPARAAASA"
FT   gene            complement(190969..191502)
FT                   /locus_tag="Bcen2424_0171"
FT   CDS_pept        complement(190969..191502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0171"
FT                   /product="NAD-dependent aldehyde dehydrogenases-like
FT                   protein"
FT                   /note="KEGG: reu:Reut_B5828 methylmalonate-semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06925"
FT                   /protein_id="ABK06925.1"
FT                   /translation="MPAEVAGLRARCERWYVDLGVEEGAKLVVDGRGLKVKGHEDGFFT
FT                   GGTLFDNVTPDMRIYKEEIFGPALACVRVRDFTEAVELANAHEFGNGVACYTRDGHVAR
FT                   EFGRLVEVGMVGINVPIPVPMAWHGFGGWTRSLFGDMHAYGEEGVRFYTTRARDCCATP
FT                   MGADICWRARATNR"
FT   gene            191783..192226
FT                   /locus_tag="Bcen2424_0172"
FT   CDS_pept        191783..192226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0172"
FT                   /product="transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: bur:Bcep18194_A3991 transposase and
FT                   inactivated derivatives-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06926"
FT                   /protein_id="ABK06926.1"
FT                   /translation="MPQELIDDELWSLIEPLLPKRAPRNRRYAGRKPTPDRAVLTGIVF
FT                   VLRSGIAWNLLPQEMGCGSGTACWRRLVAWQEAGVWQRIHEALLAELRRRGQLDMARAI
FT                   VDSSSVRAMLAGKKPARTQRTGASSAASTTSSSTRKVSRSRSS"
FT   gene            192223..192594
FT                   /locus_tag="Bcen2424_0173"
FT   CDS_pept        192223..192594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0173"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bxe:Bxe_B2711 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06927"
FT                   /protein_id="ABK06927.1"
FT                   /translation="MTAANCNDITQLDALVAAIPPIRGKRGRPLRKPKIVQGDRGYSSE
FT                   PHRQRLRERGITPLLAKIGSPHGSGLGKTRWFIERSFAWLHAFRRLKIRYERYAHVHEA
FT                   FLSLACCLICWSQLKTASD"
FT   gene            192700..193467
FT                   /locus_tag="Bcen2424_0174"
FT   CDS_pept        192700..193467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0174"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: rba:RB8871
FT                   3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06928"
FT                   /protein_id="ABK06928.1"
FT                   /translation="MAHPNPAALVTGSASGIGRAIAVALARAGFDIGVNYSRSEREAKE
FT                   TARLVNEAGRDALIIRADVSDESQVVSMLRQFEEAFGGRLDLLVNNAGTTIDTPPAQFD
FT                   TVDVADFDRVFNVNVRGCFLVTKHAARLLRQMDRADVINTASIVGLRPGPQPLPYSASK
FT                   AAIVSMTQTLAGALGPKIRVNAVAPGWMEGDWMERALGDNYNRLMERRAKATPLKRCAT
FT                   AEDVGETVVALATTMRFVDGQVIVIDGGYSSIT"
FT   sig_peptide     192700..192768
FT                   /locus_tag="Bcen2424_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.759 at
FT                   residue 23"
FT   gene            193504..195177
FT                   /locus_tag="Bcen2424_0175"
FT   CDS_pept        193504..195177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0175"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bce:BC2304 2,3-dihydroxybenzoate-AMP ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06929"
FT                   /protein_id="ABK06929.1"
FT                   /translation="MTASSHASRDVFDGVTPFPADYAARYRAKGYWQDKPMRQVFGEWC
FT                   QAHAPKIALRDATRSVTFAELDAASTNLALNLLDVGILPGDKLVVQLPNVIEFVYLHFA
FT                   LQKIGAIPVLALPPHRYREISCFVEMAEAVALITPDAQGDFRYTQMTERLRNEAPRLRF
FT                   GIVLGDAPEGFVSLRDLIERPPARDASELDNIAIDPCSPALFLLSGGTTGIPKLIPRTH
FT                   NDYVLNSKLAAAVCDIRDGDVLLDVLPIGHNLPLACPGLQGFLSRGCTVVLHTSTSSDQ
FT                   IFPLIDRYKVTHIHVVPALLIRWLESPVIADFDLGSVRVIQSGGQRLQPETRKRTQQRL
FT                   PQCFVQENFGMAEGVLMFVRADDPLEVRMETVGRPVCEDDEVMLLGEDDQPVQPGEVGE
FT                   LCCRGPYTLRGYYRAPEHNARAFTSDGFYRSGDLMRQHPSGNYIVEGRKKDLINRGAEK
FT                   ISAEEIENLILAHPAVVNVACVAMPDPLMGERNCACLILREGVSLSLDELVAFLKNQEI
FT                   AKFKLPERVEIFTSFPLSNFGKVSKKDLAATVAERVQAAQ"
FT   gene            195174..195920
FT                   /locus_tag="Bcen2424_0176"
FT   CDS_pept        195174..195920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0176"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mpa:MAP2306 putative enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06930"
FT                   /protein_id="ABK06930.1"
FT                   /translation="MKCYVTAIHENGIATLTLADPERRNVLSEVLCEQLIDAVAAAHAD
FT                   QDVRALVIAAQGPAFCAGAHRDDLRAAAEGDARVIGKVYQTFMDVANSPLPTIAAINGP
FT                   AVGAGMNLALACDLRIASSSARFDTRFIGIGLHPGGGHGWMLVRAVGWQNAASLLLLGA
FT                   AVNAAEAMRMGLVSACVADDGLADAVASACRRIRSAPRELLLRTKASLRHAASASHAAA
FT                   FERETAEQKWSMQQPEFLSMLGSAQK"
FT   gene            195917..196720
FT                   /locus_tag="Bcen2424_0177"
FT   CDS_pept        195917..196720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0177"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   fra:Francci3_2455 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06931"
FT                   /protein_id="ABK06931.1"
FT                   /translation="MSAILSPLLYEKRARVATLTINRPDVMNAMDSHAHLALSEALDEA
FT                   QHDPEVRVVVLTGCGDRAFSAGRDLRELARQADLNPEEKAALDQRWARTRRLTDRQDFF
FT                   KPIIARVNGVALGGGFELALACDLIVAADHATFALPEPKRGLIATAGGVHRLPRQLPLK
FT                   IAMGLLLTGDLITAPRAAELGLVNECVPAAELNLAVTRYVDRLLACAPLSVQATKQCAM
FT                   NGLGRTLQEALTAHYPLEALRQSSEDALEGPRAFAEKRTPHWKGC"
FT   gene            complement(196752..197471)
FT                   /locus_tag="Bcen2424_0178"
FT   CDS_pept        complement(196752..197471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0178"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sma:SAV1202
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06932"
FT                   /protein_id="ABK06932.1"
FT                   /translation="MKKRSSQATYAAAGTAADTVLTIRDLALEPHLDEVSANLGLRERN
FT                   KLEKAFLIRQAARELFLAKGYEATTLREVAKRADVGFGTVFSYAVDKPGLLAMVFVEDL
FT                   QHLPPLFDVPGAAPLVDQAVAAFMKLYEFWARTPVLSRAVLPQMEFYRSNPFTDAIAER
FT                   RQELKTNLARWLTACAQQKRIAAKVDPSVAADTIFAIYTSALREWIVSDPLDLSAGAEQ
FT                   LARLLDLPFRAIEKKGR"
FT   gene            197615..198499
FT                   /locus_tag="Bcen2424_0179"
FT   CDS_pept        197615..198499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0179"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mmc:Mmcs_4394
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06933"
FT                   /protein_id="ABK06933.1"
FT                   /translation="MRIIDLHCYPNTQPWIDSQGPYVEALARYWKRDWSAKTEDAVARE
FT                   FRENRIEACLVALDLTTTINTPPCSNDYVAGMRDRHADCMIGAWGAVEPSLGRAAIDEA
FT                   RHCVRDLRMTGFHFHPIMQHFSVDDSRYYPLWEEISGMKVPVMIDVGMTGMGAGLPGGM
FT                   GARTRHAHPSAIDALAADFPNLTIVMAHPGYPWIDETTVVALHKGNVYWEMSGWAPKYL
FT                   PQQIVRDMRGRLKDKMMFGSDYPSIPYPRLLKEWSELGFSDAFLEDFFHGNAERVLGIG
FT                   TQQAKQDSLVREA"
FT   gene            198609..199871
FT                   /locus_tag="Bcen2424_0180"
FT   CDS_pept        198609..199871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0180"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_2062 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06934"
FT                   /protein_id="ABK06934.1"
FT                   /translation="MNQRTGSKQPHNRWWIVIGALLGLTVGNGPIMQFTFGVFLLPVTR
FT                   EFGWARSQASLALAIGLAATALCVPIAGRLMDRYGVRRVSLPAITAFAAATAALAFVPP
FT                   SPLAFALLYALMGAAAAGQSPLPYAKAIAAAFDQSRGLALGIAMAGVGIGTAVVPQLAQ
FT                   YVVAHYGWKQAYLTLGGLTFVLGITAMGWLIHEPHGATARRIDRADIPGLAIGAAVRTP
FT                   QFWKLSLAFFVVAAATNGAIAHLVPLLGGRGIAPAVATSALAGAGLALTLGRLFAGWLL
FT                   DRFFAPYVAIFFFLLPLAGLVLLIAGSGLGMSIAAVVLIGLGLGAEVDLIAFLLSRYFG
FT                   MRSFGEIYGYLFTLFMLGNGLGPWVMGVSFDATGSYTLCLAVMCGALAVAALLVSRLGA
FT                   YGYPPERDTGTSSACRTAAAH"
FT   gene            199905..201062
FT                   /locus_tag="Bcen2424_0181"
FT   CDS_pept        199905..201062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0181"
FT                   /product="outer membrane protein (porin)"
FT                   /note="KEGG: bur:Bcep18194_B0054 outer membrane protein
FT                   (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06935"
FT                   /protein_id="ABK06935.1"
FT                   /translation="MKRSLWMALAMSVTGSVASFAALGDAHAQSSVTLYGVLDTGVEYV
FT                   SHANAAGDRLIRMPGTTGELPSRWGLRGNEDLGGGMQATFVLESGFNVRGGDLGQGGRL
FT                   FGRQAYVGIASAYGKLTFGRQYTMTFWAQTDADILGPDIYGLGALDAYVPNARSDNTVS
FT                   YLGTFSGLTLGATWSFGRDSAGTSNSPGQGTCAGSVAGHATECRQWSALVKYDSPWFGL
FT                   AAAYDEQRGGTSAAANFFDGVPPLTLTNPADKDARLQFNGYAKLGPVKLGGGWMGRRVV
FT                   TDSPALPDVRTNLFFVGAAWQVTPSYIVDGEVYRITNAQHDTRATLGTLRSTYLLSKRT
FT                   AVYLQAAYLANSAKARYSVSAGGGGTTPAAGMNQTGVMAGIRQLF"
FT   sig_peptide     199905..199970
FT                   /locus_tag="Bcen2424_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.863 at
FT                   residue 22"
FT   gene            201175..202872
FT                   /locus_tag="Bcen2424_0182"
FT   CDS_pept        201175..202872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0182"
FT                   /product="Carboxylesterase, type B"
FT                   /note="PFAM: Carboxylesterase, type B; KEGG: bja:bll4001
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06936"
FT                   /protein_id="ABK06936.1"
FT                   /translation="MSKIIAKQDTADDPHRRHWIAPLLAAAAAATVAVAMSALLAACGS
FT                   SDRAPATYASASDRVQVTGGAIAAATDSTSTMRVFRGIPYAQPPVGPLRWKPPQPVSAW
FT                   SGVRNSDRFSSACVMGNRPAGQPGSILFQSTEPQSEDCLYLNVWTGAAAGAQEKRPVMV
FT                   LVHGGGLQLGAGSQPNYRGAGLASKGAVVVTMNYRLGALGFLAFPALSAESADHVSGNY
FT                   GLLDVIAVLKWVKHNIAAFGGDAGNVTVYSESAGSQLSSVLLASPPASGLFHRIVIESL
FT                   ALLPAGASNPTLAQAEAAGQAFASGLGATALDQLRAMSATDIMKGTDTVISPVVDGKVF
FT                   PDQLDTLYAQGKVEKVPMLVGWNQNEATPYPPFATSLSTYNAAVTSYGASADAFRSVYP
FT                   VSSDSDVLAMAYSPMRDNMFAWQPWTVARWHAAKGGAATYLYFFTRHPPYYANQSYSGQ
FT                   SSPEAFGAYHSLEQVYFYNNLDVGVPARPYTDTDRHIADVSSSYLINFARTGNPNGSGL
FT                   PQWPAFTGTARQTMEIGDAIAPTSVPFTNAFAFWDSYYTQKLDRALPF"
FT   sig_peptide     201175..201282
FT                   /locus_tag="Bcen2424_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.316 at
FT                   residue 36"
FT   gene            complement(203608..204030)
FT                   /locus_tag="Bcen2424_0183"
FT   CDS_pept        complement(203608..204030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0183"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type; KEGG:
FT                   psb:Psyr_1078 protein of unknown function DUF24"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06937"
FT                   /protein_id="ABK06937.1"
FT                   /translation="MDRDELLQYSQTVCDGLRDDDDGLRREVLAHAGSRWSLGVVHTLG
FT                   VYGRLRHAEIGRRMHGVTQRMLTRTLRQLERDGLVLRHDFDEVPPRVEYELSDTGMDLL
FT                   VRMVPLWTWIVENADRFREARRIFDSQNRDASDANS"
FT   gene            204123..205076
FT                   /locus_tag="Bcen2424_0184"
FT   CDS_pept        204123..205076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0184"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: pfo:Pfl_2406
FT                   NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06938"
FT                   /protein_id="ABK06938.1"
FT                   /translation="MNQTDPNATSQNILVLGAGELGLPVLRNLARRAKDVAGAKISVLL
FT                   RASAVESNAPAKQHDIAEIRDLGIEIVVGDLVKSSIDELAGVFAGYDTVIGCAGYAAGI
FT                   DTPMKLARAALQARIPRYFPWQFGVDFDVIGRGSPQDIFDAQLDVRELLRSQHETEWVI
FT                   ISTGMFMSYLFKPDFGVVDLQNDAVHALGSLDTAVTLTTPDDIGALTAEIVFAQPRIRN
FT                   EIVYLAGDTVTYGVVADKLQAALGRPFSRSEWSVQYLLDELARDPNNMMRKYRAAFAQG
FT                   RGVAWDKSGAFNQRHAIPVTDVASWIDANLASGRSE"
FT   gene            206895..208103
FT                   /locus_tag="Bcen2424_0185"
FT   CDS_pept        206895..208103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_1641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06939"
FT                   /protein_id="ABK06939.1"
FT                   /translation="MSFEEDDFSTMYEYIDWTTNTEGAVIDGTEKTCLRTEFGLLRTIL
FT                   ISMEAMVREIEFDKHSVGFDIKTNPRGKVSVTPKAKTGTLKYYRCLSTFLRNYAHAERR
FT                   VYSPHVQVVVEALDAVGLEPYGFRFGEPGAREVSCGKTHGEIFNEVVAKVGEIVASTAF
FT                   KERVRVRKRNAARNEAKGLAIEQKVFENKSRQLVLMLHFGFQKAYRQQVTFEEIQAYRT
FT                   KFFNNCRTNKLLRGIVDYIWKLEEGDESGLHLHVLIFYTADSCRDVYIAQQLGEYWKET
FT                   ATDGKGQYWNSNAHKAFHEKYGHGVGTGEINWDDDAKREALRENIRYMTKADQFLKMKY
FT                   GERSRLFGTSQVEEKKKPGRPRVVKPKGKGDPAGSAQADLRNSDSLDDTGVDAANPGAG
FT                   QND"
FT   gene            208321..209628
FT                   /locus_tag="Bcen2424_0186"
FT   CDS_pept        208321..209628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06940"
FT                   /protein_id="ABK06940.1"
FT                   /translation="MNKINLKPVADDLPDTSDGTAVAMPRVMWWTALVAALFASAISLG
FT                   INVYAGMLRAGTVTEQICTVATSLVAALCMYLAPMLWRFAPTRARVVLAVLWLLAVCGV
FT                   LRGQVDVLAFANVHAADERAQTVAVVAVPSVATGPAGRNLMAIEQDIAKVSIEMAHVDA
FT                   RRCMGECRSLRLRKAELSAQLAVLNAEADEAKRRATEQDWRRDQVSRAQELSESRRAEP
FT                   GTALVAPWLGTTEARLDLLMNFVLVVVLEGTACYCWYVVGLGAVATRRAAVVDDRSTTM
FT                   LESPPVMPMPEPPQGDRDGQDTTQAAGVEPQPVASSRAVVASERNATVSRLEVVAPIGK
FT                   ARLADRVDQSATHAATLTDEEAVVNDASPGVATPDDDRLVAEIREAVVAGRLKRNLMSI
FT                   RAFVGCAQSRAVRLNRLYVERFGKARSPEAGAVGAA"
FT   gene            209831..210478
FT                   /locus_tag="Bcen2424_0187"
FT   CDS_pept        209831..210478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu3938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06941"
FT                   /protein_id="ABK06941.1"
FT                   /translation="MQRLTFSRVCTFIRPAPMNLPLPEVFHSALQGDRLEIIANILIDE
FT                   HFTTLTDLQSEFDDGYSRGTTRFARQKNRLKSVALSGQYDWLQLLHAGNDLVFTIEGIP
FT                   CRFATDDPVNPTKPAVLDATPIQQSFFDEVENGEPCKFCFILDGGYAEADDPRVVFIGE
FT                   DLMGVAKCRWTSDGTKALHAVSANTPPAKDIGKAPVGPKRIDSDKTGTSDAP"
FT   gene            210475..211626
FT                   /locus_tag="Bcen2424_0188"
FT   CDS_pept        210475..211626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0188"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: plu:plu3939 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06942"
FT                   /protein_id="ABK06942.1"
FT                   /translation="MIFIGSNLRIARLFHNFSQQELGEHIGCSKQFLSRLESGGDVPTA
FT                   ALVSKLCDQLAVLPEFFVEPDPMPIADEQCHFRKQLTTKVALHQSARARGEFLKRMINV
FT                   MDEHLELPRYDFQEGDASSAEAIEQVAERAREHWGLGLGPVQNMTRIAENAGAVVMPIN
FT                   GLAPEIDAISFATRRPVIAMNSEGRSSCRARFGIAHEIGHFCLHIGIQTGDKVTESQAN
FT                   RFASAFLMPRRYFAAECRTAMRGSRLNWPVLTDIKVRWGVSKAAILYRGRQLGVFSDEQ
FT                   YRSGVIGLTRRGEARSEFEDKDMPLESADLITDGIQVLREAFGISRAALAQEMKVQTSL
FT                   LDELLSARFDTNAYAAATDNVVSMSLERRARADVARGSTRRPL"
FT   gene            212767..213036
FT                   /locus_tag="Bcen2424_0189"
FT   CDS_pept        212767..213036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0189"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: cch:Cag_1938 Sel1-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06943"
FT                   /protein_id="ABK06943.1"
FT                   /translation="MPVDFRMGFHLNNGISIMSDYQDAHDLSLRATAGDAQAQFVLAER
FT                   YANGEGVQQSSRNATYWYARAAAQGHVQAQKEQARCRDEGEGVT"
FT   gene            213275..213565
FT                   /locus_tag="Bcen2424_0190"
FT   CDS_pept        213275..213565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06944"
FT                   /protein_id="ABK06944.1"
FT                   /translation="MAMAKYCITAANHKNPNNHVASSFLVWVQDPKTTKWSELGAKSAK
FT                   QVVELIESGNTVLTGKISADGKKLLPGEPVEVELRIAKNKTDYDVSKMPTF"
FT   gene            213578..214912
FT                   /locus_tag="Bcen2424_0191"
FT   CDS_pept        213578..214912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bma:BMA2990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06945"
FT                   /protein_id="ABK06945.1"
FT                   /translation="MRRFDFHLSSLANRNDSLRSSFKVPRARLPPIVAGARMSVSKSWA
FT                   YVTEFGRERITAWAIQQERAKYEGKPLGRTYWSNHKPGRRKAVKHVQKAGTAFFAYINP
FT                   ADAEGCGEGESLSHRLLKEAIAGLAGTKLKLGNYGDHDVTITHGEIETLIPTIEGTYYA
FT                   DAFLRFTCSTRLALRWSGEIYIEVHNTHAVPVDKEKELRRSRVPVVEVPLLKAFEYPYQ
FT                   DEDTTDLREAAHVERIRNMLENGFLAGKVISDRRSVEFLEQEVSLLRASLREARDGWDL
FT                   AKQATADANDQLASARARIAEQGKSIADDARNVKRWADQCGDLQREFNEEKAKAGGLSG
FT                   DLANAKATIVALRKKARRYSIAGGTGILLGLCSVPGYWQFLKAPSVAQDLPAQPAAVSP
FT                   TEHSAPARETTVSARHAARTTTAHRRPAHRPAPIANESEPEASTQ"
FT   gene            complement(215234..215902)
FT                   /locus_tag="Bcen2424_0192"
FT   CDS_pept        complement(215234..215902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06946"
FT                   /protein_id="ABK06946.1"
FT                   /translation="MSKRYRWLAVQWPIAMRTLGKRLKARPFDGEAMHGFVIDRIRDDA
FT                   LEARYVERIEYTETITDPFGKELSFDRVEFRQSFFCATTDGPGLELRDPPRSLQPLMNR
FT                   LSEATDFEVAINPYTVDVLAWAAKFQAGTGLPLVVDSVQMNSLQVEDGIAAKIVIKGNR
FT                   DVRAASTTLAANRKFQMERIQLRIGHPTGSVTLSNTGSATLNVDDPDGVLLEQLRSALA
FT                   "
FT   gene            complement(215886..217034)
FT                   /locus_tag="Bcen2424_0193"
FT   CDS_pept        complement(215886..217034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aci:ACIAD2192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06947"
FT                   /protein_id="ABK06947.1"
FT                   /translation="MSEFLDHLSANDNDIYDLLVSGKQRLTESVLREFARDRGIFCSPE
FT                   ENREELADYLSVLPHGFHDVATIVQKREPGHRREKTTFVRLNTTIPVEELKAVAADYEI
FT                   AVRGREKVVYRPAANNEFVMKVTYDEFNHSRTRLLQRERQEADIEFLVQDGQTVVRLPA
FT                   TDRAKKIVAALKESVERRRKATIDEESIELTGLTTPEQRSKFFTRLISTLPGFRLRNVM
FT                   SLKVSSKSSEDGEDDEALALEDEDDDEAGAEMFAAVVHSMQLSGQNLVQSQEYKELTAR
FT                   GFYITAISWRSESEGTPPDIIQFDAGFQDRKQGTGFKYAIQGAFRAHKGSHRKTIVHVD
FT                   DSEKARLLALIEATARKVLADLLTEAKESDLPAEGDMDVEAV"
FT   gene            complement(217031..217984)
FT                   /locus_tag="Bcen2424_0194"
FT   CDS_pept        complement(217031..217984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aci:ACIAD2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06948"
FT                   /protein_id="ABK06948.1"
FT                   /translation="MASELFSEFFWSKLGPVNHDWPCEDQERHKVKEHPCDVVYYYDEP
FT                   YAARQTYVHCDLKSYAKGTITAAAVKSAIESLAKQVACAEKSETWRNLHTHDNVTFSVN
FT                   GLLFVYNHDGEYEADFQRNLVHVAPETLHLPRGSRLFVLGPKEIFWLDNIRDEIQRLRG
FT                   RRIPEVPAPEHCFYFHPQLVRRANLQVRKAKAATLEMLTSPIIILEHHDPKGSARRGVI
FT                   VFYSRPGDTTDEFMYLIDTLRKYELLDDQTSVTVKTLGASPISSPTFQKAQLQYIEGLV
FT                   GTNVATDLGDYVNAIRYEPMSHIKTTYSNVDLGTWG"
FT   gene            218500..218814
FT                   /locus_tag="Bcen2424_0195"
FT   CDS_pept        218500..218814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06949"
FT                   /protein_id="ABK06949.1"
FT                   /translation="MRKCSARRTRRHWRCRASPSPRPLLIFEEQTSGEYRLAARNDTVV
FT                   LRANDGGQCDPFEDGYDGLAVKGRYFTVQNGVACGAHVSSTARSSRLPIHSTARPTGPT
FT                   "
FT   gene            complement(219131..219466)
FT                   /locus_tag="Bcen2424_0196"
FT   CDS_pept        complement(219131..219466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06950"
FT                   /protein_id="ABK06950.1"
FT                   /translation="MATDRVNAIHGPDSVRHEAAELLLAARTLVSPQTPLWGRARCIDL
FT                   IDTLLDLATRHGFMLTEPLLEMLDADLYGDDTLRMIHAAFNPVPETELVASLHQSSFHA
FT                   WLQGKVH"
FT   gene            complement(219607..220080)
FT                   /locus_tag="Bcen2424_0197"
FT   CDS_pept        complement(219607..220080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06951"
FT                   /protein_id="ABK06951.1"
FT                   /translation="MQEQAQNVRNAAQTVFPLFVIVGIFGLGIWPVMYLSMREKRINEA
FT                   LGAELIPHWVSVTQVALLGTTLFLKFFGGWIDSDDIVGLSVLTSLAMGVMWIVFAFRAK
FT                   ATLERVVVHQWQITGYRLNPVWTFFFSLFYIVYCLNDLPEAVRRASPIQQPVA"
FT   gene            220256..220585
FT                   /locus_tag="Bcen2424_0198"
FT   CDS_pept        220256..220585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0198"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bte:BTH_I0107 possible transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06952"
FT                   /protein_id="ABK06952.1"
FT                   /translation="MTTRRPTPPPSRPAPISIALGKRIKECRHAADKSQETLAFEAHVD
FT                   RTYISSIERGIANPSVETLANICYSLNVTLGELFAPLDGVSLKPTGERRANAATPPEIK
FT                   RSRLR"
FT   gene            complement(220586..221224)
FT                   /locus_tag="Bcen2424_0199"
FT   CDS_pept        complement(220586..221224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06953"
FT                   /protein_id="ABK06953.1"
FT                   /translation="MLIQKFHHALRLGGGPVRTGSGSPLFSRQGHWDGGSTLHCVAMAL
FT                   ALLDLLGDPVWLPYHDEGNERTVWDRAWPHYLHGLTLSELSGFIAELNLGLRPVERQAE
FT                   GSELSRFCERELQAGWPVIIGWNQRHPVSAHAALVTGIEGHQNGKVFEPHALLLLDPAG
FT                   DDPGRSGFNARLDWHGNEALLYSGPSVTRAVTPEGALSIRVTGSRGAPA"
FT   gene            complement(221226..221519)
FT                   /locus_tag="Bcen2424_0200"
FT   CDS_pept        complement(221226..221519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0200"
FT                   /product="plasmid related protein"
FT                   /note="KEGG: bte:BTH_I2730 plasmid related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06954"
FT                   /protein_id="ABK06954.1"
FT                   /translation="MNARARNAARFPIGRALITPGAQAALDSEGIPVLLVLARHVCGDW
FT                   GELPVEDLAANELALLAGRRLLSSYALPGDGKVWIITEADRASTTILLPDDY"
FT   gene            complement(221516..221899)
FT                   /locus_tag="Bcen2424_0201"
FT   CDS_pept        complement(221516..221899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2730 plasmid related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06955"
FT                   /protein_id="ABK06955.1"
FT                   /translation="MNHHTRLKPLFHPGKLLVSPAALVALRANGVPVISVVLRHICGDW
FT                   GSVSESDREQNDLSITTGLRLLSLYHLPDGSRIFVTTAWDRSNTTIEKLDEGPADREAR
FT                   PASMPGRRRPVWSVFNCLQGACA"
FT   sig_peptide     complement(221807..221899)
FT                   /locus_tag="Bcen2424_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.895 at
FT                   residue 31"
FT   gene            complement(222369..223451)
FT                   /locus_tag="Bcen2424_0202"
FT   CDS_pept        complement(222369..223451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06956"
FT                   /protein_id="ABK06956.1"
FT                   /translation="MSATPRWAIAMAAGATGTALCLSTIAGWQRGGSLSERVVWVAMGV
FT                   VLIVSAHLLPTLVRSSPFTIRITGSVLWGACMVTACIGHVTFFLFAQQHAGEARASAVT
FT                   RNVAASPALASRTLTAVMQEGAAVTRQLALARAQRCSRDCPFLDARRVTLAARLDALEA
FT                   EADDIRRQDSERDRTRSQRDALLADPVTSRLAALLGTTTARVDLLSGVTFAAVLEGVAC
FT                   LLWTVALRPLPLPHATAAVTGTVAPGVTPDINVTEAAPPAVTSSVTTAPVRRGNASARR
FT                   KTGSRSRDGPDGSQATRTEYRAPPLLETDGADDALTRLARDIDAGRVRPTVAGIRSHLG
FT                   CSQSRAASLRRQLAVLSPTA"
FT   sig_peptide     complement(223371..223451)
FT                   /locus_tag="Bcen2424_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.966 at
FT                   residue 27"
FT   gene            complement(223448..224398)
FT                   /locus_tag="Bcen2424_0203"
FT   CDS_pept        complement(223448..224398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06957"
FT                   /protein_id="ABK06957.1"
FT                   /translation="MIKGLALTPPVIGRISIGRVVEKNGKCLPEKDDQFTITTQVQQRG
FT                   EWVLHPLNESLRKATTGKLRAIPVRFLFNDPDLNLRAEYSLFDRDTGRPVCVGNGTTCR
FT                   RACENGIEELSCPSPDGCAFGQAGNCKPFGRLNVAIGDEDELGSFILRTTSWNSIRTLA
FT                   ARLHYFSAVSGNLLACLPLELKLRGKSTTQSFRSAVYYVDIGVRSCSTLEQTIVQAREL
FT                   DDRRRAAGFDQAALDAAARAGFANGAYEDSIEDGSAVVDEFYPDAGRSDGDGPGTDGNA
FT                   ATVAGSGTTVSRTDGSATLRQKLERKAMPLGGAAA"
FT   gene            complement(224462..225457)
FT                   /locus_tag="Bcen2424_0204"
FT   CDS_pept        complement(224462..225457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0204"
FT                   /product="GP47"
FT                   /note="KEGG: bte:BTH_I2726 GP47"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06958"
FT                   /protein_id="ABK06958.1"
FT                   /translation="MSLPETAGRGRKRPALRLVETKDLPRTDWLEVRKSGIGGSDAAAA
FT                   IGLNPYMSALELWCDKTGRGDGLPRPDPGDTTSPTYWGTLLEPIVSASYTKQTGNRVRR
FT                   VNAVLQHPTIPFMLANLDREVIGVPGVQILECKTAGAFGARLWREGVPEYVQIQVQHQL
FT                   AVTGKQAADVAVLLCGQKLEVHRIERDDELIARLIPLEAAFWRYVETDTPPPADGSESA
FT                   DRALRCLYPGTGGTVDYTDDRKLSSLFADLVALRADIEQRETQEAVLKQTLIQAMGEAD
FT                   QAIFETGSVSFKRSRDSAGVDLKRLLAEHPEVASQYALSKPGSRRFLIST"
FT   gene            complement(225532..226500)
FT                   /locus_tag="Bcen2424_0205"
FT   CDS_pept        complement(225532..226500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_3659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06959"
FT                   /protein_id="ABK06959.1"
FT                   /translation="MHLVQTMAFTGEEPWHGLGNKLVPKQPLEVWQKAAGMDWSIEEAE
FT                   VRFVAAGNKSLGSIHAFPEQKVLYRSDTKAPLSVVSARYQVVQPSEILEFYRDLTEYSG
FT                   FELETAGVLREGRKLWALARTGQSATLKGRDVVNGYLLLATACDGSLATTAQFCSVRVV
FT                   CNNTLSIALGEGTGAVKVPHRSQFDAAAVKRQLGICISSWDAFMVRMKALSECKVSDVG
FT                   AEKFLRRVLTYPTTNSTDRDAIAVNDRAIKAVGQLYAGRGMGADLASASGSAWGLLNAI
FT                   TEYADHHRRARSDDHRRDASWFGAGATLKGRAWEEAMKLVA"
FT   gene            227557..229626
FT                   /locus_tag="Bcen2424_0206"
FT   CDS_pept        227557..229626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0206"
FT                   /product="ATP-dependent endonuclease of the OLD family-like
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_A1800 predicted ATP-dependent
FT                   endonuclease, OLD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06960"
FT                   /protein_id="ABK06960.1"
FT                   /translation="MKLRHVQIKNFRLLSDVDLALEDLTTVVVGRNNSGKTSLSEVIRR
FT                   LLADGSAQFQLEDFSSACYEGFRLAWEARSNDEHDDIVRALIPYIELRLTFQYDPNQPQ
FT                   LGPLSPFVIDLDPDCTEALVVVRYELKDGQLSQLFDGLPPTPLSAEARLTFFRTLRDRI
FT                   PGNYATRIWAEDPNDAGNQRQLLPNAVKGLVKTGFINAQRGLDDVTSRESDVLAKTVEL
FT                   LFATASSASADAADKQIADSLTDAVQGIQSQIDTNFGGQLKGLIPALKSFGYPGLGNQE
FT                   LHTETLLDVRKLLSNFTKVRYAGYSGVALPESYNGLGARNLIFILLQLAGFYKAYRAEA
FT                   TAPGIHLIFIEEPEAHLHPQMQEVFIRQLAKTAQLLVDSTEDKTPWPVQFVVSTHSSHV
FT                   ANEAGFESIRYFLGRDVSGAQPGVRQTMIKDLRRGLDGVSEPDKKFLHQYMTLTRCDLF
FT                   FADKAILVEGLSERLLLPVLVGKLEEAEPNSPKLSSQYVTTIEVGGAYAHLFFKLLHFL
FT                   ELRSLIITDLDAVEKAGGSACEVHKGTYSSNACLKAWFSDDDPFTLAGLLAKGEAEKIK
FT                   EGNRIAYQCAEAEGGPCGRTFEDAFILSNRALFGLTGNTREELEVAARSKAGEFKKSDF
FT                   ALRYAIEEKGWSAPKYLVDGVRWLAAGIEPDQSDPALALAADVIVAKAEAAPHG"
FT   gene            229619..231355
FT                   /locus_tag="Bcen2424_0207"
FT   CDS_pept        229619..231355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06961"
FT                   /protein_id="ABK06961.1"
FT                   /translation="MADIQSPAELASQCALDAMFQCLDEGRSFRLEAGAGAGKTYSLIK
FT                   ALQYLIERNRHGFPKKNQQIACITFTNVARDEIAARTDKSPLVFCETNHAFCWSLIRGF
FT                   QKQLRSLVEAMPHWQERLAEVGGTLGARMVEYSLGHRSIREDRVSIHHDDVLPLTISLM
FT                   EHLKFRRMVADRFPIILVDEYQDTDRDWVEAIKRLFLSNPDGPLFGFFGDHWQKIYGDG
FT                   CGRLEHESVTEIGKEANFRSVKTIVDCLNRMRPELRQEVRDPDSVGHVSVFHTNDWVGQ
FT                   RRAGGHWAGDLPADVGHQALEHVKELLAQQGWDLAPGSTKILMLTHRLLATEQGYTSLP
FT                   TVFRYNDAFTKKEHPHIAYLVDELEPACDAFAANRFGVMFEALGGTTPLLRSHADKAAW
FT                   HNAMTRVLELRATGTVGDVIDHLLDQRKPRLPDAIEKRERELRDFDRTAGEEMPERLAE
FT                   VERLRAVPYAEISALRAYLDGHSPFETKHGVKGAEFDNVLVVIGRGWNQYNFGEMLGLA
FT                   AGQAIPAAREESFERNRNLFYVACSRPKRRLALLFTQLLSPVAMGTLEQWFSPESVHAV
FT                   VL"
FT   gene            231370..232266
FT                   /locus_tag="Bcen2424_0208"
FT   CDS_pept        231370..232266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA2472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06962"
FT                   /protein_id="ABK06962.1"
FT                   /translation="MTSRTLYVIGNGFDLWHGIPSSYSCFRDYVRLHGRDVFDAVESYL
FT                   PVGESWSDLEAAFAEIDVDHVIESLGHFMGSYGDDDWSDSGHHDFQYEVERVVERLSRE
FT                   LRFLFGGWIRQLPIPTATTVTQRLRFLDRDAIFLTFNYTKTLREIYGVADANVLHIHGN
FT                   ADLPDSELILGHAWHPESCRSLNDRTDIEDIDVRLAEAHDILDDYFTKTFKPSAQIIQA
FT                   HGDFFALMRDVKEVFVLGHSLSDVDKPYFDAMLAVPGMRTARWTLACREDAGEKSRRIY
FT                   AFGIAPASVRTVSWGAL"
FT   gene            complement(232517..233656)
FT                   /locus_tag="Bcen2424_0209"
FT   CDS_pept        complement(232517..233656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0209"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bxe:Bxe_A2451 putative integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06963"
FT                   /protein_id="ABK06963.1"
FT                   /translation="MAASITSKTARDKLPPRREPYFARVQSGLYVGFRKLAEGDGTWIA
FT                   RRRNEAGKQEYKALGTLPAFDDAVKATLEWSKAVDAGVSTKATTVTNACEQYVKHLGLH
FT                   KGSSSKLDAEGRFKRLVYDDKIGRIDLSKLRTSHVKDWLAEQISEIEESAEDEDDLRRA
FT                   KDSANRNLASLKAALNLALHDRLVATDAGWKTVTKFKDVGRRRQSFLPAEQRSALIDAC
FT                   AEDIRQLVKAMLFTAARPGELARACVKHFDRQQGTLVLDGKTGHRVVSLASAAIRFFDE
FT                   QTKGKIANAPIFSTEYGQSWNKDSWKKPFKDAVKTAKLPDSVVMYSLRHTAISEMIASG
FT                   IDSFEVARMAGTSTEMIDKHYGHLRHDRMRAKLDAIAII"
FT   gene            complement(233928..235370)
FT                   /locus_tag="Bcen2424_0210"
FT   CDS_pept        complement(233928..235370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06964"
FT                   /protein_id="ABK06964.1"
FT                   /translation="MTSSACRPGGWPEDAPPRSALFSLNPEGHSGDDLEDLASYFRRLS
FT                   EDHCMLPWTLAFRSVVPLIGSGSTGWRAKMACYCYGLATSGVTELADSWAKALNHATGR
FT                   NDLQLHTLVPLKAVVPPTKLLSPIERFCPICYAHDESSERPKYNRLLWAVDCVAACPLH
FT                   CVQLQAVDKSNRNNDNPFWLHRQGKRASASSFWLPGISRVNGRSLASDVGKLAREEDVQ
FT                   FARLVADLVDDLHHHPHEFHDVGAPTNFLRYATEVLFAGNLSQFAQHLGVSKGALHGWT
FT                   SGKTRPSFPRLALIAFCCGAAISDVILGNKVMLFKRPAPARPAQLCVRKRKGARRPRNE
FT                   LRQEFEQIVESGRASSAREAADLLDVSTKFLRSLSPALNQQLVHAGQERVRRTARELED
FT                   LKFDEFRKSFDAIVAKREKPVRRRVQQDVFERTGLSFRYKQAGIFLERVRCLAGVDASS
FT                   GADGRKSGGRRRRRQENRPAMD"
FT   gene            complement(235376..236446)
FT                   /locus_tag="Bcen2424_0211"
FT   CDS_pept        complement(235376..236446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06965"
FT                   /protein_id="ABK06965.1"
FT                   /translation="MDWRLTMITREQAITGSPEDKAAYMKATCVPHRNLDAVMHEVRSR
FT                   MTAGAGLSITLVVGPPGVGKTTFGRKQLQSLLSRYPIQLQEKRHIIPAVMSEVDAADRG
FT                   EFNFNLLYNRLCADLMAPSSLDGPVLLENVSEPADPVRNSRMMFERALRRREVKHLILD
FT                   EAVHFTNSLTDPLQYGNLLKSLSNRSGFNLLLLGAYGCEQLVLASAQLARRIGVVHYPR
FT                   YFQTDQDFTEYCTFVKSLLAHLPYGFDIDIENRLEYLFAGTFGLPGATVDVLTGAAGRC
FT                   CESKRKVWSDACLLKSMPSKEAQRKIARDTMVGEAEVQPFLQMEREHDYATEQDIRNVL
FT                   LLEEQTRRKINGRMHG"
FT   gene            complement(236447..239479)
FT                   /locus_tag="Bcen2424_0212"
FT   CDS_pept        complement(236447..239479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0212"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_2895 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06966"
FT                   /protein_id="ABK06966.1"
FT                   /translation="MGTSLRDDSHLQDRRRASSTVAYPQLVALRRERKMTIELPVKLPP
FT                   LSTWQRTEALWLESRPGGLAKPFSDEELLAVMDEWGTPEEGRKYIIRARTESPSRRVGG
FT                   RARNVVTRYTPLKLDDRVATESRSVEFAALFRYDLDGTTREHYCQPPQVGIPTKIRRTS
FT                   RRGKVTEYTHTVPYTPDIFRLTPHGPFVEEWKNEEKLVALAKKYPFRFFKSEDDATWHC
FT                   PEREEYFKALGITFCLRSSAEHNQRFIDNLSHLRAYLDNQMSTLTEDAWSAIDRIVSKR
FT                   GAMSMAALFAFAFDDRTPWNEPLVLPTPPGRFRVDDVLQAIADKRLFVDLDYDDLSDPS
FT                   SVVICSSMEQLDAVKWRRPPPHTVSTHFVMTVDVGTEFMFRGKPDVYIVTAMPAGKVLY
FT                   RDSESRVFEEMPELRFQQLLQDDIHLLSTPKSTEELLAQCEYITDEQIQTARRRFQLVK
FT                   QLEHTAIPHPYSARTIQRWQQKIRSAGESRPLQMLALIPRRPGGRGPQILDEVLALIRE
FT                   VALGANNPTNPSGRHSYDAFVRLCRERDVKPCSPNTFYQRSAVFRDVRTREGDRRAYNK
FT                   EPAVWYLRRGDKIHGGRPFHRAHIDHTKLDIIIKARGHGGRTYRLRPWLTIVIDAETRA
FT                   VLAFYLAAHPPSTVSCMMAMRAMVALHKRVPDFLVCDNGKEFHSNAFDNFCDLNDITLE
FT                   FRPAHESRFGSVIERLFGTTNQLLIHQLAGNTKAMQHVRTLTRSVDPMRADHLSFVELH
FT                   GLLDYFFFVEYNREWRHPAHDHTPDEYMKNRFMVTGRRLTRLRPYDERFMLQTLIPVSR
FT                   GGTREIDNQMGIQVGRIWYWADEFAARRNRKKVEVRVDMWNVCVAYACIDGHWVKCVSK
FT                   LLMQYRHLTQIELRYAVYEVRLRLRAAPEGSFESVLRDVLAEQNVPVAADVTGATRLIY
FT                   GKPHLTEIESAEDVAEVSGTAHVDASTENSASAPHDEERVDETLVTNYRRRANDAPRPN
FT                   PPRTFGRFKIDYSHLPVRNPI"
FT   gene            complement(240900..241487)
FT                   /locus_tag="Bcen2424_0213"
FT   CDS_pept        complement(240900..241487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06967"
FT                   /protein_id="ABK06967.1"
FT                   /translation="MLIYLNFDGVLHPNHLQYRYRHSPELLCPSHTAFEYAPALENAFE
FT                   DCPDATVVLNTWWTYYLTVEACLQLLPASIRPRVVGTTLVGGIREEPLPNRVREAERHI
FT                   GVPTNELLVLDNSSARYGESLLPQLLLVNEETGLSCPSAMRALKKRLHSQWSRVASHKI
FT                   DQRPVPIPSIQNGREIPVRQWTEPPPANHREA"
FT   gene            complement(241496..242050)
FT                   /locus_tag="Bcen2424_0214"
FT   CDS_pept        complement(241496..242050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06968"
FT                   /protein_id="ABK06968.1"
FT                   /translation="MSDPGGYRNHPTMAQVMYLGIEGVLFAHRPADIRPRCCQHQPPRV
FT                   TPLPLLPAISRLLAGLPNVCVVINSRWICDVGYRNLLSLLPDEIARTTIGATMPGNRSH
FT                   RRSTTASRIDILRADIRRRCPARLAIVDASPYAVPYEYLAQAVHVTKAMGTREIAEIVD
FT                   RIVQLLDAGVAAIDEDSDFLA"
FT   gene            242169..242708
FT                   /locus_tag="Bcen2424_0215"
FT   CDS_pept        242169..242708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06969"
FT                   /protein_id="ABK06969.1"
FT                   /translation="MSVQFQVKLASGAENGWAKLASRAARVVLARQDMSYTELAGELAK
FT                   LGVAESAHAVEAKVSRGTFRFAFFLQLIAGSRTDCPYLWADALSSTETWQARSSTVFAA
FT                   EMAGQPWLNWQMLSNRLQEIGVSLPSESLQAQIESGSFATTLFLQCATVCRFESIYRFL
FT                   DTSELHRVALANSPQS"
FT   gene            242993..243385
FT                   /locus_tag="Bcen2424_0216"
FT   CDS_pept        242993..243385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06970"
FT                   /protein_id="ABK06970.1"
FT                   /translation="MRLHQLCRRLLGLQMKEAAMALWNIASVMSQPEVSIARWRVLEID
FT                   AGTRHFVGADERDFSGRVSSAIVAFDYKMLRGRTRSGRVYQLVGLPGHSTNADYVWQHW
FT                   CAINDVKSFSDVTKQLLAGIADDNRT"
FT   gene            244043..245779
FT                   /locus_tag="Bcen2424_0217"
FT   CDS_pept        244043..245779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0217"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: bcn:Bcen_2889 N-6 DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06971"
FT                   /protein_id="ABK06971.1"
FT                   /translation="MTPTTKSQFLRLVRALRAVMQGAQLGTDEVIGSALMRWCKESFPG
FT                   LPRSGLPVNAQLRNAPAVAAFVDFVKKKDLLEAIYWLSSAYAQLAGEERRKQLAMFFTP
FT                   PSLTKRLLDDLSASGVDFSVRKFCDPACGGAAFLAPIAMRMRDALRERGTSATQILDHV
FT                   QRHLLGFDKDAALCEMSKHFLLMVLHDEVVATGARPKFQIHQGDSLIRAQSLLGALDVV
FT                   VCNPPFRKMPSAEVAHYLEHFADIIEAQPNLYALFMALCVKLLAPGGTCALVTPTSFLS
FT                   GQYFSKLRTFLLTQANVLSIGMVSDRLGVFIDVEQETALTLARREQTGHGPGTDAYVSV
FT                   VARDGNYVNVGRCVLPNSGAAWPVPRTESDVVLLKTAAKSRATLADYGYTPRIGAFVWN
FT                   RDTRTTYPSAKSAARAHGGTAVPLLWSSDIAQDGSLRFSGAPKANREHCFVNLGAKDHR
FT                   SVVRRPSVLLQRVTSNDQPRRLVAAAVPPALIETYGGFVGENHTVILEQVHPEPALAPE
FT                   ELAQLLATPTVDRYFRCISGATNVSIFELGQLRLPDPGRLRNLLARGCDMPSAARKALQ
FT                   EQ"
FT   gene            complement(247523..247765)
FT                   /locus_tag="Bcen2424_0218"
FT   CDS_pept        complement(247523..247765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06972"
FT                   /protein_id="ABK06972.1"
FT                   /translation="MPQNGLYPRFVGFELRHALYDGLEGCSQKLTRPLRQQEYRVRGDS
FT                   VVGQQHAQTILVESSKHKRRTTQPVNVLLQLRSRQ"
FT   gene            248036..248614
FT                   /locus_tag="Bcen2424_0219"
FT   CDS_pept        248036..248614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06973"
FT                   /protein_id="ABK06973.1"
FT                   /translation="MSAELREMVEQVLCDAGVSIQSDKTFESALRSYHELVQKRLAQRF
FT                   PQATVADQVRAVRQSMVELDASLERRLPTLQAMRHWIDLGRSPDTPFEQLRPQAPNRED
FT                   VFKAFAEVLGFSTLEAAYHWQRVITAVRTSRRLDGRHVSDIYAYMLLQPESVMAHSSIR
FT                   RKTLQQLFDKARENVATVEIVGPLKESKE"
FT   gene            248611..252816
FT                   /locus_tag="Bcen2424_0220"
FT   CDS_pept        248611..252816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0220"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: bcn:Bcen_2887
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06974"
FT                   /protein_id="ABK06974.1"
FT                   /translation="MSQSVLRADPAKISPTLKEAVVDSLLNLTYAQLSGQGPTGQYIFG
FT                   TRPRALLNSGFLLPQRSVSGDDEVTSPIWVSSHGIQMQLNAVTPAVMTVLPRFSVYVRV
FT                   LPREEDLRRPNCRPVFMLRQALVDEIKAERDRRLEGEWEKVKGGYTSKWKHPDWPVIRA
FT                   RVVDEVYKAKGVPRHLLTADVPQDESDLEADEALGDADSAGESTKEGVPVKADESLPIK
FT                   DEHFEPLTVPHKWMRLEVQLPSLELDIFKSSEELQRDLDDHAARMNAAVAKRVAEWAQS
FT                   DDPDTGGKAWGYRHDLSIPASRYTKWADFLDLVRKSNLRITLPQIQLSWDLELYPDWLD
FT                   PSKRSFFLALENVSKLPKQHVDETEEAVFLVSLRVELPTALHHPLKLERVEPSYRYNKY
FT                   LTYPAMGHNCGVVRIQSDSAGCVLETTWTPRYTQPRIVPTSANGVQRRVRSLAQPEGVD
FT                   GLSPLVPSMGAWLKSLPTHVNPAEGLDISDVAGIAREEEAFRQDLRKWEAEMKAVEAGL
FT                   NCLRESRDAWRSRGLQTDAKAIVYEAWLATNETMADFMRARFGGDDSEWRLFQLAFIIA
FT                   NIPPLASRIPELSHFYDERRDDAVTLLYFATGGGKSEAFFGLLVFNLMLDRLRGKHRGV
FT                   TALIRYPLRLLTIQQAQRAARVLAHGERVRRRHGYGGDSLSIGFWVGNGGSPNRHSAKG
FT                   VKSIPTVSEAPPVLADEHALRENDSKYTLAMRAWRKLPKCPFCGSETALRLFVDSKNQT
FT                   LGHVCTNIQCDSNGGQWKPLPFYIVDEDIYDLAPSVLLGTVDKLALIGHSNHTIRRIYG
FT                   MFGAAPWVNPSNGRLYVPIDNRELTAGPAAKGMEGVYPAYQTGKRVFHDPFPSLIIQDE
FT                   AHLLDESLGTFAGLFESTLDAVFEYLAKPLANLIAVDGRGHRRRAKVIAASATVADPER
FT                   QLEHLYQRSTPATQFPEPGPTLYESFYAKPAQAKEVLREAHLDVEVASQQARVYTAFMT
FT                   NGKPHTSTSVAVLSGFHLTVTRLFDSFTSGAPEHFQAAQKMLVDHVSAGPLEQLHKQVL
FT                   AAADASQLATLIDLHRIALTYVTNKKGGDQIMAAEAEETRKRHLNEGIALEGLDTRLIT
FT                   GSVEQGEIQAVVDTAQRRVAPGQPLPPIREQLRSVIATSAISHGVDVDEFNSMFFAGMP
FT                   SDIAEYIQASSRVGRTHIGFVVLVPTPQRRRDRHIVHVFDIFHRFLERMVQPAAIDRWA
FT                   ERAVERVFPSLLQAYLLGVVPSREMIRLPEDEKGKTPDFSFIPNVRKELNTRGDAFIEE
FT                   IDRFVELAIGLRDAFAPEGKEHYRARIDQKTRDLVANAWSSPVWGSGNMDGYFKAQTDL
FT                   MLKPMTSLRDVDQGGAIQASTRDAEGKTQTPGEVLLVMDLVRHGVANNDGADNAQTGD"
FT   gene            252818..255043
FT                   /locus_tag="Bcen2424_0221"
FT   CDS_pept        252818..255043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06975"
FT                   /protein_id="ABK06975.1"
FT                   /translation="MATRKGFLDAEGEEKTLSAPTMARSRGQLGSAYAPGAFFTFEGGL
FT                   GACISLPDFSSMVDDAPIHSTTKAQIILRLQEVWQSWFARSYAVGIGNQQIDPRQCLDE
FT                   ALLGGATVVPLGADRLAFLSPLRMGYAPAPLTFVCNKCRLFRRFESAHDLAQNIIRLRK
FT                   TQCGAADGKGLCQWRQLDVIFVHWSGEWMPATPGRWEWDDRKNDLRLSGEECSVCGKRD
FT                   FKLNTDSPRIGQWHFYCANPTCGHKGSDEWRQNDQFTTEVFRDTANRRVSERRMEPISY
FT                   RASSAYYAQSEQFVLFSQSEHHLLEMLEPQRQSELAAFIGKRFRFEGGELTSDEMKAAL
FT                   LAGGKAGEWETYENLSRICELARGMDDKGPQEMAEKELKKLIDRWTTSDPPLVPPRVVL
FT                   PPGIHAQLTARSEYTSRFDPFVLTVEHEALNRGKLSAAPDGGRAKFVRFNHLDNDLAPK
FT                   DASVKAAQEAQTQHLMTKLGMADLGLIREFDLCRFTHGYTRVSATPTLEKRNQLMPVRL
FT                   RLFDPLRNGKRPIYVVTQANEALYVRLDPRAVYRWLQSVGVVDLPDWDESGIVKLGGKI
FT                   LEVAQPFGRYFSLLKEGDAATYRYVYTLLHTYAHSIMKSVAELSGLDLGSMGEYLFPLD
FT                   LAFVVYRNGTTMDLGNLSSLWRNENNRFLSRLLEPSTHRCNSGRLCDTAGGACPDCIMI
FT                   PETSCLAQNQLLSRAVLKGGPPPREDTTHRGKRIPGFLEVVNEGIAD"
FT   gene            complement(255342..257045)
FT                   /locus_tag="Bcen2424_0222"
FT   CDS_pept        complement(255342..257045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06976"
FT                   /protein_id="ABK06976.1"
FT                   /translation="MSALIFKQLFVQSTSQKLAGRFRFEPGLNLITGDDNSIGKSTLVR
FT                   LPLWTLGCDFDFDTLWAPFDARTILEFEVDGRTYLAARHRNQIRLKVGEEPWTVYHSTS
FT                   DAYEQAFASIVQFGAVLPRRKEKWIHEVPPPACYFSAFYVDQRRGWTEPWGSFVIHKYE
FT                   DWRRPVINFHVGYHSAAYFEVGAEIAKGLQHIDADQGLIEKYGRAVEVLTLLAPPEELP
FT                   TTDAELDSAIADIQNSMVAVKRREQRALSVLRAKHEELEITKVQRGIAQAAVDDIEKDY
FT                   DFASTQLRDDVLVCPLCGTLHDNTLLERASLLQDRAQAEQQVASLTATQSKIEAAIETT
FT                   LRRLDAVREELAKLNRRFKRLDKDVTVKSILETMGTDSVRRRAEEVTTTARLRLRANKK
FT                   TLAEQRAAQSELIEDGKEESINAYYQSELAGLCDTLRLSPAFDVRTALPTGYRELAVSG
FT                   GGADSSRMQLAYHLTMHRLIRHFKTEVLAPLILDTPNQQDQGALNYGLVSEELKRRATK
FT                   DTQLFVCATRHAAMQTLEKDSTVIELDENRLLSTELYERLQAGFVRVFGE"
FT   gene            complement(257099..258208)
FT                   /locus_tag="Bcen2424_0223"
FT   CDS_pept        complement(257099..258208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06977"
FT                   /protein_id="ABK06977.1"
FT                   /translation="MRDPKPRLTKTAAASSGTPASNPLYVSQREKAGAATFDRFNFQYD
FT                   WALYEFLEQHKLNQVSIVFVEFHEDVVFSSSLDAADARFVFCQVKAGASANFNKKSLVK
FT                   RIKQKPSVLGKMFTSVGDKKIAARVDKVRLVATGGFKLELAEKGFQLEEIPWDALHQET
FT                   ANEISAALAAELGTDCALEKLHFHKPQLPELQHRRAVIGLIADLISERVPNGGGDCQAI
FT                   YHVLQDELRRKGVHTWDYSDWESLVRNKGLTGQRVDALFEQFASSATVDDLLSDFEYAT
FT                   AQLQYEPRERRKLRQSARTYVLNTLDGGSLAHLQVRAAVSRHLQADFPLRLTTDLLTSL
FT                   VAASPDVVREHLVDETSLVAAYIIEYLRA"
FT   gene            complement(258444..262238)
FT                   /locus_tag="Bcen2424_0224"
FT   CDS_pept        complement(258444..262238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06978"
FT                   /protein_id="ABK06978.1"
FT                   /translation="MQFIKNGPTIPETLLLAHEEGRVVFFCGAGISFPAGLPGFKTLVN
FT                   KLYDSLQPAPNDVQEAAITNQQYDIAVGLLEDELGSREVVRREMAKVLTPDLSARDAFT
FT                   THRALLSLAKTRKGSTRLITTNFDRLFEEVIARDGLKLEPFCAPLLPVPKNRWNGLVYL
FT                   HGLLSTSPSRDELDRLVISSGDFGLAYLTERWAARFVSELFRNYVVCFVGYSLADPVLR
FT                   YMTDALAADRLRGEASPEMFAFASYAGTKASHDKASREWRAKNVIPLLYKETKDHSYLH
FT                   KTIRAWEKTYSAGARGKGKIVQDCILAGPLASTVEDDLIGRMLWAISEPDGTPARLFAE
FT                   HSPAPTLDWLPHFCDTRFEHRDLPRFGVSPDKEVDVKLRFSLAHRPMPYSLAAEMSIVS
FT                   HGGNPRAMDRVMSYLALWLVRYLDAPELLLWLASRGGHLSEPFASQVRKRLEETAQMEE
FT                   RESAEEIKRFKDDSPHGIPRPAMRTLWNLVLLGRVGSANTDFHIFEWVRHFLREGMTTA
FT                   LRLQFKQFLGARVILRKPIRLLSETSVDIEREQQLRHLVNAEVVLTDDHLRIAMEEVKD
FT                   SLQWQNALPELFGIACEALRDVLDLMREIGQANERSDASMWDMPSIIAHWQNRHYKDWT
FT                   LLIELVRDSWSAIFQSNPERAHDLMNTLRQMPYPTFMRLALNAAREEGDKSTGAWVKWL
FT                   LEDDAWWLWSTETQRETMRLLATSSKWLTLDSAERLQQAILTGPPRRMFREDVDDARWE
FT                   DIVERMQWLRLAKFKAGGGALVAGTTERLAGLETKHPQWHIGSDFEREEFAHWMSGTGD
FT                   PDYHFQPQIDLAPRRRSALTTWLQKEPERALFREDDWRELCRTDSRVAIASLLELATRD
FT                   VWPRERWSEALSTWSNDGFVRRSWSRLANCVLSMPDDVFREVVSATAWWLHEVGKQLDV
FT                   HQATFISICERVLRLPTDDFPDTDDAVMRSMSNPLGQVTQALLNWWFSEPLKDNQGLPR
FT                   TIASIFTRLCDPAVHRFRHGRTLLASNVVALYRVDRLWTQAHLLPLFDWRKSDREAYAT
FT                   WMGYLWAPRLHKDLLVELKTPFLDSAQQYMRFGDARVNYASMLTLAALDTTDIFSRAEL
FT                   QKAVRALPDDGLVASAHAVHSALKGANARQNEYWTLAVRPYFASIWPKTTASMDARLPE
FT                   ILARIAVAADREFPDALDTVKSWLKPISYPYQLLKEMNVEKIGERFPRPALSLLVAVID
FT                   KNRFAPSDLNEILRQIASADEKLMRELEFQALEDFVRRR"
FT   gene            262509..262820
FT                   /locus_tag="Bcen2424_0225"
FT   CDS_pept        262509..262820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06979"
FT                   /protein_id="ABK06979.1"
FT                   /translation="MRRASGRYLRMQRKVCVSSGPEYYLDRHQRETWQPAPHDVAGALF
FT                   RHIYELESEPADVRHAIRQNDCNLRVARVDVGVKPSDDFKEQLLQVIAFTRVRRLDFL"
FT   gene            complement(262899..263843)
FT                   /locus_tag="Bcen2424_0226"
FT   CDS_pept        complement(262899..263843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06980"
FT                   /protein_id="ABK06980.1"
FT                   /translation="MMVSRKTRNINRDLAHLRAGEQYLLGLPLNTIQPQRLERAGLGAH
FT                   PANGTRVLPPATGGAASRRNANGFDIIHRDQPKETRYRQISWTWTEHHGRDTVEKTGVK
FT                   DVPYLRYPRTSIPPYAVELQIQTRRDGASFVVAGPFTVGSELDAVATNTANVFCEQFGG
FT                   YEILNVTLGAWVATPVRRLNWELLPPGRNPWLSAKPALDRIVSSAPAGNRDVIAARFAA
FT                   IGSHSPDFVAVGAAGFDGYAVFGFPRQGFCLLESRQVNNATYVLSDTDWERVSQMSKAE
FT                   ILSAGAHQRRLIHTRNWFDELELMFASPGRRTA"
FT   gene            264002..264583
FT                   /locus_tag="Bcen2424_0227"
FT   CDS_pept        264002..264583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06981"
FT                   /protein_id="ABK06981.1"
FT                   /translation="MSDTVENDSRLSKREVEEELQKLSEADWTRAEIYADFLSRSLAGC
FT                   DGNDLLQMAMEKFLNMRRRWPRGLEPLKALFGAMRSISSNELKKETNGPIDTFAVVSTT
FT                   DESPDEGQVQPYAVATTLETPEDVLVGRQLVEQIEAELSDDEEAGLLFMFWIEGTRGAE
FT                   AAAELGWDQKRFDAARKRLLRRLAPHDRQG"
FT   gene            264588..264992
FT                   /locus_tag="Bcen2424_0228"
FT   CDS_pept        264588..264992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06982"
FT                   /protein_id="ABK06982.1"
FT                   /translation="MNITKKPEPFDHLADALERELLNMSDEDVLEGRNGDAAKANGLRL
FT                   LKAAKATAGKQRLAAAKEAVALARSGVLSVPLEVKLDDIKAYIRNASNDGRYTLAARSL
FT                   DEMTESDLRRIYAQLKRLESSLDSNEDDGQ"
FT   gene            264989..265804
FT                   /locus_tag="Bcen2424_0229"
FT   CDS_pept        264989..265804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0229"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   bcn:Bcen_2878 protein of unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06983"
FT                   /protein_id="ABK06983.1"
FT                   /translation="MSPGERAENLIAEFGITSPDELDVRAFAYDAGLEVEFDDLEGCEA
FT                   TLVGVGNRGIATIRPSNVVGRERFSIGHELGHWEMHRGKSFRCRVDDPSDNLASNSEQE
FT                   KHADEYASHLLMPRPLLQPMVKSVGCPGFKHINEFAEIFQTSRTATCIRLAQIDTLPII
FT                   AACYRGNDLRWLSRAPDVPRKWFLKSRLDEDSFAYDVLQHGREAQGKQPAEVWFDDDGA
FT                   DEYEVMEHSARGRDGEVLVLVYLTDVEMMTSRSSRSRHAEGAWRSRGGY"
FT   gene            complement(266095..266481)
FT                   /locus_tag="Bcen2424_0230"
FT   CDS_pept        complement(266095..266481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06984"
FT                   /protein_id="ABK06984.1"
FT                   /translation="MMKKRRSTRATAQLLAINAKLYEKERDRQVTRYRFSANTLRRLAN
FT                   RTAIRESFLNELEEELAELNLLLVRLPGEYAVVDLSKADSWVKLGFKRLKEADDDLLAA
FT                   SEEHIEMKYEQLYPAANEEETGDD"
FT   gene            266987..268591
FT                   /locus_tag="Bcen2424_0231"
FT   CDS_pept        266987..268591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06985"
FT                   /protein_id="ABK06985.1"
FT                   /translation="MAAIPSTSTAVAACPLTDAQQALLARLHAYSPDDPHAPLPYSRRL
FT                   AEAEGWSHDHALAVIDEYKRFAFLAQAAGHPVTPSVAVDAAWHFHLQYTLEYWDVFCAD
FT                   VLHARLHHMPGTGAPDEAAVYAQRYRDTLDSYRRLFGCEPPASIWPRPVDRQAEADAEA
FT                   RQTERMAAVAPRRAWRDRLPKLVWPAAAASVAATCASAQDLDVLDYTGPQFLAFYVPAC
FT                   ILALLLIVALQAIEFRIRRWGRRTRKASSGLSADEVAYLTGGEARVAQVVTMSLAHAGA
FT                   VDLWSVHRQGSYVKIADLARAGRYDDYCAWLNEQPSGTVRYGVFRERLARYAQEVVDGM
FT                   RAQGWFWAPGELRASRMAARAIALLVLGTGAAKLAVGLSRGRPVLLLCICMAVFAIAYR
FT                   IVAGRLTGFGRGGATAAGRAALLERRNAHDPRAARDARHVRSARGASGIRDAERDDPDP
FT                   LLWTAALFGAGALAGTVWSAYAGPVLVASQVSSAAAAKAGGGTSSDSSCSSSSCSSSSS
FT                   CSSSSCSSSSCGGCSSN"
FT   gene            268800..270749
FT                   /locus_tag="Bcen2424_0232"
FT   CDS_pept        268800..270749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0232"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   bcn:Bcen_2875 TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06986"
FT                   /protein_id="ABK06986.1"
FT                   /translation="MNVRRFAQPSMTTPASDVSACVRHAATLCQNGQFADALSRVAPLL
FT                   DAPAVDVAALHVAAVCALGLNRLADAEAWWRRAIDAMPAFEPPYDGLHALLLSQERLPE
FT                   AEVILRRQLACVAPLRASHHHRFGKVLEALGRLDEAEQAFGQALSIEPRSPDVLTDLGN
FT                   LLRILARPAEAELAYRLAIAVRADHVLAHANLGAILVDMQRLPEAEAASRQTIALCPDH
FT                   PEAHYNLGVALQNLDRLSEAEAAYRDAIRCRPGLPQPHNNLGCVLRAQGRHDEAAVAFT
FT                   DALALAPRMAEVHYNLGTTLAHAGQLDEAERAYRRALDLRADYDDARFGLATLLLGRGR
FT                   FEEGWRRYESRYEQSTFVHRRTREVLRCAQWQGEPLAGKTLLVWQEDGLGDMLQFSRYF
FT                   AEFRARRAARVVFACQPALHRLMETVDGVDAVLDHEAATAQAGQFDYWTSLLSAPMHAG
FT                   TTLDTIPPPVRFVSDPACVAHWGARLDALPAGPRVGLVWKGNPKHHNDVHRSLPSLALL
FT                   TPLWSVPGVNFVSLQKGQGEDEARQPPGGLPLLHLGSELDDFADTAAIVAQLDLVVCVD
FT                   TSTAHLAASLGKPCWVLLPNQDVDWRWMHDREDSPWYPGTVRLFRRGRGESWIQMAERL
FT                   RGVFAAHFRECVDA"
FT   gene            270816..271568
FT                   /locus_tag="Bcen2424_0233"
FT   CDS_pept        270816..271568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06987"
FT                   /protein_id="ABK06987.1"
FT                   /translation="MKVAIMQPYFLPYIGYFQLIGAVDRFVVYDNIKYTKKGWFNRNRF
FT                   LLNGSDALFSIPLKRDADSLDVRDREVSSDYDPVKLAAQLKGAYVRAPFFEQGFNLVSA
FT                   VIDADEPNLFKFIKRSIDVVVDRLGIATRIDVSSSIDVDPSLKGQSRVLAICESLGATT
FT                   YVNAIGGVDLYSHEDFAARGIDLRFLRSRPIEYGQFGAPFVPWLSIVDLLMFNSVAEVR
FT                   DMLTEYDLIQAVPANGVAMPDTVQQVSG"
FT   gene            complement(271676..272089)
FT                   /locus_tag="Bcen2424_0234"
FT   CDS_pept        complement(271676..272089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06988"
FT                   /protein_id="ABK06988.1"
FT                   /translation="MRTKLIVAALAAMVSLTCSAATSVVIDAKANCLSSFVGTVSGGTS
FT                   AKFRLARGQYAVSLVSNTMSCGGGSLDNGCNIDTVMMQGGYGYGSIRWGTAITAKPTVI
FT                   LMTSDLNDVFAYVSDDYCGDNVGQATLLIQPVN"
FT   sig_peptide     complement(272027..272089)
FT                   /locus_tag="Bcen2424_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.923 at
FT                   residue 21"
FT   gene            complement(272584..273405)
FT                   /locus_tag="Bcen2424_0235"
FT   CDS_pept        complement(272584..273405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06989"
FT                   /protein_id="ABK06989.1"
FT                   /translation="MKCMICDADGDYYFSKTYTERPFSDFMSSIGKVDYYKCRQCGFVW
FT                   SGTHQSLPAEKWSELNRQFHHYIENPANETKGNQPPYAEQAMMLALLGKNGVIRLDNMV
FT                   DYAAGYGTLSNVLAKYYDLELPIFDLYVKNDGSGRYIDPSNLGRYKTVINSAMFEHVLR
FT                   RSDLDFVHDMVDHDGALVIHTVVCERVPNDPEWFYLRPPVHTAFHTNRSMTILMEQWGY
FT                   RASLYCPQAKCWVLLRDECAHIGETVASINRELQTTWFHYKEGFVDYWKGF"
FT   gene            complement(273509..273973)
FT                   /locus_tag="Bcen2424_0236"
FT   CDS_pept        complement(273509..273973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0236"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_2871 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06990"
FT                   /protein_id="ABK06990.1"
FT                   /translation="MTSPATSGLARSSSCASSTIAFSAIRDLIEQEQVRNADFIRTALP
FT                   AYLDKLEARAEFVAEAVDGICHGFVAFYCNDYATRILYVTLILVAPTRRRTRLGERLLT
FT                   RTFELARARGFLRCRLEVHPDNPGARDFYARLGFKPIDARSDAIVLERTL"
FT   sig_peptide     complement(273902..273973)
FT                   /locus_tag="Bcen2424_0236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.927 at
FT                   residue 24"
FT   gene            complement(273970..275118)
FT                   /locus_tag="Bcen2424_0237"
FT   CDS_pept        complement(273970..275118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0237"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: bcn:Bcen_2870
FT                   DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06991"
FT                   /protein_id="ABK06991.1"
FT                   /translation="MTASLPASSVAQLPRDSIYVTQPYLPPLDEFIPYLQQIWDSRVLT
FT                   NGGPFHQQFERALCDYLDVPHLSLFANGTLALVTALQALRITGEVITTPYSFVATAHSL
FT                   LWNGIKPVFVDVDPDSLNLDPAKIEAAITPQTSAIMPVHCYGRPCDVEAIQKIADNYNL
FT                   RVIYDAAHAFGVHTPTGSLLRHGDLSILSFHATKVFNTFEGGAIICPDAKTKQRIDHLK
FT                   NFGFVDEVTVVAPGINGKMSEINAAFGLLQLQHVDAAIARRAHIDAMYREQLSGLRGLR
FT                   CIEHGDGVRHNYSYFPILVDDEYPVSRDALYSKLRAHEIYVRRYFYPLISEFPMYRGLP
FT                   SAHKSLLPAAAHASERVLCLPIYPALRDEDVERIVKIIKGHV"
FT   gene            complement(275143..277485)
FT                   /locus_tag="Bcen2424_0238"
FT   CDS_pept        complement(275143..277485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0238"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   bcn:Bcen_2869 tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06992"
FT                   /protein_id="ABK06992.1"
FT                   /translation="MFSTELPASAALTPEQQLAQDIALVMENALERQRSGAFDDARALY
FT                   EAILDAVPAHGDAHYNLAVLLADTGQAADAVPHFEAAIGASPDNGYYWVSYIHALHRSG
FT                   QTAAAWIAVEIAQQRGVHGPALDGLIAQLASPDVVLATAAVAPSGIDMAIVLETAAGHA
FT                   GKSDAGRPVRRPNQTLLQKHAALFDKNKHAEATALAQQLVADYPEDGACWRALSASLHR
FT                   EGRFAEMIEAGFRTIELLPDELLVRMLLADTLRMVNRLAEADEQCTRLLQLQPDHPEAF
FT                   RIRGLVLFALRRTDEAIAACRRAVELAPNAAAPCGTLGFVLLEQGATQEAIRWLKRSIE
FT                   INPTDSVTHSSMLFCITHSSDFDPQALIAEHRKFGERYGNHKRKRAAVFSNSRDPARKL
FT                   QVGFVSGDLFSHAVASYAVPVIEHLAADPGIAMHFYHNHFEEDHVSERFKAHATTWRTV
FT                   AGMSDTAFLERLRNDRIDIVIDLSGHTGRNRLVALAQRAAPVQASWIGYPATTGLAAMD
FT                   YFIADRFVAPHGEFDDQFVEQIVRLPAISSFMPPANCPPVNVLPALRNGYTTYGSFNRL
FT                   NKLSPHVIGVWARVLHADPTARMALGAIGNEGDQRVLIDWFAAAGIDASRLSFHRRSNI
FT                   PVYLQQHHGVDLCLDTFPYTGSTTTLNALWMGVPTLTIAGVTLAGRGSANWLMHVGLDT
FT                   YIAKNEDEFVAKALALGKDTASLQALRSGLRARCAESAAFRPEIVAAGLSSALRTMWAR
FT                   WCAGEPAIAFDTPLFDDTATAPATTEA"
FT   gene            complement(277747..278046)
FT                   /locus_tag="Bcen2424_0239"
FT   CDS_pept        complement(277747..278046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06993"
FT                   /protein_id="ABK06993.1"
FT                   /translation="MEQTELIAQIDAFTDAIEHAAAMADWAEAVRLVDARWSLVALLST
FT                   DQPPVGIAAIRRMQASNDRIFAGAQRAQQELTDEYQAAMSRVQAVGQYQSIANR"
FT   gene            complement(278072..279580)
FT                   /locus_tag="Bcen2424_0240"
FT   CDS_pept        complement(278072..279580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0240"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein; KEGG: bcn:Bcen_2867
FT                   flagellar hook-associated 2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06994"
FT                   /protein_id="ABK06994.1"
FT                   /translation="MSTINSAVTAANNSANSQLQQAAQSIISGSTGNSSMDVNSLVTAL
FT                   VNAKTAGQAAALNAQQSSDNTQISAYGALSAALSALQASLTTLSNGSLQNTFTATASGT
FT                   GLTATAGAGAVAGSYSVGVTQIATSQSLSSAAFGASTALGTGTMTLSLGSQSFSVDVNG
FT                   TNNTLSGIAAAINTATGNPGIVASVVNGSDGAHLVLSSTPTGAASTIGVALSNVAGDNG
FT                   LSSLGVTSTASTTGGQSTITSANSGAAWKQSTAAQDAAFTINGIAGTSASNTVTSAITG
FT                   VTLNLTSAAVSATQPQTLTVATDTKSQAAAINNFATLYNTLVTTMGSLSSFTSGASSQG
FT                   PLLGDSTLNTIKNALASIVASGVTSNGSTVNLASIGVTLQADGTLKVDSTALNGALQNN
FT                   PTGVASLFNSTNGIGEQLTTNITNYTKTNGLIAARTTALSNDLKNVAQQQTTLSNYAAQ
FT                   LTSQYQAQFTALNTLMATMNSNSQYLTQLFGGANSGGALANNKS"
FT   gene            complement(279713..280867)
FT                   /locus_tag="Bcen2424_0241"
FT   CDS_pept        complement(279713..280867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0241"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: bcn:Bcen_2866
FT                   flagellin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06995"
FT                   /protein_id="ABK06995.1"
FT                   /translation="MLGINSNINSLVAQQNLNGSQNALSQAITRLSSGKRINSAADDAA
FT                   GLAISTRMQTQINGLNQGVSNANDGVSMIQTASSALSSLTNSLQRIRQLAVQASTGTMS
FT                   TTDQAALQQEVSQQIQEVNRIASQTTYNGTNILDGSAGIVSFQVGANVGQTISLDLSQS
FT                   MSAAKIGGGLVQKGQTVGTVTGLSLDNNGAYTGSGATITAINVLSDGKGGYTFTDQNGG
FT                   AISQTVAQSVFGANATTGTGTAVGNLTLQSGATGAGTSAAQQTAITNAINQINAVNKPA
FT                   TVSNLDISTVSGANVAMVSIDNALQTVNNVQAALGAAQNRFTAIATSQQAESTDLSSAQ
FT                   SQITDANFAQETANMSKNQVLQQAGISVLAQANSLPQQVLKLLQ"
FT   gene            281398..281610
FT                   /locus_tag="Bcen2424_0242"
FT   CDS_pept        281398..281610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0242"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21; KEGG: bcn:Bcen_2865
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06996"
FT                   /protein_id="ABK06996.1"
FT                   /translation="MTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQSYEKPTAVR
FT                   KRKKAAAVKRLHKRLRSQMLPKKLH"
FT   gene            complement(281773..283896)
FT                   /locus_tag="Bcen2424_0243"
FT   CDS_pept        complement(281773..283896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0243"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: bcn:Bcen_2864 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06997"
FT                   /protein_id="ABK06997.1"
FT                   /translation="MTVSLARPPVRPRRVAAALACLAASLAHADDSSGDAAVLPALNIT
FT                   AAHDSPQHLTDTISTGALGTRRQLDTPFSTTIVTSEELEARQPYKLGDVFANDASVSDN
FT                   SGAYSAWASYMTVRGMQLDWQNGYKIDGLPFVTYGITMPYEQLERVELLKGLGGFLYGF
FT                   VTPGGVVNYVTKQPGAEPVRSVDVNYRSTNVWTEHVDLGQRFGPNDMFGARLNATHEEG
FT                   KTYNDGNIRRDSVSLALQANLTRDLSVSFGALYQDRRTTGQTPSIFTGSYPGGALPATI
FT                   SGGSTNLGGKDQYLNTNLQLYTAGLQYQLAPDWQLDVAYSYSKATRRRNESTLYLQDAA
FT                   GNYTDSRYVGMEDHRFSQWRAMVEGKVRTGPFSHQIVLGASWQKQANDYSANSVFVPLG
FT                   AGNLYAPNPYRYESPHGFIQYRTSEIVQKSLFASDTVQLTERWSVLAGVRYMNYEQRAF
FT                   QASGAEDPGYRQNGVVTPTFAVMFKLAPTTTAYASYAESLEPGSRVNDVYANAGQVLKP
FT                   LRSKQYELGIKSEHARWSATAALFRIERSAEYANAANVYVQDGESIIQGIEVGARAKFG
FT                   AHWNAGVDAMLLDAWYANGIGNNGNRVAGAPRFVLAGDLGYAVPGVPGLTLGVDAKFTG
FT                   ATPLRAAGGLDAPGFLVVNAGARYLTRVGRHDVTLRASIDNVLNRRYWEYQYADYVKPG
FT                   DPRTVSLSAKIDF"
FT   sig_peptide     complement(283807..283896)
FT                   /locus_tag="Bcen2424_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            284126..285364
FT                   /locus_tag="Bcen2424_0244"
FT   CDS_pept        284126..285364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0244"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bur:Bcep18194_A3346 uncharacterized iron-regulated
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06998"
FT                   /protein_id="ABK06998.1"
FT                   /translation="MNAFLRPFLVRLHRWFGLAIALFLFVAGLTGALIAWDHELDAALN
FT                   PDFYIARSGAAPLAPLELAARIEAADPRVQVTYLPLAVEPGHTLQAGVMPRTDPATGQP
FT                   YALGFSQIAVDPATGAVQGRREWGALSLARLDLMPFIYRLHYSLFLPVYGGINFGFWVM
FT                   GVVGIVWAIDSLIALVLAFPNLKSWRKSFAFRVRRGGYPLVFDLHRSGGVWVWGLLLVV
FT                   AVTSISMNLAVPVVRPLVSLMSPLAETPYTNPEHFPPAPAGSQVLPRERIVEIARSAGR
FT                   DAGITAPPGALLFAPPMNAYAVGFFTPGNDHGDVGLGNAWLYWNAVTGKPVAAQVPGRG
FT                   SAGDLFMQAQFPLHSGRIAGVAGRVAVSVLGIVIAMLSVTGVCIWVKKRSARGRAARST
FT                   RPVVPASSSRAAR"
FT   sig_peptide     284126..284233
FT                   /locus_tag="Bcen2424_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.647 at
FT                   residue 36"
FT   gene            complement(285694..286296)
FT                   /locus_tag="Bcen2424_0245"
FT   CDS_pept        complement(285694..286296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0245"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG: bcn:Bcen_2862
FT                   DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK06999"
FT                   /protein_id="ABK06999.1"
FT                   /translation="MSQRCNWVKTEADAHYHDTEWGVPSHDDRHLFEMLILEGAQAGLS
FT                   WSTILNKRAGYREAFADFDVDAVARFTPKRIEKLLENPGIVRNRAKVESAVTNARAVQR
FT                   IREEHGSLAAFLWSFVGDTPVQNAWQSYRDAPASTEQSDALSKALKAYGCKFVGSTICY
FT                   ALMQATGMVNDHEAGCPCHAQCAALGGKQPARRRKAG"
FT   gene            286439..287320
FT                   /locus_tag="Bcen2424_0246"
FT   CDS_pept        286439..287320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0246"
FT                   /product="ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase, BadF/BadG/BcrA/BcrD type; KEGG:
FT                   bcn:Bcen_2861 ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07000"
FT                   /protein_id="ABK07000.1"
FT                   /translation="MAALLFAIGIDGGGTGTRAVLADRHGRELAQGRGGPSGLGLGIER
FT                   AWASIGAACADAFTQAGLAFDWSQCALGCGLAGVNNAAWLAAFRAQAPLGALAIESDAY
FT                   TTAVGAHGGAPGLIVALGTGSIAAALDAAGACRIAGGFGFPSGDEASGAWLGVRALAYA
FT                   QQALDGRVPRDAFATALLAETGAQDRDALVQWSCDANQTIYARLAPIVFAHRTHPVARA
FT                   LIAQAGDEIGKMIDALDPQQALPVALCGGLADALAPAVPARHAARLRAPLDDSAHGALR
FT                   LALQALRAAEAG"
FT   gene            287465..288289
FT                   /locus_tag="Bcen2424_0247"
FT   CDS_pept        287465..288289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0247"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase, type 3; KEGG: bcn:Bcen_2860 Cof protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07001"
FT                   /protein_id="ABK07001.1"
FT                   /translation="MYKVIATDLDGTLLNSDHQLDPYTIDTVRRLDRDGVQFVIATGRH
FT                   YADVAGIRDVLGIRPYLITSNGARVHAPDDTKIHAQDIDAAIVRSLVQPAVVGAHGRVI
FT                   VNLFTNDGWLIDRDAPHLLEFHQDSGFRYDVIDMAAHDGADIAKVLYIGEPADLAVVAE
FT                   QMRVQFGDALYVTYSLPDCLEVMTANVSKGRALRAVLARLGVDAGHCIAFGDNMNDIDL
FT                   LETAGHAFMMNNANPDLIARLPHVPRIGNNFDAGVARHLRTLFSLEDDVVAS"
FT   gene            complement(288421..289164)
FT                   /locus_tag="Bcen2424_0248"
FT   CDS_pept        complement(288421..289164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0248"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel proteins; PFAM: major
FT                   intrinsic protein; KEGG: bcn:Bcen_2859 MIP family channel
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07002"
FT                   /protein_id="ABK07002.1"
FT                   /translation="MNLSQRLAAEVFGTFWLVLGGCGSAVLAAAFPGLGIGFAGVALAF
FT                   GLTVLTMAFAIGHISGCHLNPAVSVGLTVAGRFPARDLAPYIVAQVVGATLGAFVLYLI
FT                   ATGKPGFDVVGSGFATNGFGDRSPGHYSLTASFICEVVMTGFFLFVILGATDKRGVPAG
FT                   FAPIAIGLCLTLIHLISIPVTNTSVNPARSTGPALFVGGDAIGQLWLFWVAPLIGAVLA
FT                   GIIYPLVAGRDDAVDLLPASARTSE"
FT   sig_peptide     complement(289030..289164)
FT                   /locus_tag="Bcen2424_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.504 at
FT                   residue 45"
FT   gene            289464..289760
FT                   /locus_tag="Bcen2424_0249"
FT   CDS_pept        289464..289760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0249"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bcn:Bcen_2858 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07003"
FT                   /protein_id="ABK07003.1"
FT                   /translation="MSQYAKLKAQIADLQAQADDVRRQEVAAVIADVQRMIAEYGLTAQ
FT                   DLGFAERARRGRPPKKAPLPPKYRDPKSGATWSGRGKPPNWIVGKNRDRFLIE"
FT   gene            complement(289872..290936)
FT                   /locus_tag="Bcen2424_0250"
FT   CDS_pept        complement(289872..290936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0250"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bcn:Bcen_2857 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07004"
FT                   /protein_id="ABK07004.1"
FT                   /translation="MRIAQIAPLYEAVPPKLYGGTERVVSYLTEALVELGHDVTLFASG
FT                   DSVTSARLEAAWPRALRLDPSVRDSMAPHMRLLEQVARVAHEFDVLHFHLDYLPFPLMS
FT                   RLDTPYVTTLHGRLDLPELQPVFDAFPDSPVVSISNNQRKPLPQAAWAGTVYHGLPDTL
FT                   LTPQPDVKPEYLAFLGRICPEKRVDTAIRIAAQSGLPLKIAAKVDKADADYFKEVIEPL
FT                   LGQAHVEFIGEINEAQKPAFLSGAKALLFPIDWPEPFGLVMIEAMACGTPVVAFNRGSV
FT                   PEVIEDGVTGFIVEDVQGAVGALHRIDSLSRTAIRERFDTRFSSKAMAQRYVETYESLC
FT                   AATKQPALRRVAGA"
FT   gene            291598..291918
FT                   /locus_tag="Bcen2424_0251"
FT   CDS_pept        291598..291918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0251"
FT                   /product="Flagellar transcriptional activator, FlhD
FT                   subunit"
FT                   /note="PFAM: flagellar transcriptional activator; KEGG:
FT                   bur:Bcep18194_A3353 flagellar transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07005"
FT                   /protein_id="ABK07005.1"
FT                   /translation="MSATSEMLSEIKEVNLSYLLLAQRLLREDKAMGMFRMGISQELAD
FT                   VLANLTLAQTVKLAASNQMLCRFRFDDHALLSSLADKGRSDVVAHAHSAILMAGQQVEG
FT                   VR"
FT   gene            292011..292565
FT                   /locus_tag="Bcen2424_0252"
FT   CDS_pept        292011..292565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0252"
FT                   /product="Flagellar transcriptional activator, FlhC
FT                   subunit"
FT                   /note="PFAM: flagellar transcriptional activator FlhC;
FT                   KEGG: bcn:Bcen_2855 flagellar transcriptional activator,
FT                   FlhC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07006"
FT                   /protein_id="ABK07006.1"
FT                   /translation="MASKSVVIEVKEITLAIELIELGARLQLLEAETSLSRDRLIKLYK
FT                   ELKGVSPPKGMLPFSTDWFMTWLPNIHSSLFYNIYRFMQDHGRCDTIQSIVKAYRLYLE
FT                   HVNLSGDEAALSLTRAWTLVRFFDSGMLQMTPCTRCGGHFVAHAHDPHQGFVCGLCQPP
FT                   SRAGKTRKAAAARAELAAAVA"
FT   gene            292758..293618
FT                   /locus_tag="Bcen2424_0253"
FT   CDS_pept        292758..293618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0253"
FT                   /product="flagellar motor component-like protein"
FT                   /note="KEGG: bcn:Bcen_2854 flagellar motor component-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07007"
FT                   /protein_id="ABK07007.1"
FT                   /translation="MLIIVGTLVTLLSVFGGYALAGGHLGALIQPVEILMIVGAGVGAF
FT                   ILGNGGKTIKATLRVLPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDP
FT                   EKSPIFTQYPKILADRHIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHTEGEGPAH
FT                   ALMRVGDAMPAFGIVAAVMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGP
FT                   LASLAEQRVAESTKMFQCIKVTILATLNGYAPAIAVEFGRKVLFSTERPSFSELEEHVR
FT                   RVKAK"
FT   sig_peptide     292758..292823
FT                   /locus_tag="Bcen2424_0253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.970 at
FT                   residue 22"
FT   gene            293632..294651
FT                   /locus_tag="Bcen2424_0254"
FT   CDS_pept        293632..294651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0254"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bcn:Bcen_2853
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07008"
FT                   /protein_id="ABK07008.1"
FT                   /translation="MSKSKDRAIVVKRVAPAKKGHHGGAWKLAYADFMTAMMAFFLLMW
FT                   LLSSVTPVQLKGIAEYFNMPLKAAILGSGDRSSQESSIINGGGRDLSSVDAGTLRRTDG
FT                   TTSLAERLAKAGDDNSRSQAQGAQDRLEQTRLHDLQIKLMAAIEANPTLRQFKQQIRID
FT                   STLMGLRIEIVDSQKRPMFAMSSDHVEPYMRDILREIGKTLNDVPNRIIVQGHTDAVPY
FT                   AGGEGGYSNWELSADRANASRRELISGGMDEAKVLRVLGLASTQNLNKADPLDPENRRI
FT                   SVIVLNRKSEEALMRDDATTTTLSADAAGSKLLAQQLGGPTPAVRPVVASAVAVAPKP"
FT   gene            294668..295045
FT                   /locus_tag="Bcen2424_0255"
FT   CDS_pept        294668..295045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0255"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bcn:Bcen_2852 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07009"
FT                   /protein_id="ABK07009.1"
FT                   /translation="MIRTILAIDDSATMRALLQATLAQAGYDVTVAPDGEAGFDMAATA
FT                   PYDLVLTDQNMPRKSGLEVIAALRKLTAYADTPILVLTTEGSDAFKDAARDAGATGWIE
FT                   KPIDPGVLVELVATLSEPAAS"
FT   gene            295079..297349
FT                   /locus_tag="Bcen2424_0256"
FT   CDS_pept        295079..297349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0256"
FT                   /product="CheA signal transduction histidine kinases"
FT                   /note="PFAM: CheW domain protein; ATP-binding region,
FT                   ATPase domain protein domain protein; Signal transducing
FT                   histidine kinase, homodimeric; Hpt domain protein; KEGG:
FT                   bcn:Bcen_2851 CheA signal transduction histidine kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07010"
FT                   /protein_id="ABK07010.1"
FT                   /translation="MTLDITQFYQTFFDEADELLAQMEQLLLNLDVDAPDPEDLAAIFR
FT                   AAHSIKGGAATFGFSALTDTTHILESLLDRARNHELTLTKEMIDAFLETKDVLSDQLVD
FT                   YRASAEPDAAAAATICAKLERLKAESGAGAPAAAAEPAPAAPVAPVAAVAPAVVEPAAA
FT                   GDRAPDHVVEQAVAAAHPAADADAGGPHLKITLVGVDAKDRELLTEELGNLGRIVGREE
FT                   TGADLSLWVESDVPSDDIVAVCCFVIDESQIRVAHGTAPAAQAAPAAAQGAAAEAAEPA
FT                   AVAQPARVEVFAPPPAAPQPAAPAPAPAEPAAAAAQQPQPQPHAQPQPAEHATPAAAAH
FT                   HDDKRARPAAAAAAGAEGSSIRVGVEKVDQLINLVGELVITQAMLAETATAFDPALHDR
FT                   LFNGMAQLERNARDLQEAVMSIRMMPMDYVFSRFPRLVRDLAGKLGKQVELVTFGQATE
FT                   LDKSLIERIIDPLTHLVRNSLDHGIETVDKRVAAGKDAVGQLVLSAAHHGGNIVIEVSD
FT                   DGAGLNRERILAKAAKQGMQISENISDDEVWQLIFAPGFSTAETVTDVSGRGVGMDVVK
FT                   RNIQSMGGHVEISSQAGRGTTTRIVLPLTLAILDGMSVKVGSEIFILPLNFVMESLQPS
FT                   NDDIYTVGNGERVVRVRGEYLPLVALHEVFSVEDARTDPTQGIVTIMETEGRRFAMLID
FT                   ELVGQQQVVVKNLETNYRKVHGISAATILGDGSVALIVDVAALNRETRATHGARAGAEL
FT                   AVF"
FT   gene            297380..297913
FT                   /locus_tag="Bcen2424_0257"
FT   CDS_pept        297380..297913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0257"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bcn:Bcen_2850 CheW
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07011"
FT                   /protein_id="ABK07011.1"
FT                   /translation="MSAEVQMINPAAANAATSRRDAAHGDATGQEFLVFTLGDEEYGID
FT                   ILKVQEIRGYDSVTRIANAPEFIKGVINLRGIIVPIVDMRIKFHLGRVEYDHQTVVIIL
FT                   NVSNRVVGMVVDGVSDVLTLQTDQIMPAPEFGATLTTEYLTGLGTVDGRMLILMDIEKL
FT                   MSSREMALIETLGG"
FT   gene            297951..299930
FT                   /locus_tag="Bcen2424_0258"
FT   CDS_pept        297951..299930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0258"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bcn:Bcen_2849
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07012"
FT                   /protein_id="ABK07012.1"
FT                   /translation="MLHNWSIRTTLTAVGLILVCLAAAVGGLGLYALNHASRSLDEIAH
FT                   VDLPAIHTLDDTAAYLLRSRVALDRFRTLTEAGNAADAAKVLDRAQELYAKSNQNWQTF
FT                   QSTPKLGVEQALVDELTARYATIMKEGVEPEFAAARAGDMAAYHAIADAKISPMFVAFD
FT                   QTAAAVIAALQKRAEERQAATQSQISMMIALIAAGIALAFVVVIAIRFVLRGLIVQPIE
FT                   DAIAHFERIAGGDLTQPVSVFSTNEIGRLFGGIKRMQDAVTTMVQAVHRGTESIDVGAR
FT                   EIASGNIDLSQRTEEQAASLQETASSMEQLTGTVRQNAENARQASQLAVNASDIATQGG
FT                   DVVGQVVSTMQDIAASSGKVVDIIGTIEGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRSLAQRSASAAKEIKQLIGDSAEKVDSGSALVARAGATMDEIVQAVRRVTDIMGEI
FT                   SAASDEQSTGIEQVNRAVGQMDAVTQQNAALVEQAAAAAASLEEQTRQMKAIVSGWRVA
FT                   GGIALAPTRGVARPVAHEPAALPSDVRHDAPVAALPAPAAAQPAARRGAPASRAAAPAT
FT                   AGAGAAAAAAEPKRAADAAARTQKDAPAARGGTAAGGYGPRLAKTAAAADKPAAKPALV
FT                   RPALNGEKPALAAAGASDDDWETF"
FT   sig_peptide     297951..298025
FT                   /locus_tag="Bcen2424_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.279 at
FT                   residue 25"
FT   gene            299934..300926
FT                   /locus_tag="Bcen2424_0259"
FT   CDS_pept        299934..300926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0259"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /note="PFAM: MCP methyltransferase, CheR-type; KEGG:
FT                   bcn:Bcen_2848 MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07013"
FT                   /protein_id="ABK07013.1"
FT                   /translation="MSHARAPFRPDVPDASPRAGEPGRDFAFTGADFARIRALIHQRAG
FT                   ISLSEHKRDMAYSRLARRLRARGLDTFRDYLDLLEQEDDPLEWEAFTNALTTNLTAFFR
FT                   ESHHFPILSEFVKSRPAPVSVWCSAASTGEEPYSIAITLIEALGDTAARNASILATDLD
FT                   TQVLAKAEAGIYTYDQVKHLSPERLKRFFLKGTGAQAGRVKVRPELRAMIRFEQLNLTD
FT                   ADYGIAKPFDAIFCRNVMIYFDKPTQGQVLSRFEPLVKPGGLLFAGHSENFTYVTQAFR
FT                   LRGQTVYELTRDAAQGARPRGAPTSAAAAMPAAGRVRAAGGAPAYGERG"
FT   gene            300983..301666
FT                   /locus_tag="Bcen2424_0260"
FT   CDS_pept        300983..301666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0260"
FT                   /product="CheD"
FT                   /note="PFAM: CheD family protein; KEGG: bcn:Bcen_2847 CheD,
FT                   stimulates methylation of MCP proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07014"
FT                   /protein_id="ABK07014.1"
FT                   /translation="MKLLPNEFYTTAEDMVLMTVLGSCVAACLHDPYAGIGGMNHFMLP
FT                   DDGADPGAAASESMRYGAYAMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTTINIGD
FT                   RNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHSGRAMVKKLRLQVPGVTEREAALA
FT                   READRLRAARTRAQVELFAAKRPAAPQPARPRIELFGGRGTAPGAGSPSAGSPYAANLS
FT                   RKQEA"
FT   gene            301672..302754
FT                   /locus_tag="Bcen2424_0261"
FT   CDS_pept        301672..302754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0261"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: bcn:Bcen_2846 response regulator receiver
FT                   modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07015"
FT                   /protein_id="ABK07015.1"
FT                   /translation="MQKIKVLCVDDSALIRSLMTEIINSQPDMTVVATAPDPLVARELI
FT                   KQHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDF
FT                   VTKPRVGIRDGMLDYAEKLADKIRAASRARVRQAPQPQAAARSADSAAAAPMINNPLVS
FT                   TEKLIIIGASTGGTEAIREVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRIAVKE
FT                   AEHGERVLPGHAYIAPGHAHLLLARSGANYIAQLSDEPPVNRHRPSVDVLFRSAATHAG
FT                   KNAIGVILTGMGRDGAAGLLEMKRAGAHTFAQDEASCIVFGMPREAIALGGADEVAPLA
FT                   DMSRRVMARLATMGDRVQRV"
FT   gene            302822..303217
FT                   /locus_tag="Bcen2424_0262"
FT   CDS_pept        302822..303217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0262"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bcn:Bcen_2845 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07016"
FT                   /protein_id="ABK07016.1"
FT                   /translation="MDKSMKILVVDDFPTMRRIVRNLLKELGYTNVDEAEDGAAGLARL
FT                   RGGGFDFVISDWNMPNLDGLAMLKEIRADATLTHLPVLMVTAESKKENIIAAAQAGASG
FT                   YVVKPFTAATLDEKLNKIIDKMAKAGS"
FT   gene            303220..303951
FT                   /locus_tag="Bcen2424_0263"
FT   CDS_pept        303220..303951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0263"
FT                   /product="chemotaxis phosphatase, CheZ"
FT                   /note="PFAM: Chemotaxis phosphatase, CheZ; KEGG:
FT                   bcn:Bcen_2844 chemotaxis phosphatase, CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07017"
FT                   /protein_id="ABK07017.1"
FT                   /translation="MNEPIHAALAGAAINADGHAEGADYASDRILARIGHVTRTLRDSM
FT                   RELGLDKHVERAAEAVPDARDRLRYVATMTEQAAERVLNAIEIAKPVQERIQNEAEALD
FT                   ARWAQWYAAPIEHAEVRELMDDTRTFLRTLPESTSATRAQLLEIMLAQDFQDLTGQVIK
FT                   KIMDMVYLIEQQLLTVLVENIAPERREQFAATAAALAAEQMSATGSPESLLNGPQIAPE
FT                   GKSDVVQDQGQVDDLLASLGF"
FT   gene            304225..304728
FT                   /locus_tag="Bcen2424_0264"
FT   CDS_pept        304225..304728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07018"
FT                   /protein_id="ABK07018.1"
FT                   /translation="MKLKRLGWTVAHATAAMGVLWAVHAHAELGGAPMSPPADDQAATV
FT                   RALQRAMRSADGAQASTAAYTVREITLGSGTVIHEYTSAAGSVFGLAWRGPTMPDLASL
FT                   LGSYFPQYTAGVQAAHRARGWRAPVAVETSGLVIRTGGHMGAFSGQAWLPSALPAGVAG
FT                   TDIQ"
FT   sig_peptide     304225..304308
FT                   /locus_tag="Bcen2424_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.851 at
FT                   residue 28"
FT   gene            304745..305995
FT                   /locus_tag="Bcen2424_0265"
FT   CDS_pept        304745..305995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07019"
FT                   /protein_id="ABK07019.1"
FT                   /translation="MSIPRTFKRWLGVLGLLAATAVLVTACGGGDGGGGSGNGGNAGNT
FT                   GGNGSGGSDGNSGNTAVVTVGAGAANVINIPTISLKICVPGTSNCQIVNNVLVDTASYG
FT                   LRLVGSAVAGVHDSLPQVTSGGAPVAECGKFVSSYTWGSVRTVDLSIGTEQASSLPVQI
FT                   IGDLGTTNVPSSCTNGGASANSTGALGANGILGIGPAPYDCGTTCATSTSTSNNYYACP
FT                   NGDNARCTVALVPLAQQVANPVHRFANNDGVSVQMPAISDNGQASATGTLTFGLPNLDG
FT                   KTVMRSTTTGDVSATFQGRSVTAFFDTGSNAYFFNDSTSTSQPCTRNTEFYCPSATTTY
FT                   SATLSGQNGASGTVSMPVANADALFSNSSTFAFNDIAGPFGSSSWLDIGMPHFYGKTIY
FT                   FGMDKTASGGPQPFVAF"
FT   sig_peptide     304745..304825
FT                   /locus_tag="Bcen2424_0265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.895 at
FT                   residue 27"
FT   gene            306158..306655
FT                   /locus_tag="Bcen2424_0266"
FT   CDS_pept        306158..306655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0266"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: 3-demethylubiquinone-9 3-methyltransferase;
FT                   KEGG: bcn:Bcen_2841 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07020"
FT                   /protein_id="ABK07020.1"
FT                   /translation="MNPRIQRITPFLWFDRDAEAAAGFYVSVFDNARIVHVARYGKAGA
FT                   HASGNAEGAVMTVAFELDGQAFVALNGGPVFQMTPAVSFVVNCRDQAEIDHYWARLSEG
FT                   GDERAQQCGWLRDRFGVSWQVVPVQMAELMTGDPARAERVMAQVMTMKKLDLGALQRAA
FT                   AG"
FT   gene            307052..308251
FT                   /locus_tag="Bcen2424_0267"
FT   CDS_pept        307052..308251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0267"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: bcn:Bcen_2840 flagellar
FT                   biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07021"
FT                   /protein_id="ABK07021.1"
FT                   /translation="MADESDLDKTEAATPRRREKAREEGQVARSRELASFALLAAGFYG
FT                   AWLLAGPSGAHLQAMLRGAFTFDRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAA
FT                   LLAPMALGGWLISQKTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIA
FT                   IWRSKDELLGLATQPLGAALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRM
FT                   TKEEVKREHRENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTD
FT                   GEMRAPKVVAKGVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAV
FT                   AEVLAWVYQLKRFRSEGGAFPAMPVDLDVPAELDKGTSVAADDEREEAEDTLGKQGNAA
FT                   "
FT   gene            308248..310350
FT                   /locus_tag="Bcen2424_0268"
FT   CDS_pept        308248..310350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0268"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: bcn:Bcen_2839
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07022"
FT                   /protein_id="ABK07022.1"
FT                   /translation="MSTPTTGLFAKRPNVLAGTNLRALAGPILICMILGMMILPLPPML
FT                   LDLLFTFNIALSVMVLLVSMYTMKPLDFAAFPSVLLFSTLLRLSLNVASTRVVLLEGHT
FT                   GPDAAGQVIEAFGHFLVGGNFAVGIVVFVILMIINFMVITKGAGRIAEVSARFTLDAMP
FT                   GKQMAIDADLNAGLINEEQARKRRLAVSQEAEFYGSMDGASKFVRGDAIAGLIIMAINV
FT                   IGGLIVGMVQHDMSFAAAGTNYTLLTIGDGLVAQIPSLVISTAAGVIVSRVATDEDIGT
FT                   QITGQLFTNPRVLNITGAIIVLMGLIPGMPHFAFLALGGGAIWLARTQTKRAAARKAAG
FT                   DVTDIAPPAVLPADSHEATWDDVQLIDPLGLEVGYRLIPLVDKNSDGELLKRIKSIRKK
FT                   FAQEIGFLPPVIHIRDNLELRPNAYRIALKGVEIGAGEVFPGQWLAINPGQVTAALPGA
FT                   VTQDPAFGLPAVWIDVALREQAQVYGYTVVDASTVVATHLNHLVVQHAAELLGRQEVQA
FT                   LVERTGKDAPSLVEDLVPKTISLTTLQKVLQNLLEEGVPIRDMRTILEAVSEHAGRGDA
FT                   FEITAAVRLSLGRAITQQWYPGNGEMQVMGLDANLERVLSQALATGANPGLEPGLAHNL
FT                   LTGTQQAMLRQQNLGLPPVLLVQHALRAMLARFLRRSLPQLKVLSYAEVPDTRTIKVVN
FT                   VIGGSA"
FT   gene            310347..312125
FT                   /locus_tag="Bcen2424_0269"
FT   CDS_pept        310347..312125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0269"
FT                   /product="GTP-binding signal recognition particle SRP54,
FT                   G-domain protein"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54,
FT                   G- domain; SMART: AAA ATPase; KEGG: bcn:Bcen_2838
FT                   GTP-binding signal recognition particle SRP54, G-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07023"
FT                   /protein_id="ABK07023.1"
FT                   /translation="MNIRKFTGATSRDALRLVREALGADAVVLSNRTLDDGSVEIVALA
FT                   DSDLAAVAPPAARPRVAPSRVPESVPAAAVPGIVSRPGIAPRPAVNPYAAGEGGLPDVF
FT                   SSVFGASADAQEADAHRSSIEADAPAAAAPSIAAPTAGSPAAGWPAPGSPAATSEPAPW
FT                   LVEHAKRLTQQRDALIARAQAPAEPQASAPQPAAGATPPDWARDIVRDAERRMPPAGAP
FT                   AAARRAPDTGAAYAAKTAERTRLSSDAAAAVADAVKSRIERIVNDTVMQELGELRGMMQ
FT                   EQFDSLMWHDRQRRSAVHGALTKHLFAAGFSAQLVRMLVDNLPSGDDAQTFEQAAEWAQ
FT                   SVLASNLPVLDSEDALMERGGVFALMGPTGVGKTTTTAKLAARCVMRFGASKVALLTTD
FT                   SYRIGGHEQLRIFGKILGVPVHAVKDAGDLALALSELRNKHIVLIDTIGMSQRDRAVSD
FT                   QIAMLHGANAPVQRLLLLNATSHGDTLNEVVQAYRSAGEHPDLAGCILTKLDEATHLGG
FT                   VLDTVIRYKLPVHYVSTGQKVPENLYVASTKFLLKSAFCVPRDGSPFVPQDEDMPTLLS
FT                   ALTARSTAELHEVRFG"
FT   gene            312118..312936
FT                   /locus_tag="Bcen2424_0270"
FT   CDS_pept        312118..312936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0270"
FT                   /product="flagellar biosynthesis protein, FlhG"
FT                   /note="KEGG: bcn:Bcen_2837 flagellar biosynthesis protein,
FT                   FlhG"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07024"
FT                   /protein_id="ABK07024.1"
FT                   /translation="MDKRIIDQAEGLRRLLAGRASRIVAVTGGPAGVGCTSTVVNLAAA
FT                   LASLGKDVLVVDERADVHSASATLAGAWLRDGERTRVAAGFGLCGAARLARAGYSDAQL
FT                   SDFIDGPADIVLVDAQLGADGSFSALAREAHDVLVVTRVAAQAITEAYACMKRLHFAHA
FT                   FAQFRVLTNQVGSHADAKTAFDNLAGVASRYLTVSIADAGCVSADPLVEHARELMHAVV
FT                   DAFPSSPAARDYRQIAADLLYWPMRPRSGAGRAVHAGGKPSYEAGAAHAA"
FT   gene            312962..313693
FT                   /locus_tag="Bcen2424_0271"
FT   CDS_pept        312962..313693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0271"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2; KEGG: bcn:Bcen_2836 RNA
FT                   polymerase, sigma 28 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07025"
FT                   /protein_id="ABK07025.1"
FT                   /translation="MYNAQGKMSQADVLAQYAPLVRRLGLQLVAKMPASVDLDDLIQAG
FT                   MIGLMDAAGRYKEDQGAQFETYATQRIRGAMLDELRSNDWLPRSLRKTSREVEHAVHQV
FT                   EQHLGRSASETEIAQHLNMPLDEYQGMLQDLHGSQLIYYEDFDRAADDEPFLDRYRVDH
FT                   ADPLSALLDDHLREALVEAIERLPEREKLLMSLYYERGLNLREIGAVLEVSESRVCQLH
FT                   SQAVARLRARLREQAWVGAES"
FT   gene            313959..315377
FT                   /locus_tag="Bcen2424_0272"
FT   CDS_pept        313959..315377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0272"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: bcn:Bcen_2835 adenosylhomocysteinase; TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07026"
FT                   /protein_id="ABK07026.1"
FT                   /translation="MNAIIDSKASHDYVVADMALAGWGRKELNIAETEMPGLVQIRDEY
FT                   KAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTP
FT                   VFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEKDRSVIAKPT
FT                   NEEEVALYKSIAAHLDVDANWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNV
FT                   NDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVVAGYGDVGKGCAQSLRGLGATV
FT                   WVTEIDPICALQAAMEGYRVVTMEYAADRADIFVTATGNYHVINHDHMKAMRHNAIVCN
FT                   IGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHPSFVMS
FT                   NSFANQTLAQIELFTRGEQYENKVYVLPKHLDEKVARLHLARIGANLSVLSDEQASYIG
FT                   VQKDGPFKPNHYRY"
FT   gene            315477..315830
FT                   /locus_tag="Bcen2424_0273"
FT   CDS_pept        315477..315830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0273"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   bcn:Bcen_2834 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07027"
FT                   /protein_id="ABK07027.1"
FT                   /translation="MSVILTWVINALALLIITYLVPSIHIKSFGTALIIAVVLGLINTV
FT                   IRPVLILLTLPVTIVTLGVFILVVNALCFWFASSLLKGFEVSGFWSAFFGSILYSIVSW
FT                   LLSALIFGQRDIG"
FT   gene            315865..316695
FT                   /locus_tag="Bcen2424_0274"
FT   CDS_pept        315865..316695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0274"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   bcn:Bcen_2833 5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07028"
FT                   /protein_id="ABK07028.1"
FT                   /translation="MKPIELSFEFFPPKTADGVEKLRATRAQLLPLKPKFVSVTFGAGG
FT                   STQQGTLDTVLDMQKDGLEAAPHLSCIGSSRDSLRAILDQYRSHGIRHIVALRGDLPSG
FT                   MGEVGELRYASELVSFIRAEHGDWFHIEVAGYPEYHPQSRSPKADLENFARKVKAGANS
FT                   AITQYFFNADAYFRFVDDARKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWVARR
FT                   LESFGDDRESIRAFGADVVTNLCQRLIDAGVPGLHFYTLNLATATRTICERLAV"
FT   gene            complement(316801..318279)
FT                   /locus_tag="Bcen2424_0275"
FT   CDS_pept        complement(316801..318279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0275"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bcn:Bcen_2832 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07029"
FT                   /protein_id="ABK07029.1"
FT                   /translation="MHSDYLAHDAIGLAALVRDRQASPRELLDAAIGQAEAVNGAINAI
FT                   VLQDYEAARERAAGAPEPGAATPFAGVPYLVKDLGAAVAGLPLSMGSRHYRYFVPADDS
FT                   PVIARSRAAGLNVFGKTNTSEIGQMPYTEPALFGACRNPWNLDHTPGGSSGGAAAVVAA
FT                   GIVPLAHASDGGGSIRIPASCCGLFGLKPSRNPVLVDLPSNGELVVQHAVSRSVRDSAL
FT                   LLDVTTGQTLPPGAPGTFLGALDTPPGPLRIGLVVDPMLAPALADDTRAALDDAAALLE
FT                   SLGHHVEPATLQIDYARAAETFLTLWATIAEEMVLGARELTGRTPRRSEFEAATWAMAV
FT                   VGRRLARTRLPDVLEWQRQLTVQVAGLVSRYDAILCASLAGPPVKIGELQPTPFESAQM
FT                   KLVAALPVKPLLKEMLAKSSEKAFAWAGCTELFNLTGQPAMSVPLYWNARGLPIGVQFA
FT                   ARHADEALLLRLARQLEQARPWFDRRPPLMQAQR"
FT   gene            complement(318361..319053)
FT                   /locus_tag="Bcen2424_0276"
FT   CDS_pept        complement(318361..319053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0276"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: bcn:Bcen_2831
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07030"
FT                   /protein_id="ABK07030.1"
FT                   /translation="MTAQWIDIPTGNDSFGGYLALPKRGKGPAVIIIQEIFGVNAHIRA
FT                   VADQYAADGFVALAPDVFWRTQPRVELTYEGADRDKGIELMKKTDVGLAVADIGAAADA
FT                   LRARPEVAGKLAAIGYCFGGQLAYRAAATGKLDAAVSYYGGGIQNALDLAGQVTQPILF
FT                   HYAENDHGIPLTAVDQVKAAFAGHGDASFHVYPGAEHGFNCTDRASYNQRAAALAHGRT
FT                   LTFLAEHL"
FT   gene            319276..320358
FT                   /locus_tag="Bcen2424_0277"
FT   CDS_pept        319276..320358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0277"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   bcn:Bcen_2830 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07031"
FT                   /protein_id="ABK07031.1"
FT                   /translation="MSARSFSTPFSERFGLRLPLVQAPMVGATTTAMAAAASNAGALGS
FT                   FGAGALAPERIEAEVAAIRAATDRPFAINLFVLPDDAAPDAATVARALAAIDPLNAALG
FT                   LPPGTAPARYAPDFRAQLDALVALRVPVASFTFGVLDAADVARLKAAGTYVIGTATHVA
FT                   EGLAWQAAGADAISAQGAEAGGHRGTFIGAAEDALIGTFALVPQLVDATGLPVLAAGGI
FT                   MDGRGIAAALALGAQGAQLGTAFLTCAESAIAADWKARLLASADTSTQVTRAITGRHAR
FT                   GLRNTLMARLGEHVADVPPYPVQNALTQPLRQAAARANDGDYLSLWAGQGAPLARRRGD
FT                   ALTTSQLVAALDAEWRASAA"
FT   sig_peptide     319276..319380
FT                   /locus_tag="Bcen2424_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.407 at
FT                   residue 35"
FT   gene            320762..321937
FT                   /locus_tag="Bcen2424_0278"
FT   CDS_pept        320762..321937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0278"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bcn:Bcen_2829 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07032"
FT                   /protein_id="ABK07032.1"
FT                   /translation="MAFFGTELETYMNIKMQKLLPITAAAMLCAAAASNASADQVVKIG
FT                   HVAPLTGGIAHLGKDNENGARLAVEEINAKGLTIGGQKITLQLDPQDDAADPRQATQVA
FT                   QKLVDDKVVAVVGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATD
FT                   AQQGPALANYAHSKGIKSVAVVDDSTAYGQGLANEFEKKAKALGLKVMSHDATNDKAVD
FT                   FRAILTKIKGENPDAIMYGGMDATGGPFAKQAKQLGLRAKIFAGDGVCTEKLADLAGDA
FT                   TDNIVCSEAGASLEKMPGGNAFKAKYEKRFGQPIQIYAPFTYDAVYIIADAMKRANSTD
FT                   PDKILAAMPATKYTGVIGTTTFDSKGDLQHGVISLYNYKSGKKSLLDEVKM"
FT   sig_peptide     320762..320878
FT                   /locus_tag="Bcen2424_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 39"
FT   gene            complement(322037..323254)
FT                   /locus_tag="Bcen2424_0279"
FT   CDS_pept        complement(322037..323254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0279"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_A3382 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07033"
FT                   /protein_id="ABK07033.1"
FT                   /translation="MSQSSSPESSSPFAAPPDAHRVLPLPARQRARTASMALFFVAGMM
FT                   YASWGVHVPTVRDKFALSPGLLSIALFAVAGGSIVAMLSIARWIARVGSRTACLAGGLV
FT                   MSACAALILVVPDYWMLLAVLALFGFSMATLDVAMNAEASAVEIALGKPIMSSLHGMFS
FT                   IGGMAGAAAGGALLSAGMAPAAHLALAAAVGAAVLVAASPAVLPHVPHHEQAHGGGNRW
FT                   RSPALWMLGGIALIALIAEGAMYDWATVYMRDVVAASPALASAAYAAFSGGMAIARFAG
FT                   DAVRARFGAPQLVFASASLACAGMIGALLLPYPAAVLTGFTLMGLGLANMMPVLFAAAA
FT                   RVKGIHAAEGLAHVAGLAYFGLLFGPVAIGAVAQASNLTIGLSVVALCAALVALVAPKV
FT                   LAHLKI"
FT   gene            323442..324101
FT                   /locus_tag="Bcen2424_0280"
FT   CDS_pept        323442..324101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0280"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: bcn:Bcen_2826 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07034"
FT                   /protein_id="ABK07034.1"
FT                   /translation="MNIDPAFALHLLHRCALGTLATHTREPQGFPYPTVVPFAPDASHR
FT                   PVILVSGLAEHTRNLAADPRAGFLIVDASDGDVLNAERATLLGRFVPLGDDPHVTARYL
FT                   RYEPDAARYLALGDFAFWALEIERLRYIGGFGRMGWVDGTQLDTLPPLAFDDEQALWHA
FT                   YEAGDAHRDGLDLLGVDRHGADWRCDGRRVRTPFESPSADTGALRERLIACAKDVT"
FT   gene            324459..324752
FT                   /locus_tag="Bcen2424_0281"
FT   CDS_pept        324459..324752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0281"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bcn:Bcen_2825 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07035"
FT                   /protein_id="ABK07035.1"
FT                   /translation="MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLA
FT                   ELGLSRAKAGKVGRPRAGVAAKYRDPETGATWSGRGKPPRWIAGKNREQFAI"
FT   gene            324996..326153
FT                   /locus_tag="Bcen2424_0282"
FT   CDS_pept        324996..326153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0282"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bcn:Bcen_2824 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07036"
FT                   /protein_id="ABK07036.1"
FT                   /translation="MSTFSGDAQSADKHAVARKSTLVSIVLNVVLATFQIAVGVIAHSQ
FT                   ALIADGVHSISDLISDFVVLVANRHSGASPDADHNYGHSRYETVASLFLGAILIAVGIG
FT                   MLWRAGDRLVNLENIPAVHFSALIVALTVLVSKEALFRYMLREARRVRSAMLVANAWHA
FT                   RSDAASSLVVAIGIVGSLAGVRLLDPIAAAIVGFMVARMGWTFGYDALQDLSDRALDTA
FT                   DTAEIRALLAATPGVRDVHDLRTRKMGDAALVDAHILVDPKISVSEGHYIAETARARVL
FT                   SDPRVLDALIHVDPENDAARRPALALPPRGELAARLEAALAQRGLRAAAINLHYLSTGL
FT                   EVDVTLDSDPRDTDAALAGRLDIDTLKREFGARRISFTRTLPART"
FT   gene            complement(326224..326694)
FT                   /locus_tag="Bcen2424_0283"
FT   CDS_pept        complement(326224..326694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0283"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bur:Bcep18194_A3386 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07037"
FT                   /protein_id="ABK07037.1"
FT                   /translation="MEAQVTLDSFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIK
FT                   DMEQSGVIQRYTALLDREKLGLHVCALAHVHLTRHNEGGVEQFEREIATCPEVTECYST
FT                   TGEADYILKIVAPDIKAYDVFLHERIFKIPAVSQVRTSVVLREIKFDTQLPL"
FT   gene            complement(326774..327433)
FT                   /locus_tag="Bcen2424_0284"
FT   CDS_pept        complement(326774..327433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07038"
FT                   /protein_id="ABK07038.1"
FT                   /translation="MNQTAIPEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKQLIATF
FT                   SANLETLPGAHAHPVQEAWWKTEPEAWAACRRDLQAPEAALVAYVEWVEALPGKPVFVA
FT                   MPAGFDFTFMFWYMMRFAGRCPFSWSALDIKTLAFAMTGLPYRKAIKPRFPKHWFDDHP
FT                   HTHVALDDAIEQGALFCNMLADLRRQQAALAGLAVSDTDRSESAGAGQNPTDPRAN"
FT   gene            complement(327430..328074)
FT                   /locus_tag="Bcen2424_0285"
FT   CDS_pept        complement(327430..328074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0285"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcn:Bcen_2821 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07039"
FT                   /protein_id="ABK07039.1"
FT                   /translation="MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQ
FT                   NVQVEKVLLTHGHIDHCAGAKTLATRYGVPIEGPQEEERFWIEKLPMQSERFGFPAADV
FT                   FEPDQWLNDGDTVRFGDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDF
FT                   PRGNHEDLVRSIKEKLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKVFG"
FT   gene            328700..329341
FT                   /locus_tag="Bcen2424_0286"
FT   CDS_pept        328700..329341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0286"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: bcn:Bcen_2820 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07040"
FT                   /protein_id="ABK07040.1"
FT                   /translation="MRPEPEGDTSMNLRFPSRFGTIALFFALTGCAVPSSQTTGSVNQK
FT                   KAVDKTAAAAKADDDKQPLSFDSALASMPAADSKDAKKSSLADAEPIDGKDVSEFRQSG
FT                   RASWYGRDFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVVVKVNDRGPF
FT                   KRGRVLDLSYAAAKVIGLVHAGTGRVKIEGLSPQEAREARDEMLASISAK"
FT   gene            329411..329740
FT                   /locus_tag="Bcen2424_0287"
FT   CDS_pept        329411..329740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07041"
FT                   /protein_id="ABK07041.1"
FT                   /translation="MRPAWAHSCGCKSRHKLVTANEVKRNCMRATECGEEAWSVNREPM
FT                   DKNCIEGAAVQGERATHREALVTKAKQRKCGGCAMKECALTWGDLALCLKGRRRRAGAR
FT                   SQQRS"
FT   gene            329811..331178
FT                   /locus_tag="Bcen2424_0288"
FT   CDS_pept        329811..331178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0288"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron, maturase-specific domain
FT                   protein; KEGG: bcn:Bcen_3099 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07042"
FT                   /protein_id="ABK07042.1"
FT                   /translation="MSMRQAMRQMPVRAGRAGSIRGEAASMPVSDEGCCPRHESGDTGS
FT                   PLLMAALTRENLKQAFKRVRANKGAAGVDGLNIDQTSRHLVTAWPAIREQLLKGTYRPS
FT                   PVRRVTIPKPDGGERELGIPTVTDRLIQQALLQVLQPVLDPGFSEHSYGFRPGRRAHDA
FT                   VLAAQSYVQSGRRIVVDVDLEKFFDRVNHDILIDRLQKRIGDASVIWLIRAYLNSGIMD
FT                   GGVVQQREQGTPQGGPLSPLLANVLLDEVDKELERRGHCFARYADDANVYVRSRRAGER
FT                   VMALLRRLYGQLRLKVNETKSAVASVFGRKFLGYSLWVASGGVIKRKVAARPLLAFKRR
FT                   IRELTGRSGGRSMKDVVERLRPYVLGWKAYFRMAQTPRVWLDLDKWMRHRLRVIQLKHW
FT                   RRGPTIYRELRALGAPSAVAQQVAANSCRWWRNSGKLLNSVLTLAYFDRLGVPRLS"
FT   gene            complement(331286..332116)
FT                   /locus_tag="Bcen2424_0289"
FT   CDS_pept        complement(331286..332116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0289"
FT                   /product="Protein of unknown function UPF0011"
FT                   /note="TIGRFAM: Protein of unknown function UPF0011; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: bcn:Bcen_2817 protein of unknown
FT                   function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07043"
FT                   /protein_id="ABK07043.1"
FT                   /translation="MVATPIGNTADITLRALHVLGLADRIAAEDTRNTGQLLARYGISK
FT                   PLVAVHEHNEREAAQRVIELLRGGERVAYVSDAGTPGISDPGARLVDAVRAAGFTVVPL
FT                   PGASAAVTALSVAGDWAGAFTFAGFLPPKAKQRATALQALVSHPYALVFYEAPHRIAET
FT                   VAALAEAFGPARRLLIARELTKLHEQLFQGTLAEGQSWLAGDANRQRGEFVLVVEGAPA
FT                   ASGEADDTAHDALLRLLLEEVPVKSAAKLAAALTGASRNTLYARALVLKEGKED"
FT   gene            332172..332648
FT                   /locus_tag="Bcen2424_0290"
FT   CDS_pept        332172..332648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0290"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   bcn:Bcen_2816 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07044"
FT                   /db_xref="GOA:A0K3G7"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3G7"
FT                   /protein_id="ABK07044.1"
FT                   /translation="MAGNARGRGTNGTRTALCHAAPARPEGARGRPPSGDNFSGAARSK
FT                   PVGAAFEQRARQFLERHGLGFVAANVTMRGGELDLVMREPDGMLVFVEVRARRSTRHGG
FT                   ATASVGWRKRRRLVAAALQFWSRHGAGAACRFDVVAFEAGRLAWLRDAFRTDDA"
FT   gene            332785..333369
FT                   /locus_tag="Bcen2424_0291"
FT   CDS_pept        332785..333369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0291"
FT                   /product="phosphoheptose isomerase"
FT                   /note="KEGG: bcn:Bcen_2815 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07045"
FT                   /protein_id="ABK07045.1"
FT                   /translation="MSVERIQQQFRDSAALHAEAADALSLPIAAAVDAMFAALANGNKI
FT                   VACGDGPSAAAAQYLAASLVGGFERERPGLPAIALATDASQAGLAGAAAAEQLFAQQVR
FT                   VLGQTGDILLVLDAGGASPRVLAAIDEAHEREMTVIALTGGNDHTVAAALSDTDIPISV
FT                   PAVRAARIHEVHLLTIHSLCDGIDAMLLGED"
FT   gene            333387..334187
FT                   /locus_tag="Bcen2424_0292"
FT   CDS_pept        333387..334187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0292"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: bcn:Bcen_2814
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07046"
FT                   /protein_id="ABK07046.1"
FT                   /translation="MNQSRVKQTLVRTTLLAALTAGLAVSLQGCVLGVVGAAAGGGALI
FT                   ATDRRTLGAQTEDREIQVKSLTQINNGLPDQSHVNVTVFNRRVLLTGEVPNDASKQRAE
FT                   ELVRGINNVNGIVNELSVEPASSLSSRANDSYLEGRVKSELIATKGISANYYKVVSERG
FT                   NLYLMGLVTVDEGNRGAEAASQVPGVEKVVKVFQYVKPQDAQALQDASPASGASAAQAV
FT                   AAPADSATVGAVPDASVQSAPLQPPAPISNSSNVHPGNPKAKAQ"
FT   sig_peptide     333387..333476
FT                   /locus_tag="Bcen2424_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.452 at
FT                   residue 30"
FT   gene            334184..334537
FT                   /locus_tag="Bcen2424_0293"
FT   CDS_pept        334184..334537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0293"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: bcn:Bcen_2813
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07047"
FT                   /protein_id="ABK07047.1"
FT                   /translation="MTGMQMKRWMVQGAAAAALVAGTLGAAHADVGDGLKVARSNACMG
FT                   CHAVDRKLVGPSFKDIAARYKSDPQAVAKLSKKVKDGGSGVWGAIPMPAHPRMSDADVR
FT                   SVVEWVLAGAPSK"
FT   sig_peptide     334184..334273
FT                   /locus_tag="Bcen2424_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 30"
FT   gene            334605..334680
FT                   /locus_tag="Bcen2424_R0006"
FT                   /note="tRNA-Ala3"
FT   tRNA            334605..334680
FT                   /locus_tag="Bcen2424_R0006"
FT                   /product="tRNA-Ala"
FT   gene            complement(334750..335061)
FT                   /locus_tag="Bcen2424_0294"
FT   CDS_pept        complement(334750..335061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07048"
FT                   /protein_id="ABK07048.1"
FT                   /translation="MTRSDPTPRQIIVFVLYSVLCLPASMTVAGLVATQITRNISSFEG
FT                   GAGYAALWWIIILTFAFYGLSIAVCALLRKRTAVLAVMTAGFAVLAVPTFRVIYELAT"
FT   sig_peptide     complement(334972..335061)
FT                   /locus_tag="Bcen2424_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.464 at
FT                   residue 30"
FT   gene            complement(335188..336585)
FT                   /locus_tag="Bcen2424_0295"
FT   CDS_pept        complement(335188..336585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0295"
FT                   /product="D-glucarate dehydratase"
FT                   /EC_number="4.2.1.40"
FT                   /note="KEGG: bcn:Bcen_2811 glucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07049"
FT                   /protein_id="ABK07049.1"
FT                   /translation="MSEPSRAGTPRVTRMQVIPVAGRDSMLLNLCGAHAPYFTRNLVIL
FT                   DDSSGHTGVGEVPGGEGIRHALERMTDLVVGQSIGRYQATLNAVRAALSGAGAGAGRTI
FT                   RHEVTSAGEAAVLRQPHEINLRLDNVITAIEAALLDLLGQHLDVPVAALLGEGQQRDAV
FT                   PMLAYLFYIGDRRRTDLPYRDEAQARAPWFRLRNEAALTPAAIARQAEAAVERYGFTDF
FT                   KLKGGVMAGADEMEAIAAIKTRFPDARATLDPNGAWSLDEAVALCRGQGHLLAYAEDPC
FT                   GPEAGYSGREVMAEFRRATGIPTATNMIATDWRQMDHAVRLQAVDIPLADPHFWTMQGS
FT                   VRLAQLCRDWGLTWGSHSNNHFDVSLAMFTHAAAAAPGTITAIDTHWIWQEGDARLTRE
FT                   PLAIVGGKVAVPERPGLGIELDMAQVEAAHALYNAVGGTARDDAVAMRYLVPGWTYDPK
FT                   RPSLGRV"
FT   gene            complement(336648..337988)
FT                   /locus_tag="Bcen2424_0296"
FT   CDS_pept        complement(336648..337988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0296"
FT                   /product="d-galactonate transporter"
FT                   /note="TIGRFAM: d-galactonate transporter; PFAM: General
FT                   substrate transporter; major facilitator superfamily MFS_1;
FT                   KEGG: bcn:Bcen_2810 D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07050"
FT                   /protein_id="ABK07050.1"
FT                   /translation="MNPLHALPASASATARRTRVRWLVLAVLFAVTTINYADRAAIAIA
FT                   GPGLARALHLSHVQMGFIFSAFGWSYVIAQLPGGWLLDRFGSRIVYAFSIFFWSLFTLL
FT                   QGGIGFFGGAAAFALLFGLRFLVGAAEAPSFPANSRIVSAWFPAPERGTASAIFNAAQY
FT                   AATVVFAPLMGWLVHAFGWQSVFAVMGVLGFAFVLVWNRTMYDPKDHPTINRAELDYLA
FT                   EGGALVNIDQTTGGRDGGPSLRHVKALLRNRMLVGVYVAQYCINALTYFFITWFPVYLV
FT                   QARGMSILNAGLVASIPAVCGFLGGILGGIVSDALLRQGRSLSVARKVPIVIGMLLSMS
FT                   MIVCNYTDSHVIVVVFMALSFFGKGLGALGWAVNADTAPRQIAGLSGALLNTCGNLSSI
FT                   TTPIAIGYIVDRSGSFNGALVYVVAHALVAVICYLFVVGEIRRVELQ"
FT   gene            complement(338204..339181)
FT                   /locus_tag="Bcen2424_0297"
FT   CDS_pept        complement(338204..339181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0297"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_2809 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07051"
FT                   /protein_id="ABK07051.1"
FT                   /translation="MANDGAVAAKIETRRFSMWTLEMNLNDLYLFVQAVEAGSMSAAAR
FT                   RLDLPKSTVSKRVAELERTLGARLVHRTSRSFRLTPVGAEFFEHARAAVIEADSARDAV
FT                   LRQAAEPAGVVRITSSVPVAQHILAPCLPALAIAHPKLLLQIHASDRLVDIAQEGFDIA
FT                   VRSHFAPLPDSALVQRPLAASPIVVVAAPAYLARAGTPDTPADLAQHDGLHPGPQPWRL
FT                   QRRGDAVDVTPRLRLQADESTLLLQAATAGLGLACLPDWIAGAALASGALVRVLPGWCA
FT                   GTVTTTLLMPHRRGQLPGVRAAVEFLAQHVARHHGSGSTIEPHA"
FT   gene            339188..339952
FT                   /locus_tag="Bcen2424_0298"
FT   CDS_pept        339188..339952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0298"
FT                   /product="Glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   bcn:Bcen_2808 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07052"
FT                   /protein_id="ABK07052.1"
FT                   /translation="MTARSTSVEFPMSPILLYGIPAGCSFGSIVALEWTGRPYRLSRIT
FT                   MPGAVTSDAFLALNPVAETPAFVTANGDVLTESIAILGHIGAQALDRGLAFRQGSADFD
FT                   RLNRMLAWLNTTFFNAFGALWYVYEHDTEGAEKAALQAYGRGKVLKAHRQLEALLERGE
FT                   GPWLLGARRTLADAYFTGIARWADYHAVFERDAFPRVAALRARLADDAGVQFAHAIEEN
FT                   LPPPASSAFEGHVSLDDALASARGIVASARAV"
FT   gene            340079..340711
FT                   /locus_tag="Bcen2424_0299"
FT   CDS_pept        340079..340711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07053"
FT                   /protein_id="ABK07053.1"
FT                   /translation="MTTSTLLPSYTAFDGHRRLASGPLATVALAVRQAAGDAMPGSILI
FT                   FDDATGRSIDLDLRGTADDIRARYAPPSADASGGAGEPAGAGAAEQRGRGRPKLGVVSR
FT                   EVTLLPRHWEWLGAQPGGASVALRKLVEDARRTHAAADRQRDAQARAYHFMSAMAGDLP
FT                   GFEEAARALYANDPARLAELIAGWPDDVRDHALALARGDLPPVAEDC"
FT   gene            340727..342064
FT                   /locus_tag="Bcen2424_0300"
FT   CDS_pept        340727..342064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0300"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: bcn:Bcen_2806
FT                   carotenoid oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07054"
FT                   /protein_id="ABK07054.1"
FT                   /translation="MTVFDLNRGALAPVADEVDIVELRVTGAIPRELDGTLLRNGPNPP
FT                   GGRFEGNDMLSWWPEAAMLHAIAFENGRAAGYRNRWARTQRWAAVHAPGQAPHLPDTNP
FT                   NVNVLQHAGELLALAEGGAPLAITAALDSFGVPARHAGFDGAMTAHPKVDPVTGELILF
FT                   RADWRAPWLRYGVIDAMGVKRIDVEIELGAPSMMHDLAITETRSLLLDLNVGYDFSLLK
FT                   QGHRMPLRWHDDRPARIGVLPRHGGDVRWFGVEPCFIQHVVNAYDCDASCIVLDAVRYP
FT                   SFLRLDTRTGRFADNPVGELWRYVIDTANGLIDEGPLADGGIELPRINESRTGRNYRYL
FT                   YAVEQPNNAEMRGVMRFDHARGTTMHYAVPAGDQNGEPVFVPRPGGADEDDGWLLVMVY
FT                   RAATDTSDVVILDARAIDAGPVATVHLPRRVPAGFHGAWVPCERRA"
FT   gene            complement(342078..343244)
FT                   /locus_tag="Bcen2424_0301"
FT   CDS_pept        complement(342078..343244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0301"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bcn:Bcen_2805 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07055"
FT                   /protein_id="ABK07055.1"
FT                   /translation="MAIPLTYIARNLWTRRLTTALTAGGMALVIFVFATVQMLDAGLTK
FT                   TLVSTGEPDNAVVIRKGAETEIQSSIDHQQANALEMHPAVALGPDGRPLVSKEAVVLIS
FT                   LVKTSTGKPSNVVIRGVSPAGLALRPHVKLVAGRPFAPGSSEIVVGSAIAKGFSGTQLG
FT                   DRLHFAQRDWTIVGIFDAGGSGFDSEIWGDVDQLMQSFRRTSYSSMVLRIPSADGFARF
FT                   KADIDVDPRLTDEAKREQTFYGDQSKALSTFINILGITLSTIFSIAAMIGAMITMYASV
FT                   ANRVAEIGTLRALGFKRTSVLAAFLLEALLLGFVGGVAGLACASLMQFASFSTTNFQTF
FT                   SDLSFRFVLTPAIVVKTLLFSLVMGLVGGFLPAMRAARLKIVDALRAQ"
FT   sig_peptide     complement(343140..343244)
FT                   /locus_tag="Bcen2424_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.807 at
FT                   residue 35"
FT   gene            complement(343253..344407)
FT                   /locus_tag="Bcen2424_0302"
FT   CDS_pept        complement(343253..344407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0302"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bcn:Bcen_2804 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07056"
FT                   /protein_id="ABK07056.1"
FT                   /translation="MFVLKLIARNALRHRLRTLLTVLGLTIAVLAFGLLHTVVDAWYAG
FT                   AAAASSGRLVTRNAISLVFPLPVSYENRIRGVDGVTAVVRSNWFGGIYRDPKNFFASFA
FT                   VSDNYLDLYPEFILPAQQRADYARDRRGCLVGRQLATQFGFKVGDVIPLKGTIYPGTWD
FT                   FVVRGILDGRDDSTITRQLVFHWDYLNETVRKRTPKQADQVGVFVLGVANPDDGASIAR
FT                   NVDAVFKNSLAETLTETEQAFQLGFVAMSNQIIAAIRLVSYVVILIIMAVMANAMAMSA
FT                   RERTAEYATLKALGFGPGFLALIVFGESVVIAVAGGGLGILATPPAASLFKQAAGGIFP
FT                   VFKVSTETVMLQAACSVAVGFAAAIVPAWQAARVRVVEGLRAIG"
FT   sig_peptide     complement(344294..344407)
FT                   /locus_tag="Bcen2424_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.478 at
FT                   residue 38"
FT   gene            complement(344429..345127)
FT                   /locus_tag="Bcen2424_0303"
FT   CDS_pept        complement(344429..345127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0303"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_2803 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07057"
FT                   /protein_id="ABK07057.1"
FT                   /translation="MNDAPTPLVELSHVAKSYRRGNQIVPVLTDISLDIGEGDFVALMG
FT                   PSGSGKSTLLNLVAGIDRPDSGELRVGGLDISQLAEAQLAEWRAANVGFIFQFYNLMPV
FT                   LTAFENVELPLMLTPLSRRERRERVELVLDMVNLGDRTSHYPSELSGGQQQRVAIARAL
FT                   ITDPVLIVADEPTGDLDRASATDVLAMLQRMNAELGKTIIMVTHDAHAAGAARSLVHLE
FT                   KGELIDGHAG"
FT   gene            complement(345133..346338)
FT                   /locus_tag="Bcen2424_0304"
FT   CDS_pept        complement(345133..346338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0304"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_2802 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07058"
FT                   /protein_id="ABK07058.1"
FT                   /translation="MPDHNLDKLKIDRRPIAPVPRRRRWARYAVAAALIVIAIGAGLAL
FT                   TGRPTVDTTSVTSAYPYQNDTQLNATGYVVPQRKAAVASKGQGRVEWLGVLEGTRVKKD
FT                   EIIARLESNDVQASLAQARAQVQVSRANLGVAQAELKDAEIALRRTSTLAPKGAVPAAQ
FT                   LDIDTARVNKARATLDSDQAAIASAEANAQAAQVAVDQTVIRAPFDGIVLAKHANVGDN
FT                   ITPFSSASDSKGAVVTIADMETLEVEADVAESNIAKIRAEQPCEIQLDALPDLRFAGRV
FT                   SRIVPTVDRSKATVLVKVRFVDRDERVLPDMSAKIAFLSKPASAQDRQPVTAVQASAVV
FT                   ERDGRPVVFVVKDDAVHAVAVAKGARIGELVAVRGVTPGDTVVLAPGAKLKDGANVTVA
FT                   KK"
FT   gene            346565..346930
FT                   /locus_tag="Bcen2424_0305"
FT   CDS_pept        346565..346930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07059"
FT                   /protein_id="ABK07059.1"
FT                   /translation="MEPVRQVLSRRNGESRPRGLGLRCECLASLITGTFDFFSAKGRTM
FT                   KKTLASIIAAAFALASVSAFAQASAPAADTPAAASAPAKKDHSKPKHQLKHHGSKKGQA
FT                   KAAAASAAGTNDAGTQN"
FT   gene            complement(347010..347789)
FT                   /locus_tag="Bcen2424_0306"
FT   CDS_pept        complement(347010..347789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0306"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   bcn:Bcen_2800 protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07060"
FT                   /protein_id="ABK07060.1"
FT                   /translation="MATATFRFHGELNAFLARQQRDRAFAHACARDATVKHAIEALGVP
FT                   HTEIGRLYVNDAPAALDRPLDDGDRVEVLPERAGPAANGATGPPPAAWRFVADAHLGGL
FT                   AQLLRLAGFDTCYDNHYRDDELAALAEREQRIVLTRDRELLKRRAVVRGCYLHALQPAD
FT                   QLRELFERLDLAPHMRPFRLCLRCNAPLHPLDAAAAAPSVPAGVRLRHRRFAACDVCRR
FT                   VFWEGSHWRRMRAVVDAMRTPSPVRRDGAGGPDEPGA"
FT   gene            347886..348755
FT                   /locus_tag="Bcen2424_0307"
FT   CDS_pept        347886..348755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0307"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   bcn:Bcen_2799 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07061"
FT                   /protein_id="ABK07061.1"
FT                   /translation="MDLGFIGLGEMGQAIATNLLKAGHTVRVWNRSRERAEPLAAFGAQ
FT                   IVDTPADAFRGDAVFSMLGDDAAARAVFDDALLAQAPRGLIHVNMATVSVALAESLAHA
FT                   HASRGIDYVAAPVMGRPDVAAAARLTIMAGGPAEAIDRVQPLFDAIGQKTWRFGSLPQH
FT                   ANVAKIAANFTLASAIETLGEASALLGAHGVAMRDFLDVITSSVFPGPVYEGYGAMIAE
FT                   RRYEPARFKARLGLKDVRLALEAGDATSVPLPVASVVRDSLLDALAHGGGDQDFAVLGE
FT                   VALRRAGR"
FT   gene            348829..349464
FT                   /locus_tag="Bcen2424_0308"
FT   CDS_pept        348829..349464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0308"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bcn:Bcen_2798 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07062"
FT                   /protein_id="ABK07062.1"
FT                   /translation="MNLHTWWLFVATVFVVSAIPGPNMLLVMTHGARHGLRRSSATMAG
FT                   CLSALVLMLAVSAAGLGAVLEAWPAMFNTLRFAGAAYLVYLGVKAWRARVDDAPAADVD
FT                   AVSQGASASRAVLFRNGFLVAGSNPKAILFAAALLPQFINAAEPTLPQFGILVVTFAVI
FT                   EVSWYLVYASFGTRIGATLKSQSVARVFNRLTGGLFVGFGAMMALVRH"
FT   gene            complement(349596..350879)
FT                   /locus_tag="Bcen2424_0309"
FT   CDS_pept        complement(349596..350879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0309"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_2797 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07063"
FT                   /protein_id="ABK07063.1"
FT                   /translation="MNCPADRCSAPVSPAVAAPPALSTGMTLFFAATVGVIVMDLFAAQ
FT                   PLTGPISADLHLPPGLAGLVAMLPQLGYAAGLALLVPLVDLLENRRLIVATLAVCAAAL
FT                   ALPAFTQSGAVFLLATLAAGAASSVIQMLVPMAASMAPEAQRGRAVGNVMSGLMLGILL
FT                   SRPLASLIAGSAGWRAFYLLAALADAAIAVVLALRLPARTPSITASYRALLASMGRLLA
FT                   DEPVLRRHALSAALAMAAFSAFWTAVGLRLAQPPFALDLHGIALFAFAGASGAIVTPLA
FT                   GRAGDRGHGPAAQRLAHGTMLAALVVLGVAGAGWFGFDAHAHRGVALALLAGGAALLDA
FT                   GVIVDQTIGRRAINLLHPAARGRLNGLFVGLFFVGGALGAALAGSAWAWGGWSAVCGVG
FT                   FAFAGAAAAFGLMAGRGAGAAAWDRPGA"
FT   gene            351028..351906
FT                   /locus_tag="Bcen2424_0310"
FT   CDS_pept        351028..351906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0310"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_2796 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07064"
FT                   /protein_id="ABK07064.1"
FT                   /translation="MVAAAAKLHLTQPGLTRRVQNLETLLGMPLLERQSKPLKPTAAGR
FT                   DVYALARNVLGAVDELMAAGAPDSEPSGELRIGVPPFLSELALERPIDRLRDAFPRLTL
FT                   RVTAGWSPALVQGIERGALDVATVMVPASAALPDALTATLLATQPTVLVAARDFPLPDG
FT                   PLSLDTLSGYPWVLSQDGCGMRSALSRALGAAGLPFDVAVEAFGSELQLSLVARGAGIG
FT                   IAPPNALARSAHREALRVVETAGLETRINVWLVHGTLPGRLVRPVALLRDALGEVLERE
FT                   NGKGSGAVTAN"
FT   gene            complement(352092..352925)
FT                   /locus_tag="Bcen2424_0311"
FT   CDS_pept        complement(352092..352925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0311"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bcn:Bcen_2795 OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07065"
FT                   /protein_id="ABK07065.1"
FT                   /translation="MKKTLLCAAAGAAAVAPLAAHAQSAGSNVVTLGWFHIMPLQSSTP
FT                   MRTNVAPTPINTPLRLPPSFTSAGTGLHTSGADTVGLTVSHFLTDHIAVTSVAGVPPVF
FT                   KVSGQGTIKPPGPAGALGTQNIGLGSVNPIVKSVRQWSPAVILQYYFGQATAKFRPFLG
FT                   LGVSYNWFSDLQLNTNFIKQTQDNLGAILAAGAGKPGTTSVEAKASSSWQPVFNAGLQY
FT                   NLTEHFGLVASVTYIPLKTTSTVTIKAADGSVLAESKSDLKADPIISYVGMTYKF"
FT   sig_peptide     complement(352857..352925)
FT                   /locus_tag="Bcen2424_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(352944..354185)
FT                   /locus_tag="Bcen2424_0312"
FT   CDS_pept        complement(352944..354185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07066"
FT                   /protein_id="ABK07066.1"
FT                   /translation="MKRNLILAAALAAPLLSACGGGSDNPPPLVEDRLCPATLDYNTVF
FT                   TGGAGSGELAKVQLDTTKMTWQVTYVESAVPQKTGTVTPTRAGTVDSGTLTQETLLPTN
FT                   KLNQCAFRLNGASLDASRPARIFVGFGVAGGTIPGKEIQFDGVLGQAAVPDTKFPYYPF
FT                   IGFSSIETDITKVAGTYSHIGFGEVPSQKFGPASIDAKVTINADGTWTKCDTTGQFAGG
FT                   ACAQQGTNFVQSADGSGAFQSNNYASQLKPTLSATPQGKGFMIVGKLRNQLVPILVRTG
FT                   VANPNPTPDSNGVPGLTADDESSISILAPQTAVAAGSQNGEYIGVDSQFDYRTTALIDK
FT                   QATLLDPFQPSQASLATALDLDYTQKVPGTVTTIHTGSGSTSPTGKFIFSGGVFGFLDN
FT                   AGSTPYFTIGAFVQ"
FT   sig_peptide     complement(354123..354185)
FT                   /locus_tag="Bcen2424_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.445 at
FT                   residue 21"
FT   gene            complement(354334..355755)
FT                   /locus_tag="Bcen2424_0313"
FT   CDS_pept        complement(354334..355755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07067"
FT                   /protein_id="ABK07067.1"
FT                   /translation="MSHALSKGVATAFAIAPFLVACGGGDSGGALAPINAPQCSGSSCG
FT                   TQGQPPSQPISGALCPANADIVKSTYLGGAGSGEIVSVNIDAVAMTYTLKWLESPIPLK
FT                   TGTVTPSRVGTTITGKVIHPPTGTLPTAEQTRCAFVLTPGTGPAPDGSTYSTAADFNQA
FT                   NPPMLLVGMGVAGGGIPGATIQYDGLTIIPGVVQNVGQVPNRHFDFYPFLGFANTTTDL
FT                   SKLPGTYNALLYHLVPSGNYATKGSNSSETFDANGACTSSGSGGCQTTGDPWKTSANGG
FT                   YFDSTKAPQTLPQTQLPIVGATGKSATAHMVIGQLNGATVPVIVRTGNVNLGTPPLHLD
FT                   AQVDDESGIAVLGAATAVTSGTIDGGYAGADSNFKYTAALIRGSNASFINPSTQAEEDG
FT                   FTLDYGQTTPGLLNAKTTPPSGASYPSASGVVIATGGLYAALIQGTVNGGVTSTSANST
FT                   TSSTPYFGVGAQISK"
FT   sig_peptide     complement(355684..355755)
FT                   /locus_tag="Bcen2424_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.338 at
FT                   residue 24"
FT   gene            complement(356190..357140)
FT                   /locus_tag="Bcen2424_0314"
FT   CDS_pept        complement(356190..357140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0314"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: bcn:Bcen_2792
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07068"
FT                   /protein_id="ABK07068.1"
FT                   /translation="MSTKVFVDGQEGTTGLKIFEYLSARSDIEILRIDEAKRKDVDERR
FT                   RLINASDVTFLCLPDVASRESASLVENPNTTLIDASTAFRTNPDWAYGLPELTRAQREK
FT                   IRTSKRIAVPGCHASAFVLAMRPLVDAGIVAPTFAAHSYSITGYSGGGKSMIAEYESAT
FT                   PGGKLASPRPYALGLTHKHLPEMAAHTGLANAPIFTPIVGPFLKGLAVTTYFTPEQLAK
FT                   RATPQDVQRVFAEYYADEAFVRVAPFDAEANLDGGFFDVQANNDTNRVDLFVFGNAERF
FT                   VTVARLDNLGKGASGAAIQCMNLNIGAAEDAGLKR"
FT   gene            complement(357308..357880)
FT                   /locus_tag="Bcen2424_0315"
FT   CDS_pept        complement(357308..357880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0315"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   bcn:Bcen_2791 flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07069"
FT                   /protein_id="ABK07069.1"
FT                   /translation="MSNIVIVYHSGYGHTQKLAEAVHAGAQDAGANVRLIAVGDLDDAG
FT                   WAALDAADAIVFGAPTYMGGPSAQFKQFADATSKAWFTQKWKDKIAAGFTNSATMNGDK
FT                   FSTIQYFVTLAMQHGMVWVGTSLMPANSKAATRNDINYLGGSTGLLAQSPADATPDEGP
FT                   LPGDLETGKAFGRRVAEATARWDAGAR"
FT   gene            complement(358092..358688)
FT                   /locus_tag="Bcen2424_0316"
FT   CDS_pept        complement(358092..358688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0316"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /note="TIGRFAM: YbhB and YbcL; PFAM: PEBP family protein;
FT                   KEGG: bcn:Bcen_2790 YbhB and YbcL"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07070"
FT                   /protein_id="ABK07070.1"
FT                   /translation="MRVDRRITPPAPSGRPSPFLLSALLCAAVFAALPARAEGPFTVTS
FT                   DDLTPGARVRLANVFDRGDCKGANRSPQLAWHNPPPGTRGYAVTIFDPDAPGHGWWHWA
FT                   VAGIPATVTSLPADASASGFLRRIGASEARNDFGLDGYGGPCPPPGKPHRYVITVYALK
FT                   GTDLRVSQGRPAPMFEHEIGTLAIGTAQLTVTYGQ"
FT   sig_peptide     complement(358575..358688)
FT                   /locus_tag="Bcen2424_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 38"
FT   gene            complement(358929..359615)
FT                   /locus_tag="Bcen2424_0317"
FT   CDS_pept        complement(358929..359615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0317"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: bcn:Bcen_2789 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07071"
FT                   /protein_id="ABK07071.1"
FT                   /translation="MTGYDRQSISDTTAKILLEVQAVHFNAEKPFIFTSGWASPVYIDC
FT                   RKLISYPRVRRALMEMAETTITRDIGFEQIDAVAGGETAGIPFAAWIADRMMVPMQYVR
FT                   KKPKGFGRNAQIEGHLEEGSRVLLVEDLTTDSRSKINFVNALRTAGATVNHCFVLFHYD
FT                   IFKESVSVLKDIDVDLHALATWWDVLRVAKASGYFETKTLDEVEKFLHAPAEWSAAHGG
FT                   ATAPKE"
FT   gene            360075..362345
FT                   /locus_tag="Bcen2424_0318"
FT   CDS_pept        360075..362345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0318"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   enzyme domain protein; malic enzyme, NAD-binding; KEGG:
FT                   bcn:Bcen_2788 malate dehydrogenase (oxaloacetate
FT                   decarboxylating) (NADP+), phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07072"
FT                   /protein_id="ABK07072.1"
FT                   /translation="MDEQLKQAALAYHLNPKPGKISVTPTKPLSNQLDLSLAYSPGVAA
FT                   ACEAIHADPLDAQKYTSRGNLVGVITNGTAVLGLGNIGPLAAKPVMEGKGCLFKKFAGI
FT                   DVFDIELSESDPDKLVEAIAMLEPTLGGINLEDIKAPECFYIEQKLRERMKIPVFHDDQ
FT                   HGTAIIASAAILNGLKVVGKKLSEVKLVCSGAGAAAIACLDLLVNLGLTKSNILVADSK
FT                   GVIYEGRSNLDPSKQRYAANTDARTLADAIVGADVFLGCSSAGVLKQDMVKTMGERPLI
FT                   LALANPEPEIRPEDAKAVRPDAIVATGRSDYPNQVNNVLCFPFIFRGALDVGATTITEE
FT                   MKLACVRAIAELAEETDQSEEVAKAYEGHSLEFGPDYLIPKPFDPRLIIKIAPAVAQAA
FT                   MDSGVATRPIQDMDAYREQLGATVYRTGMVMRPVFAAAKQKEARIVFAEGEDERVLRAA
FT                   QFVLLEKIAKPIIVGRPSVVDMRLQKIGSKLKAGVDFEIVDPEDDARYHRYWQAYQEIG
FT                   ARDGVTPEVAKAAMRKFNTLIGAMLVHLGDADGMICGMIDTFHSHLKFIEQVLGRAKGA
FT                   EHFAAMNLLMLPGRNLFVCDTYVNELPSADQLADMTIQAAAEIERFGIAPKAALLSNSN
FT                   FGSAPSASSRRMAEARKLIVERAPNLEVDGEMHGDAALSELIRKQAFPGTTLSGEANLL
FT                   IMPNVEAANIAYNLLKMVGGEGVTVGPFLLGAAKPVHILTPAATVRRIINMTAVAAANV
FT                   NTK"
FT   gene            complement(362496..366086)
FT                   /locus_tag="Bcen2424_0319"
FT   CDS_pept        complement(362496..366086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0319"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: bcn:Bcen_2787 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07073"
FT                   /protein_id="ABK07073.1"
FT                   /translation="MNAPLDADQRASLEAALKSVTLDDKYTLERGRAYMSGIQALVRLP
FT                   MLQQERDRAAGLNTAGFISGYRGSPLGGLDLSLWKAKQHLAAHQIVFQPGLNEDLAATA
FT                   VWGSQQVNLYPGAKYDGVFGMWYGKGPGVDRTGDVFKHANSAGSSQHGGVLVLAGDDHA
FT                   AKSSTLAHQSEHIFKACGLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVES
FT                   SASVDIDPHRTEIVLPTDFILPEGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLD
FT                   RIEIDSPHARFGIMTGGKAYLDVRQALTDLGLDDETCARIGIRLYKVGCVWPLEAQGAQ
FT                   AFARGLDEILVVEEKRQILEYAIKEELYNWPDAQRPRVFGKFDEKDGAGGEWSVPMGNW
FT                   LLPAHYELSPAIIAKAIATRLEKFELPSDVRARIAARLAVINAKEMALAKPHVQTERKP
FT                   WFCSGCPHNTSTNVPEGSRAIAGIGCHYMTVWMDRSTSTFSQMGGEGVPWIGQAPFTDE
FT                   KHVFANLGDGTYFHSGLLAVRAAISSKANITYKILYNDAVAMTGGQPVDGVLTVPQITH
FT                   QLASEGAKKIVIVTDEPEKYDSQNALLAPGVTIHHRDQLDDVQRELREIEGTTILIYDQ
FT                   TCATEKRRRRKRGTYPDPAKRVVINDAVCEGCGDCSVQSNCLSVEPLETEFGTKRQINQ
FT                   SSCNKDFSCVKGFCPSFVTVEGGQLKKPKAVSVDGSALPPIPEPTLPAIDRAYGVLVTG
FT                   VGGTGVVTIGALLGMAAHLENKGVTVLDVTGLAQKGGAVMSHVQISHAPTDIHATRIAM
FT                   GEADLVIGCDAIVTAGDECTSRMRHDTTRVVVNSAQTPTAEFIKNPNWAFPGLSAENDI
FT                   RAAAGVAVDFIDANRFAVALLGDAIYTNPFVLGYAWQKGWLPLTLASLERAIELNAVSV
FT                   EKNRAAFDWGRRAAYDLASVKQAAAGDARPAQGATVISLHTKKAVDALIAKRVEFLTAY
FT                   QNAAYASRYAAFVDKVRAAERALADGDTVQEPLTEAVARNLFKLMAYKDEYEVARLQSD
FT                   PAFLARLTAQFEGDWKLKFHLAPPLFAKTDAHGHLVKKAYGPWMMSAFRLLAKAKFLRG
FT                   TGLDPFGRTAERRTERALIGEYETLIDEVLTRLNAANRPLALELAALPDGIRGYGHVKE
FT                   NNLRAVRQKWDTLLAKWRSPAGGQSHQQVA"
FT   gene            366351..366611
FT                   /locus_tag="Bcen2424_0320"
FT   CDS_pept        366351..366611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07074"
FT                   /protein_id="ABK07074.1"
FT                   /translation="MPGRVGSCRRSRGGAGSFTGGAMNTRHIQSFLIVSAAFFSMTGPV
FT                   HARGASALAAAGAQMQQIVPAQGAAAQPSAERAAESKASVR"
FT   gene            complement(366749..367846)
FT                   /locus_tag="Bcen2424_0321"
FT   CDS_pept        complement(366749..367846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0321"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: bcn:Bcen_2785 4-hydroxyphenylpyruvate
FT                   dioxygenase; TIGRFAM: 4-hydroxyphenylpyruvate dioxygenase;
FT                   PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07075"
FT                   /protein_id="ABK07075.1"
FT                   /translation="MQIPTWDNPVGTDGFEFIEYTAPDPKALGQLFERMGFTAIARHRH
FT                   KDVTVYRQGDINFIINAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYQRALELGAWGF
FT                   DNKTGPMELNIPAIKGIGDSLIYFVDRWRGKNGAQPGAIGDISIYDVDFEPIAGANPNP
FT                   VGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGK
FT                   IRIPINEEGSDTAGQIQEYLDAYHGEGIQHIALGASDIYQAVDGLRSKEVKLLDTIDTY
FT                   YELVDRRVPNHGESLDELKKRKILIDGARDDLLLQIFTENQIGPIFFEIIQRKGNQGFG
FT                   EGNFKALFESIELDQIRRGVVQDKA"
FT   gene            368061..368585
FT                   /locus_tag="Bcen2424_0322"
FT   CDS_pept        368061..368585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0322"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bcn:Bcen_2784 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07076"
FT                   /protein_id="ABK07076.1"
FT                   /translation="MAQAELDAIDRRILAILQENGRLSNQEIAERVNLSPSPCLRRIRR
FT                   LEEMGVITGYVALLNPQKLGLDLLAYVSVRLEKRGGLAPMRADETSARAGATHAELFRA
FT                   AVQTWPEVVACHAMTGDMDYLLRVQVEDMAHFSRFVQEHLLHHPSVIDVKTSFSLDCFK
FT                   ETTALPIRSVR"
FT   gene            complement(368661..369308)
FT                   /locus_tag="Bcen2424_0323"
FT   CDS_pept        complement(368661..369308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0323"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_2783 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07077"
FT                   /protein_id="ABK07077.1"
FT                   /translation="MNTQFNGRADAVGKVGTAPVLVRELASKDREQMLTHFLSLDEEDR
FT                   LLRFGQMVPDHVIENYVRTIDFGRDTVFGVFDHDLELIGVGHLAYLPAEGDKRTAEFGV
FT                   SVLESARGCGVGSKLFERAAIRSRNTHVTMLYMHCLSRNATMMHIAKKSGMRIEYAYGE
FT                   ADAYLSLPPADHSTIIAEMLQEQAAVFDYAMKRQARRTSKFIESLMPTALTA"
FT   gene            complement(369542..370147)
FT                   /locus_tag="Bcen2424_0324"
FT   CDS_pept        complement(369542..370147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0324"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_2782
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07078"
FT                   /protein_id="ABK07078.1"
FT                   /translation="MARTRAPDHESQREQILDLAAEKFAQTSYPSTSMSDLATASGTSK
FT                   ARLYHYYESKEAILFDLLDRYTKRLMLIIAEVEGASQRRGLSERDAFAELVRAFLAEYE
FT                   TSHSRHVALLNDVKYLEDAQREIVLDRQRDIVAAFTRQLARAYPDRISKENQTSVTMMV
FT                   FGMINWTFTWLKPGGRLGYRDFAEQVIDLIERGLSTAA"
FT   gene            complement(370164..370985)
FT                   /locus_tag="Bcen2424_0325"
FT   CDS_pept        complement(370164..370985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07079"
FT                   /protein_id="ABK07079.1"
FT                   /translation="MSTIHVIQGGTAAASLREALAQAGRDERVVGLLDDLGVGPLKGVD
FT                   ETPDTRAAFWQHVLGDQIPDWNAEIEAEFARLDQLATDAGQVVVWHAPSVGDKLLLRRV
FT                   AYHLRNVPQRLNEVRLSAADLDAAPRAALSRTDQACSTGMFSPAELARKRPAAAPVSVL
FT                   RIGRLALEWQEAKHLNAELRYWVSNTIKSGHYADLDALIVARAAADWQPARRLVGSIMA
FT                   AADRGGLFVSDAIAWWRCRELAAAGRLELQDDAPDALSSTQVRAARAAAHR"
FT   gene            complement(371115..372203)
FT                   /locus_tag="Bcen2424_0326"
FT   CDS_pept        complement(371115..372203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0326"
FT                   /product="phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit; PFAM: ferredoxin; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; Oxidoreductase
FT                   FAD-binding domain protein; KEGG: bcn:Bcen_2780
FT                   phenylacetate-CoA oxygenase/reductase, PaaK subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07080"
FT                   /protein_id="ABK07080.1"
FT                   /translation="MATPQFHPLRIRDVRPETADAVTVSFDVPPELRDAYRFTQGQFVT
FT                   LKTHIDGEETRRSYSICVGTTDYDRDGELRIGIKRVRGGRFSNFAFDTLKPGHTIDVMT
FT                   PDGRFFTHLNADHGKQYVAFSGGSGITPVLAIVKTTLELEPRSTFTLIYGNRSVDAIMF
FT                   AEELEDLKNRYMNRFVLYHVLSDDLQDVELFNGVLDQAKCAEFLATLTPADAIDEAFIC
FT                   GPAPMMDAAEAALKAAGVPPAKVHVERFGTPLPQAGAPVVEITDQTPAADLEIVLDGKK
FT                   RKLRLPYEGVSLLDVGLRAGLALPYACKGGVCCTCRAKVVEGEVRMEKNYTLEEHEVKD
FT                   GFVLTCQCHPISDKVVVSFDER"
FT   gene            complement(372206..372769)
FT                   /locus_tag="Bcen2424_0327"
FT   CDS_pept        complement(372206..372769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0327"
FT                   /product="phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaJ subunit;
FT                   PFAM: protein of unknown function DUF59; KEGG:
FT                   bcn:Bcen_2779 phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07081"
FT                   /protein_id="ABK07081.1"
FT                   /translation="MSAQTAAPAYAAPAAHHDDPLLARAWDVLEAVPDPEIPVVSIREL
FT                   GILRDVRRADDGQLEVVITPTYSGCPAMSQIAEDIAAALQAADLPPHRIETVLAPAWTT
FT                   DWITQEARDKLRAYGIAPPVGQCGSAAPRENVVRFVPRPVAAPACPRCGSARTERLAQF
FT                   ASTACKALYRCIDCREPFDYFKPY"
FT   gene            complement(372795..373598)
FT                   /locus_tag="Bcen2424_0328"
FT   CDS_pept        complement(372795..373598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0328"
FT                   /product="phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaI subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   bcn:Bcen_2778 phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07082"
FT                   /protein_id="ABK07082.1"
FT                   /translation="MTITPEHLSYVLRLADNALILGQRNAEWCGHGPILEEDIALTNMS
FT                   LDLIGQARMLYTHAAELERQLTGATKTEDDYAYFRTEREFANFTLAELPHYGPVSGTAH
FT                   ADKDYAVTIVRNFLYAALMLHVWSALETSTDTQLAAIAAKSVKETRYHVQHAREWLVRL
FT                   GDGTDESHRRAQAALDYLMPYTREFFAADEIDDAIVAADIGPAPAAIEAAWRADVGDAL
FT                   AEATLTPPAPVKHVTTGKQGEHSEHMGYLLAEMQSLARQHPGASW"
FT   gene            complement(373609..373893)
FT                   /locus_tag="Bcen2424_0329"
FT   CDS_pept        complement(373609..373893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0329"
FT                   /product="phenylacetate-CoA oxygenase, PaaH subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaH subunit;
FT                   PFAM: phenylacetic acid degradation B; KEGG: bcn:Bcen_2777
FT                   phenylacetic acid degradation B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07083"
FT                   /protein_id="ABK07083.1"
FT                   /translation="MNKEWPIWEVFVRSKQGLDHKHCGSLHAADATMALRMARDVYTRR
FT                   QEGVSIWVVPSSAITASDPAEKAELFEPAGDKIYRHPTFYTLPDEVNHM"
FT   gene            complement(373930..374928)
FT                   /locus_tag="Bcen2424_0330"
FT   CDS_pept        complement(373930..374928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0330"
FT                   /product="phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaG subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   bcn:Bcen_2776 phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07084"
FT                   /protein_id="ABK07084.1"
FT                   /translation="MYTQSLDIPGNVAPLDAAAESPEQARFDAVMAADGKIEPQDWMPD
FT                   AYRKTLVRQISQHAHSEVVGMLPEGNWISRAPSLKRKAILLAKVQDEAGHGLYLYSAAE
FT                   TLGVSRDSLIDALHAGKAKYSSIFNYPTPTWADVGVIGWLVDGAAIMNQIPLCRCTYGP
FT                   YARAMIRVCKEESFHQRQGFDALLSMMKGSDAQRAMVQQAVDRWWWPVLMMFGPSDADS
FT                   VHSSQSAKWGIKRISNDDLRQKFVDATVDQAKVLGVTLPDPDLKWNEARGHHDYGTIDW
FT                   DEFWRVVNGDGPCNKERLATRVKAHEDGAWVREAALAHEAKRRARAEQHAA"
FT   gene            375135..376400
FT                   /locus_tag="Bcen2424_0331"
FT   CDS_pept        375135..376400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0331"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family; KEGG:
FT                   bcn:Bcen_2775 lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07085"
FT                   /protein_id="ABK07085.1"
FT                   /translation="MSFRSSFAAAVLGAAVLVAPLAASAAPAGWVAAWATALQPIPDLA
FT                   APPPLYRAPDVAGRTVRQIVYPTVSGRAARIRVSNAYGRAPLVVEAASLARAGDGAALA
FT                   GGAAVPVRFGGKASVTLAPGAELESDPVTIGVTAAQPYAISLQMGPDQRMTVWHRVSNQ
FT                   FNYVSAQGDHVSDPGAADFRTRFTQYAWVTELAVEAGSAHASVAAIGDSITDGLRSSVN
FT                   RNRRWPDALARRLTASGVDSIGVVNLGISGNRLLSDSACYGTSLASRFERDALSRSGVK
FT                   AAIVLIGINDINFAEMPPRAGLDCDHPHTQVTAASLIDGYRRLIEAAHRQGVKVFGATL
FT                   TPAALPAGREAIRLEVNRWIRSGGGFDGVVDFDAVLRDPARPSVLQRRYDSGDGIHPSD
FT                   AGYTAMAGAVPVERLQAAVGGK"
FT   sig_peptide     375135..375212
FT                   /locus_tag="Bcen2424_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 26"
FT   gene            377021..378498
FT                   /locus_tag="Bcen2424_R0007"
FT   rRNA            377021..378498
FT                   /locus_tag="Bcen2424_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            378563..378639
FT                   /locus_tag="Bcen2424_R0008"
FT                   /note="tRNA-Ile3"
FT   tRNA            378563..378639
FT                   /locus_tag="Bcen2424_R0008"
FT                   /product="tRNA-Ile"
FT   gene            378681..378756
FT                   /locus_tag="Bcen2424_R0009"
FT                   /note="tRNA-Ala4"
FT   tRNA            378681..378756
FT                   /locus_tag="Bcen2424_R0009"
FT                   /product="tRNA-Ala"
FT   gene            379032..381913
FT                   /locus_tag="Bcen2424_R0010"
FT   rRNA            379032..381913
FT                   /locus_tag="Bcen2424_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(383081..383536)
FT                   /locus_tag="Bcen2424_0332"
FT   CDS_pept        complement(383081..383536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07086"
FT                   /protein_id="ABK07086.1"
FT                   /translation="MVKQTPDAGCPGLAHVGLRSTTDESRCRGPTTSRRMNPAILYACA
FT                   IADDARQVQASLRPCCCRVECCCLAPTHLVVQPAHVSTWSLIAADLRRTRDIATALMRR
FT                   LVQLNAILRVGFYVGALPHLTFPKTMESRWVSPKHRHPTYAARQCSS"
FT   gene            384229..384314
FT                   /locus_tag="Bcen2424_R0011"
FT                   /note="tRNA-Tyr1"
FT   tRNA            384229..384314
FT                   /locus_tag="Bcen2424_R0011"
FT                   /product="tRNA-Tyr"
FT   gene            384358..384431
FT                   /locus_tag="Bcen2424_R0012"
FT                   /note="tRNA-Gly1"
FT   tRNA            384358..384431
FT                   /locus_tag="Bcen2424_R0012"
FT                   /product="tRNA-Gly"
FT   gene            384454..384528
FT                   /locus_tag="Bcen2424_R0013"
FT                   /note="tRNA-Thr1"
FT   tRNA            384454..384528
FT                   /locus_tag="Bcen2424_R0013"
FT                   /product="tRNA-Thr"
FT   gene            384595..385785
FT                   /locus_tag="Bcen2424_0333"
FT   CDS_pept        384595..385785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0333"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   bcn:Bcen_2774 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07087"
FT                   /db_xref="GOA:A0K3L0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3L0"
FT                   /protein_id="ABK07087.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIVKGSAKLALEGDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            385845..385920
FT                   /locus_tag="Bcen2424_R0014"
FT                   /note="tRNA-Trp1"
FT   tRNA            385845..385920
FT                   /locus_tag="Bcen2424_R0014"
FT                   /product="tRNA-Trp"
FT   gene            385963..386343
FT                   /locus_tag="Bcen2424_0334"
FT   CDS_pept        385963..386343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0334"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: bcn:Bcen_2773 SecE
FT                   subunit of protein translocation complex"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07088"
FT                   /protein_id="ABK07088.1"
FT                   /translation="MANPSVETVNTSGDKLMLALGVLLVLAGFVGFFWLTNQQWYVRGA
FT                   ALAVGIIAGVAVGLMSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMA
FT                   IFLWLSDKSIEWVIFSAILGWK"
FT   gene            386345..386902
FT                   /locus_tag="Bcen2424_0335"
FT   CDS_pept        386345..386902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0335"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: bcn:Bcen_2772 NusG antitermination factor;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: transcription antitermination protein NusG; KOW
FT                   domain protein; SMART: NGN domain protein; KOW (Kyrpides,
FT                   Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07089"
FT                   /protein_id="ABK07089.1"
FT                   /translation="MSDTPASPSGKRWYVVHAYSGMEKSVQRALQERIERAGMQDKFGQ
FT                   ILVPTEEVVEVKGGHKAVTERRFFPGYVLVEMEMTDETWHLVKNTAKVTGFVGGARNRP
FT                   TPISPKEVEKIMSQMQEGVEKPRPKTLFEVGEMVRVKEGPFTDFNGTVEEVNYEKSRVR
FT                   VSVTIFGRSTPVELEFGQVEKV"
FT   gene            387044..387475
FT                   /locus_tag="Bcen2424_0336"
FT   CDS_pept        387044..387475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0336"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: bcn:Bcen_2771
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07090"
FT                   /db_xref="GOA:A0K3L3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3L3"
FT                   /protein_id="ABK07090.1"
FT                   /translation="MAKKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQ
FT                   TQGMEPGLPVPVVITAFADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGSITRA
FT                   QAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV"
FT   gene            387476..388174
FT                   /locus_tag="Bcen2424_0337"
FT   CDS_pept        387476..388174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0337"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: bcn:Bcen_2770
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07091"
FT                   /db_xref="GOA:A0K3L4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3L4"
FT                   /protein_id="ABK07091.1"
FT                   /translation="MAKISKRRQAFAAKVDRQKLYAIEDALSLVKECASAKFDESIDVA
FT                   VQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQI
FT                   KAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQF
FT                   RVDKAGIIHATIGRASFEPTALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGV
FT                   RVDHATLAAQ"
FT   gene            388483..388980
FT                   /locus_tag="Bcen2424_0338"
FT   CDS_pept        388483..388980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0338"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: bcn:Bcen_2769
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07092"
FT                   /db_xref="GOA:A0K3L5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3L5"
FT                   /protein_id="ABK07092.1"
FT                   /translation="MPLNREDKQAVVAEVSAQVAKAQTVVLAEYRGIAVGDLTKLRAKA
FT                   REQQVYLRVLKNTLARRAVEGTPFAPLAEQMTGPLIYGISEDAIAAAKVVNDFSKSNEK
FT                   LVIKAGSFDGKVMDKAGVQALASIPSREELLSKLLFVMQSPVSGFARALAALAEKKQAE
FT                   AA"
FT   gene            389044..389418
FT                   /locus_tag="Bcen2424_0339"
FT   CDS_pept        389044..389418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0339"
FT                   /product="LSU ribosomal protein L12P / LSU ribosomal
FT                   protein L12P"
FT                   /note="PFAM: ribosomal protein L7/L12; KEGG: bcn:Bcen_2768
FT                   ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07093"
FT                   /db_xref="GOA:A0K3L6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3L6"
FT                   /protein_id="ABK07093.1"
FT                   /translation="MAIAKEDILAAVEGMTVLELNELVKAFEEKFGVSAAAVAVAGPAG
FT                   GGAAAAAEEKTEFTVVLAEAGANKVSVIKAVRELTGLGLKEAKDLVDGAPKPVKEGVDK
FT                   AAAEEAKKKLEEAGAKVEVK"
FT   gene            389800..393906
FT                   /locus_tag="Bcen2424_0340"
FT   CDS_pept        389800..393906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0340"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: bcn:Bcen_2767 DNA-directed RNA polymerase,
FT                   beta subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2, domain 6; RNA
FT                   polymerase Rpb2, domain 7; RNA polymerase Rpb2, domain 2;
FT                   RNA polymerase beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07094"
FT                   /db_xref="GOA:A0K3L7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3L7"
FT                   /protein_id="ABK07094.1"
FT                   /translation="MQYSFTEKKRIRKSFAKRPIVHQVPFLLATQLESFSTFLQADVPA
FT                   TQRKPEGLQAAFTSVFPIVSHNGFARLEFVSYALSSPAFNIKECQQRGLTYCSALRAKV
FT                   RLVILDKESPNKPVVKEVKEQEVYMGEIPLMTPTGSFVINGTERVIVSQLHRSPGVFFE
FT                   HDKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDILYFRVDRRRKMPVTILLKAIGLTP
FT                   EQILANFFVFDNFTLMDEGAQLEFVPERLRGEVARFDITDRDGKVIVQKDKRINAKHIR
FT                   DLEAAKTKFISVPEDYLLGRVLAKNVVDGDTGEVIASANDEVTESVLEKLREAGIKDIQ
FT                   TLYTNDLDQGPYISSTLRVDETTDKTAARIAIYRMMRPGEPPTEEAVEALFNRLFYSEE
FT                   AYDLSKVGRMKFNRRVGRDEIVGPMTLQDDDILATIKILVELRNGKGEVDDIDHLGNRR
FT                   VRCVGELAENQFRAGLVRVERAVKERLGQAESENLMPHDLINSKPISSAIREFFGSSQL
FT                   SQFMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIG
FT                   LINSLALYAHLNEYGFLETPYRKVVDSKVTDQIDYLSAIEEGRYMIAQANAAIDENGQL
FT                   IDELVSSREAGETMMVTPDRIQYMDVAPSQIVSVAASLIPFLEHDDANRALMGSNMQRQ
FT                   AVPCLRPEKPVVGTGIERTCAVDSGTTVQAFRGGVVDYVDAGRIVIRVNDDEAVAGEVG
FT                   VDIYNLIKYTRSNQNTNINQRPIVKMGDKVSRGDVLADGASTDLGELALGQNMLIAFMP
FT                   WNGYNFEDSILISEKVVADDRYTSIHIEELNVVARDTKLGPEEITRDISNLAEVQLGRL
FT                   DESGIVYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSGM
FT                   SGTVIDVQVFTREGIQRDKRAQQIIDDELKRYRLDLNDQLRIVEGDAFQRLARMLVGKV
FT                   ANGGPKKLAKGTKIDQAYLEDLDHYHWFDIRLADDEAAAQLEAIKNSIEEKRHQFDLAF
FT                   EEKRKKLTQGDELPPGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIVPIEDMPYM
FT                   ADGRPADVVLNPLGVPSRMNVGQVLEVHLGWAAKGLGWRIGEMLQRQAKIEELRTFLTK
FT                   IYNESGRQEDLESFTDDEILELAKNLREGVPFATPVFDGATEEEMGKMLDLAFPDDIAE
FT                   QLGMNPSKNQVRLYDGRTGEMFERRVTLGYMHYLKLHHLVDDKMHARSTGPYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVKSDDVTGRTKVYENLVKGDHVIDA
FT                   GMPESFNVLVKEIRSLGIDIDLDRN"
FT   gene            393928..398169
FT                   /locus_tag="Bcen2424_0341"
FT   CDS_pept        393928..398169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0341"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: bcn:Bcen_2766 DNA-directed RNA polymerase,
FT                   subunit beta-prime; TIGRFAM: DNA-directed RNA polymerase,
FT                   beta' subunit; PFAM: RNA polymerase, alpha subunit; RNA
FT                   polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07095"
FT                   /db_xref="GOA:A0K3L8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3L8"
FT                   /protein_id="ABK07095.1"
FT                   /translation="MKALLDLFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLAKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAYVVIEPGMTPLKARQIMTEE
FT                   DYYNKVEEYGDEFRAEMGAEGVRELLRAINIDEQVETLRTELKNTGSEAKIKKYAKRLK
FT                   VLEAFQRSGIKPEWMILEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLELKAPEIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRPLKSLADMIKGKGGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLKLHQCGLPKLMALELFKPFIFNKLEVMGVATTIKAAKK
FT                   EVENQTPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLFPANGDPSIVPSQDIVLGLYYATREA
FT                   VNGKGEGLSFTGVSEVIRAYENKEVELASRVNVRITEMVHNEDKSEGAPPFVPKITLYA
FT                   TTVGRAILSEILPHGLPFSVLNKPLKKKEISRLINTAFRKCGLRATVVFADQLMQSGFR
FT                   LATRAGISICVDDMLVPPQKETIVGDAAKKVKEYDRQYMSGLVTAQERYNNVVDIWSAT
FT                   SEAVGKAMMEQLSTEPVTDRDGNETRQESFNSIYMMADSGARGSAVQIRQLAGMRGLMA
FT                   KPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDL
FT                   VVVEDDCGTSNGVAMKALVEGGEVVEALRDRILGRVAVADVVNPETQETLYESGTLLDE
FT                   TAVEEIERLGIDEVRVRTPLTCETRYGLCAACYGRDLGRGSLVNVGEAVGVIAAQSIGE
FT                   PGTQLTMRTFHIGGAASRAAVASSVEAKSNGIVRFTATMRYVTNAKGEQIVISRSGEAM
FT                   ITDDFGRERERHKVPYGATLLQLDGATIKAGTQLATWDPLTRPIITEYGGTVKFENVEE
FT                   GVTVAKQIDDVTGLSTLVVIDVKRRGSQASKSVRPQVKLLDANGEEVKIPGTEHAVQIG
FT                   FQVGALITVKDGQQVQVGEVLARIPTEAQKTRDITGGLPRVAELFEARSPKDAGILAEV
FT                   TGTTSFGKDTKGKQRLVITDLEGNQHEFLIAKEKQVLVHDAQVVNKGEMIVDGPADPHD
FT                   ILRLQGIEALSRYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVQITDNGDTRFIPGE
FT                   QVERSDMLDENDRMIAEGKRPASYDNVLLGITKASLSTDSFISAASFQETTRVLTEAAI
FT                   MGKRDDLRGLKENVIVGRLIPAGTGLAFHKARKAKESSDRERFDQIAAEEAFDFGTPSA
FT                   PAEEPQHPAAE"
FT   gene            398447..400294
FT                   /locus_tag="Bcen2424_0342"
FT   CDS_pept        398447..400294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0342"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; KEGG: bcn:Bcen_2765 ATP-dependent DNA helicase
FT                   RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07096"
FT                   /protein_id="ABK07096.1"
FT                   /translation="MSRALEILDEVFGYSAFRGQQGEIVEHVAGGGDCLVLMPTGGGKS
FT                   LCYQIPALLRREAGQGAGIVVSPLIALMQDQVAALSEVGVRAAYLNSTLSGAEAAATER
FT                   ALREGEIDLLYVAPERLMTGRFLELLERAKIGLFAIDEAHCVSQWGHDFRPEYIQLSVL
FT                   HERFPSVPRIALTATADAITRDEIIHRLALDDARVFVSSFDRPNIRYRIVEKDNARSQL
FT                   LDFIRAEHTNADGTTDAGVVYCLSRRKVEETAEWLKAQGVRALPYHAGMEFEVRQKHQE
FT                   MFQREEGIVMCATIAFGMGIDKPDVRFVAHLDLPKSVEGYYQETGRAGRDGMPANAWMA
FT                   YGLGDVVQQRKMIDESDADDAHKRVQTSKLDALLGLCETISCRRVRLLNYFGEASQPCG
FT                   NCDTCLEPPASWDATREAQMALSCVFRAQRASGFNFGSSHLIEILRGGRTEKVLQRGHD
FT                   QLSTFGIGAALSEPEWRAIFRQLVAYGYLAVDHGGFGALMLTEAAKPVLKNEEKVTLRR
FT                   YVKPQRTRQSSSRSGTRVDPTAGMGARERARWDALRAWRAETAKTDGVPAYVIFHDATL
FT                   AEIARNAPETIDDLRHIPGMGVRKLERFGDEIIDVVESA"
FT   gene            400521..400901
FT                   /locus_tag="Bcen2424_0343"
FT   CDS_pept        400521..400901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0343"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: bcn:Bcen_2764 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07097"
FT                   /db_xref="GOA:A0K3M0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3M0"
FT                   /protein_id="ABK07097.1"
FT                   /translation="MPTINQLVRKGRQSETTKSKSPALQDCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDT
FT                   QGVKDRKQARSKYGAKRAKAAK"
FT   gene            401074..401544
FT                   /locus_tag="Bcen2424_0344"
FT   CDS_pept        401074..401544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0344"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: bcn:Bcen_2763
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07098"
FT                   /db_xref="GOA:A0K3M1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3M1"
FT                   /protein_id="ABK07098.1"
FT                   /translation="MPRRREVPKREVLPDPKFGNVDVAKFMNMLMLSGKKSVAERIVYG
FT                   AFEQIQTKGGKDPLEVFTVALNNVKPVVEVKSRRVGGANYQVPVEVRPSRRMALAMRWL
FT                   REAAKKRSEKSMALRLAGELSEAAEGRGGAMKKRDEVHRMAEANRAFSHFRF"
FT   gene            401668..403770
FT                   /locus_tag="Bcen2424_0345"
FT   CDS_pept        401668..403770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0345"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: bcn:Bcen_2762 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07099"
FT                   /protein_id="ABK07099.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWKGMGGNYPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQLRLRLK
FT                   ANPVPVVVPIGAEENFKGVVDLIKMKAIIWDEASQGTKFDYVDIPAELAETCKEWREKM
FT                   VEVAAEASEDLMNKYLEEGDLPEADIVKALRDRTIACEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDFLPSPVDIPPVKGELENGEEAERKASDEEKFSSLAFKIMTDPFVGQLIFFRVYSGV
FT                   VNSGDTLLNSTKGKKERLGRILQMHANQREEIKEVRAGDIAAAVGLKEATTGDTLCDPA
FT                   NPIVLERMVFPEPVISQAVEPKTKADQEKMGLALNRLAQEDPSFRVQTDEESGQTIISG
FT                   MGELHLEILVDRMKREFGVEATVGKPQVAYRETIRSTAKDVDGKFVKQSGGRGQYGHAV
FT                   ITLEPNEQGKGYEFFDEIKGGVIPREYIPAVDKGIQDTLKSGVLAGFPVVDVKVHLTFG
FT                   SYHDVDSNENAFRMAGSMAFKEAMRKANPVVLEPMMAVEVETPEDYMGNVMGDLSGRRG
FT                   IVQGMEDMVGGGKIVRAEVPLSEMFGYSTSLRSLTQGRATYTMEFKHYAEAPRNVAEAI
FT                   ISAKSK"
FT   gene            403812..405002
FT                   /locus_tag="Bcen2424_0346"
FT   CDS_pept        403812..405002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0346"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   bcn:Bcen_2774 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07100"
FT                   /db_xref="GOA:A0K3L0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3L0"
FT                   /protein_id="ABK07100.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIVKGSAKLALEGDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            405290..405601
FT                   /locus_tag="Bcen2424_0347"
FT   CDS_pept        405290..405601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0347"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: bcn:Bcen_2760
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07101"
FT                   /db_xref="GOA:A0K3M4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3M4"
FT                   /protein_id="ABK07101.1"
FT                   /translation="MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTR
FT                   IQRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            405777..406430
FT                   /locus_tag="Bcen2424_0348"
FT   CDS_pept        405777..406430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0348"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: bcn:Bcen_2759
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07102"
FT                   /db_xref="GOA:A0K3M5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3M5"
FT                   /protein_id="ABK07102.1"
FT                   /translation="MMSLGLVGRKVGMTRIFTAEGDSIPVTVLDVSDNRVTQIKTVETD
FT                   GYTAVQVAFGSRRASRVTKPLAGHLAKAGVEAGEILKEFRIDAAKAAELSNGAVVGADL
FT                   FEVGQKVDVQGVSIGKGYAGTIKRYNFSSGRATHGNSRSHNVPGSIGMAQDPGRVFPGK
FT                   RMTGHMGDVTVTVQNLEIARIDAERKLLLVKGAIPGAKGGKVFVTPAVKTKGAK"
FT   gene            406430..407050
FT                   /locus_tag="Bcen2424_0349"
FT   CDS_pept        406430..407050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0349"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: bcn:Bcen_2758
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07103"
FT                   /db_xref="GOA:A0K3M6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3M6"
FT                   /protein_id="ABK07103.1"
FT                   /translation="MELKLLNENGQEGAVVNASDVVFGRDYNEALIHQVVVAYQANARQ
FT                   GNRAQKDREQVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIFPNSPEENFSHKVNKK
FT                   MHRAGLCSIFSQLAREGRLSVVEDIILEAPKTKLLADKFKTMGLDSVLIITDTVDENLY
FT                   LASRNLPHVAIVEPRYADPLSLIYFKKVLVTKAAVAQIEELLS"
FT   gene            407047..407361
FT                   /locus_tag="Bcen2424_0350"
FT   CDS_pept        407047..407361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0350"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: bcn:Bcen_2757
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07104"
FT                   /db_xref="GOA:A0K3M7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3M7"
FT                   /protein_id="ABK07104.1"
FT                   /translation="MSEIRKNDHRLMQVLLAPVISEKATLVADKNEQVVFEVAPDATKQ
FT                   EVKAAVELLFKVEVDSVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAEAK
FT                   "
FT   gene            407364..408191
FT                   /locus_tag="Bcen2424_0351"
FT   CDS_pept        407364..408191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0351"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: bcn:Bcen_2756
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07105"
FT                   /db_xref="GOA:A0K3M8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3M8"
FT                   /protein_id="ABK07105.1"
FT                   /translation="MAIVKVKPTSPGRRAMVKVVNKNLHQGKPFAALLDSQSSTAGRNN
FT                   NGRITTRHKGGGHKQHYRIVDFRRTKDGIPAKVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGLTVGQQLMSGSEAPIRAGNTLPIRNIPVGTTIHCIEMLPGKGAQMARSAGTSAM
FT                   LLAREGVYAQVRLRSGEIRRVHIECRATVGEVGNEEHSLRQIGKAGANRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGKTAAGRDPVSPWGTPAKGYRTRSNKRTTTMIVQRRHKR"
FT   gene            408202..408477
FT                   /locus_tag="Bcen2424_0352"
FT   CDS_pept        408202..408477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0352"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: bcn:Bcen_2755 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07106"
FT                   /db_xref="GOA:A0K3M9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3M9"
FT                   /protein_id="ABK07106.1"
FT                   /translation="MARSVKKGPFCDAHLLKKVEAAAASRDKKPIKTWSRRSTILPDFI
FT                   GLTIAVHNGRQHVPVYISENMVGHKLGEFALTRTFKGHAADKKAKK"
FT   gene            408490..408819
FT                   /locus_tag="Bcen2424_0353"
FT   CDS_pept        408490..408819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0353"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: bcn:Bcen_2754 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07107"
FT                   /db_xref="GOA:A0K3N0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N0"
FT                   /protein_id="ABK07107.1"
FT                   /translation="MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAG
FT                   IVKKVVLSAIANAEHNEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHIT
FT                   VTVGN"
FT   gene            408831..409631
FT                   /locus_tag="Bcen2424_0354"
FT   CDS_pept        408831..409631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0354"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: bcn:Bcen_2753 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07108"
FT                   /db_xref="GOA:A0K3N1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N1"
FT                   /protein_id="ABK07108.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKK
FT                   KLKNASVGRVVIERPAKNARITIYSSRPGVVIGKKGEDIEQLKTELQRRMGVPVHVNIE
FT                   EIRKPETDAQLIADSITQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAED
FT                   KRPRRNARPGDRRPRRDGEGGAPGARRGAPRRGAGKPEDGKTGE"
FT   gene            409634..410050
FT                   /locus_tag="Bcen2424_0355"
FT   CDS_pept        409634..410050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0355"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: bcn:Bcen_2752
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07109"
FT                   /db_xref="GOA:A0K3N2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N2"
FT                   /protein_id="ABK07109.1"
FT                   /translation="MLQPKRRKYRKEQKGRNTGKATRGNAVSFGEFGLKAIGRGRLTAR
FT                   QIEAARRAMTRHIKRGGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLY
FT                   EMDGVTEELAREAFRLAAAKLPLKTAFIVRQLGA"
FT   gene            410060..410254
FT                   /locus_tag="Bcen2424_0356"
FT   CDS_pept        410060..410254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0356"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: bcn:Bcen_2751
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07110"
FT                   /db_xref="GOA:A0K3N3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N3"
FT                   /protein_id="ABK07110.1"
FT                   /translation="MKASELLQKDQAALNKELADLLKAQFGLRMQLATQQLTNTSQLKK
FT                   VRRDIARVRTVMTQKANQK"
FT   gene            410251..410523
FT                   /locus_tag="Bcen2424_0357"
FT   CDS_pept        410251..410523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0357"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: bcn:Bcen_2750
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07111"
FT                   /db_xref="GOA:A0K3N4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N4"
FT                   /protein_id="ABK07111.1"
FT                   /translation="MNDSVKTSLKRTLVGRVVSNKMDKTVTVLIEHRVKHPIYGKYVVR
FT                   SKKYHAHDEANTYNEGDLVEIQETRPVSKTKAWTVSRLVEAARVI"
FT   gene            410832..411200
FT                   /locus_tag="Bcen2424_0358"
FT   CDS_pept        410832..411200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0358"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: bcn:Bcen_2749 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07112"
FT                   /db_xref="GOA:A0K3N5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N5"
FT                   /protein_id="ABK07112.1"
FT                   /translation="MIQTESRLEVADNTGAREVLCIKVLGGSKRRYAGIGDIIKVSVKE
FT                   ATPRGRVKKGEIYNAVVVRTAKGVRRQDGSLIKFDGNAAVLLNNKLEPIGTRIFGPVTR
FT                   ELRSERFMKIVSLAPEVL"
FT   gene            411210..411518
FT                   /locus_tag="Bcen2424_0359"
FT   CDS_pept        411210..411518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0359"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: bcn:Bcen_2748 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07113"
FT                   /db_xref="GOA:A0K3N6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N6"
FT                   /protein_id="ABK07113.1"
FT                   /translation="MNKIRKGDEVIVVTGKDKGKRGVVLAVGAEHVTVEGINLVKKHVK
FT                   PNPMKGTTGGVEAKTMPLHISNVALVDANGKASRVGIKVEEGKKVRFLKTTGAVLSA"
FT   gene            411535..412074
FT                   /locus_tag="Bcen2424_0360"
FT   CDS_pept        411535..412074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0360"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: bcn:Bcen_2747
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07114"
FT                   /db_xref="GOA:A0K3N7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N7"
FT                   /protein_id="ABK07114.1"
FT                   /translation="MARFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIA
FT                   DKKIIENAVGDLTKIAGQKPVVTKARKAIAGFKIRQGYPIGAMVTLRGQAMYEFLDRFV
FT                   TVALPRVRDFRGVSGRAFDGRGNYNIGVKEQIIFPEIDYDKIDALRGLNISITTTAKTD
FT                   DEAKALLASFKFPFRN"
FT   gene            412082..412387
FT                   /locus_tag="Bcen2424_0361"
FT   CDS_pept        412082..412387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0361"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: bcn:Bcen_2746
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07115"
FT                   /db_xref="GOA:A0K3N8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N8"
FT                   /protein_id="ABK07115.1"
FT                   /translation="MAKLALIEREKKRARLVAKFAAKREALKAIVEDQSKSEEERYEAR
FT                   LELQQLPRNANPTRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW"
FT   gene            412402..412797
FT                   /locus_tag="Bcen2424_0362"
FT   CDS_pept        412402..412797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0362"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bcn:Bcen_2745
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07116"
FT                   /db_xref="GOA:A0K3N9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3N9"
FT                   /protein_id="ABK07116.1"
FT                   /translation="MSMSDPIADMLTRIRNAQMVEKVSVAMPSSKVKVAIAQVLKDEGY
FT                   IDDFAVKAEGAKSELNIALKYYAGRPVIERLERVSKPGLRVYRGRNDIPQVMNGLGVAI
FT                   VSTPKGVMTDRKARATGVGGEVICYVA"
FT   gene            412816..413346
FT                   /locus_tag="Bcen2424_0363"
FT   CDS_pept        412816..413346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0363"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: bcn:Bcen_2744
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07117"
FT                   /db_xref="GOA:A0K3P0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P0"
FT                   /protein_id="ABK07117.1"
FT                   /translation="MSRVGKSPIALQGAEVKLADGAITVKGPLGTITQAINPLVNVANN
FT                   DGTLNLSPVDESREANALSGTMRAIIANAVHGVTKGFERKLTLVGVGYRAQAQGDKLNL
FT                   SLGFSHPVVHQMPEGVKAETPTQTEIVIKGINKQQVGQVAAEVRGYRPPEPYKGKGVRY
FT                   ADEVVILKETKKK"
FT   gene            413359..413724
FT                   /locus_tag="Bcen2424_0364"
FT   CDS_pept        413359..413724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0364"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: bcn:Bcen_2743 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07118"
FT                   /db_xref="GOA:A0K3P1"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P1"
FT                   /protein_id="ABK07118.1"
FT                   /translation="MDKTQSRLRRARQTRIKIAELQVARLAVHRTNTHIYAQVFSPCGT
FT                   KVLASASTLEAEVRAELADKSGKGGNVNAATLIGKRIAEKAKAAGIESVAFDRSGFRYH
FT                   GRVKALAEAAREAGLKF"
FT   gene            413739..414257
FT                   /locus_tag="Bcen2424_0365"
FT   CDS_pept        413739..414257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0365"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="PFAM: ribosomal protein S5; ribosomal protein S5
FT                   domain protein; KEGG: bcn:Bcen_2742 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07119"
FT                   /db_xref="GOA:A0K3P2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P2"
FT                   /protein_id="ABK07119.1"
FT                   /translation="MAKMQAKVQADERDDGLREKMISVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRIGMGKGKAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAP
FT                   AKAGTGVIAGGPMRAVFDVMGVQNVVAKSHGSTNPYNLVRATLDGLRKQSTPADIAAKR
FT                   GKSVEDILG"
FT   gene            414273..414455
FT                   /locus_tag="Bcen2424_0366"
FT   CDS_pept        414273..414455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0366"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: bcn:Bcen_2741
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07120"
FT                   /db_xref="GOA:A0K3P3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P3"
FT                   /protein_id="ABK07120.1"
FT                   /translation="MSEKTVKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDTPAV
FT                   RGMINKVSYLVKVIA"
FT   gene            414482..414916
FT                   /locus_tag="Bcen2424_0367"
FT   CDS_pept        414482..414916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0367"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: bcn:Bcen_2740
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07121"
FT                   /db_xref="GOA:A0K3P4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P4"
FT                   /protein_id="ABK07121.1"
FT                   /translation="MELNNLKPAAGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRSGGF
FT                   HKVGFEGGQMPLQRRLPKRGFTSLTKEFVGEVRLSDLEKLPVDEIDLLALKQAGLVGEL
FT                   TKSAKIIATGELKRKIVVKGLGATKGARAAIEAAGGSFAE"
FT   gene            414959..416308
FT                   /locus_tag="Bcen2424_0368"
FT   CDS_pept        414959..416308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0368"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: bcn:Bcen_2739 SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07122"
FT                   /protein_id="ABK07122.1"
FT                   /translation="MANSPSLAKPGRSTAKFGDLRRRAMFLLLALIVYRIGAHIPVPGI
FT                   DPDQLAKLFQSQAGGILGMFNMFSGGALSRFTIFALGIMPYISASIIMQLLAIVSPQLE
FT                   ALKKEGQAGQRKITQYTRYFTVVLATFQAFGIAAALENQPGLVTDPGMLFRLTTVVTLV
FT                   TGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAVGGLFELVRTGSMSIISAIIIV
FT                   VLIAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLPLKLNMSGVIPPIFASSI
FT                   ILFPATILGWFSTGQPTGSWISNTLHNVAEALKPGQPVYVLLYTLAIVFFCFFYTALVF
FT                   NSRETADNLKKSGAFVPGIRPGDQTARYIDRILTRLTLAGAIYIVFVCLLPEFLVLRWN
FT                   VPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKGGNIPMR"
FT   gene            416316..416534
FT                   /locus_tag="Bcen2424_0369"
FT   CDS_pept        416316..416534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0369"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1, IF1 family protein;
FT                   KEGG: bcn:Bcen_2738 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07123"
FT                   /db_xref="GOA:A0K3P6"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P6"
FT                   /protein_id="ABK07123.1"
FT                   /translation="MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYI
FT                   RILPGDKVTVELTPYDLSRARIVFRAK"
FT   gene            416555..416671
FT                   /locus_tag="Bcen2424_0370"
FT   CDS_pept        416555..416671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0370"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: bcn:Bcen_2737
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07124"
FT                   /db_xref="GOA:A0K3P7"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P7"
FT                   /protein_id="ABK07124.1"
FT                   /translation="MKVMASVKRICRNCKIIKRKGVVRVICSSDPRHKQRQG"
FT   gene            416710..417075
FT                   /locus_tag="Bcen2424_0371"
FT   CDS_pept        416710..417075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0371"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: bcn:Bcen_2736
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07125"
FT                   /db_xref="GOA:A0K3P8"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P8"
FT                   /protein_id="ABK07125.1"
FT                   /translation="MARIAGVNIPNHQHTEIGLTAIFGVGRTRSRSICVAAGVDFSKKV
FT                   KDLTDADLEKLREEVGKFVVEGDLRREVTMNIKRLMDLGCYRGVRHRKGLPMRGQRTRT
FT                   NARTRKGPRRAAQALKK"
FT   gene            417104..417505
FT                   /locus_tag="Bcen2424_0372"
FT   CDS_pept        417104..417505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0372"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bcn:Bcen_2735
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07126"
FT                   /db_xref="GOA:A0K3P9"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3P9"
FT                   /protein_id="ABK07126.1"
FT                   /translation="MAKASNTAAQRVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNA
FT                   LAWATSGGQGFKGSRKSTPFAAQVAAESAGRVAMEYGVKNLEVRIKGPGPGRESAVRAL
FT                   HGLGIKITAISDVTPIPHNGCRPPKRRRI"
FT   gene            417660..418283
FT                   /locus_tag="Bcen2424_0373"
FT   CDS_pept        417660..418283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0373"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: bcn:Bcen_2734 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07127"
FT                   /db_xref="GOA:A0K3Q0"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3Q0"
FT                   /protein_id="ABK07127.1"
FT                   /translation="MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTS
FT                   GARTSDYGTQLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDVVAIREKAKKQARIVEALSLA
FT                   EQGGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR"
FT   gene            418408..419385
FT                   /locus_tag="Bcen2424_0374"
FT   CDS_pept        418408..419385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0374"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: bcn:Bcen_2733 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07128"
FT                   /db_xref="GOA:A0K3Q1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3Q1"
FT                   /protein_id="ABK07128.1"
FT                   /translation="MQTSLLKPKIIAVESLGENHARVVMEPFERGYGHTLGNALRRVLL
FT                   SSMVGYAPTEVTIAGVVHEYSTLDGVQEDVVNLLLNLKGVVFKLHNRDEVTVTLRKEGE
FT                   GVVTAGDIELAHDCEVINPNHVIAHLSKGGKLDVQIKIEKGRGYVPGNVRRYGEDTAKI
FT                   IGRIVLDASFSPVRRVSYAVESARVEQRTDLDKLVMNIETSGVITPEEAIRQSARILVD
FT                   QLSVFAALEGTETAAEAPSRAPQIDPILLRPVDDLELTVRSANCLKAENIYYIGDLIQR
FT                   TENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLDK"
FT   gene            419535..419930
FT                   /locus_tag="Bcen2424_0375"
FT   CDS_pept        419535..419930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0375"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: bcn:Bcen_2732
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07129"
FT                   /db_xref="GOA:A0K3Q2"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3Q2"
FT                   /protein_id="ABK07129.1"
FT                   /translation="MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEHEVIKTTLPKAKELR
FT                   KVVEPLITLGKKPSLANRRLAFNRLRDRDSVAKLFDVLGPRFANRPGGYLRVLKFGFRV
FT                   GDNAPMALVELLDRPEVDETENVQEAE"
FT   gene            420133..420456
FT                   /locus_tag="Bcen2424_0376"
FT   CDS_pept        420133..420456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0376"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   bcn:Bcen_2731 CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07130"
FT                   /protein_id="ABK07130.1"
FT                   /translation="MIVVLMLTTVPDAVTAAALADGALDGRLAACVSELGTIKSRYHWQ
FT                   GKVETADEIQLLFKTSPVRALELERFILAHHPYETPEIVSWQTASAAYGQWVTSETQRL
FT                   FHV"
FT   gene            420449..422296
FT                   /locus_tag="Bcen2424_0377"
FT   CDS_pept        420449..422296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0377"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; Thioredoxin domain; KEGG: bcn:Bcen_2730
FT                   protein-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07131"
FT                   /protein_id="ABK07131.1"
FT                   /translation="MFNGMALSVRVRALRFLAVLLSFVFVLSGLSAARAADDFLDPSVA
FT                   FKFSASESPGQVDVRFKIANGYYMYRERFAFAVKSGQATLGEPQFPAGHVKFDQTFQKN
FT                   VETYRDEVVVHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVMKVDGAALGAASSSGD
FT                   TAAAGSWFDKVTSADFAQSLLEGHGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIG
FT                   QGTRATHARGFALSLTYVVGMALVYTVLGIAAALVGQSLGAWLQNPWVLGAFAVLLTAF
FT                   AVSLISGKDIALPERWQNGAAEASSARQGGHFVAVAAMGALSALVVGACMTAPLFAVLA
FT                   FIAHTGNALLGGAALFAMGLGLGVPLLVVGVGAGTVLPRAGAWMDGVKVFFGIVLLAAA
FT                   LWIVWPVLAGALKMVLAALWLLIAAAALGLFTPNAGAASIWRRLGRGVGAALAIWAATL
FT                   LVGLAAGSTDPVKPLAVLAARTVASGGAATAGAAAAQDGPAFASVRSSGELDALLKTSG
FT                   QPVMLDFYADWCVSCKEMEHLTFTDARVQARLAKLHLVRADVTANNPDDQALLKRFNLF
FT                   GPPGIIFFDRNGNEISRVVGYQAADTFLRSLDRAAVPTV"
FT   sig_peptide     420449..420556
FT                   /locus_tag="Bcen2424_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.859 at
FT                   residue 36"
FT   gene            complement(422425..423423)
FT                   /locus_tag="Bcen2424_0378"
FT   CDS_pept        complement(422425..423423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0378"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   bcn:Bcen_2729 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07132"
FT                   /protein_id="ABK07132.1"
FT                   /translation="MSFHPLHRPRRMRRDDFSRRLMRENRLTTDDLIYPVFVVEGTQQR
FT                   QPIPSMPGVERVSVDLLMHVAEQCVELGVPVLSLFPAIDPSVKTPDGREAANPEGLIPR
FT                   AVRELKKRFPELGVLTDVALDPYTSHGQDGVLDENGYVINDDTIEILIEQARAQAEAGV
FT                   DIVAPSDMMDGRIGAIREMLESDGHIHTRIMAYSAKFASAFYGPFRDAVGSASNLGKGN
FT                   KMTYQMDPANSDEALREVRLDIDEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSG
FT                   EYAMLKAAAMNGWLDHDKVVLESLLAFKRAGADGVLTYFALDAARLLKAQR"
FT   gene            complement(423676..424335)
FT                   /locus_tag="Bcen2424_0379"
FT   CDS_pept        complement(423676..424335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0379"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   bcn:Bcen_2728 GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07133"
FT                   /db_xref="GOA:A0K3Q6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3Q6"
FT                   /protein_id="ABK07133.1"
FT                   /translation="MAFLLHQARFYTTVNHLRDLPPTVQPEIAFAGRSNAGKSTAINVL
FT                   CNQKRLAFASKTPGRTQHINYFSVGPAAEPVANLVDLPGYGYAEVPGAAKAHWEMLLSS
FT                   YLATRSQLCGLILMMDSRRPLTDLDRRMIEWFAPTGKPIHTLLTKCDKLTRQESINALR
FT                   NTQKGLDAYRDQGVKGKLTVQLFSALKRTGLDEAHELIESWLRPSVADEKSEPVAQ"
FT   gene            424550..425203
FT                   /locus_tag="Bcen2424_0380"
FT   CDS_pept        424550..425203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0380"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: bcn:Bcen_2727
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07134"
FT                   /protein_id="ABK07134.1"
FT                   /translation="MNRLCKSLMVLQVAAGFVGFVAEANAADAAKPDLDRGKAIAGQVC
FT                   ASCHGADGNSASGSFPKLAGQHPEYLVKQLNDFKTQPGAKGPVRNNAVMVGFASALSAD
FT                   DMRNVAAYYGSQTTKLGTARDAATVPVGQKIYRGGIAEKGVPACASCHGPTGQGIPVQY
FT                   PRLSGQWADYTVAQLTAFQQGAGARNNNEAMHQIASRLSDTEIKAVADYIAGLR"
FT   sig_peptide     424550..424630
FT                   /locus_tag="Bcen2424_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.805 at
FT                   residue 27"
FT   gene            425426..427639
FT                   /locus_tag="Bcen2424_0381"
FT   CDS_pept        425426..427639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0381"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: bcn:Bcen_2726
FT                   ResB-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07135"
FT                   /protein_id="ABK07135.1"
FT                   /translation="MSVTTSGLQSKSGQGASKRAVELLSSMRFAIALLVVLSIASIIGT
FT                   VLTQDDPYPNYVNQFGPFWADIFRSLSLYTVYSAWWFMLILIFLVVSISLCVIRNAPKM
FT                   LADAKSWKDKVREGSLRAFHHKAEYAASGTRASVAATLATFVTKAGYKHVVRETDGATL
FT                   ISAKRGAMTKWGYISAHLAIVVICIGGLLDSNLPIKFQMWIFGKSPVNTSATISEISPD
FT                   HRLSASNPTFRGYAWVPEGQFVSTAILNQPSGSLIQDLPFSIQLDKFIVDYYTTGMPKL
FT                   FASDIVVIDRETGRKIPARVEVNKPFTYKGVSIYQSSFQDGGSQMQMTAYPMTGSQAAT
FT                   VPVKGTIGSSAPLQVPGADGDTIEFSDFRAINVENMADAKGKPDVRGVATTSSLKEVFD
FT                   ERLGSGAKTSKPTQLHNIGPSVQYKIRGKDGQAREFNNYMLPVDMNGERVFLAGVRASP
FT                   NDPFRYMRIPADSQDSIGEWMRLRAALEDPAVRTEAAARFAQRSLPGDASLRGRLQDSA
FT                   SKVLTLFAASDDSIGRGADGQPVGGFQAVATFIDRSVPKGEQEKAASLLLRMLEGSMWE
FT                   VWQIARERAGEPAAQQGTDTIRFVQNAINALSDSFLYGSPVYLQLDSFKQVQASVFQLT
FT                   RAPGKNLVYLGSLLLVAGIFSMFYVRERRLWFWLKDAGSGVDVVMAMSTARKTFDFEKE
FT                   FVQTRDAAGAALRAAPRDAAPAGAASTARPPAGGGSDSENSTR"
FT   gene            427644..428834
FT                   /locus_tag="Bcen2424_0382"
FT   CDS_pept        427644..428834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0382"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   bcn:Bcen_2725 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07136"
FT                   /protein_id="ABK07136.1"
FT                   /translation="MDLTQVSSSRTASAPAPSSSPLFDERPFLARLSLFDWLFALALVA
FT                   GAGYALVHYNAHMDYYDKAVMIGTVPALVALGWRWKPARLMMASIAVLSLLSIQIYQGD
FT                   LAHADSAFFLKYFLSSQSAILWMSALFVLATIFYWIGLLARSETGAAIGQKLTWVAVLM
FT                   GFTGLMVRWYESYLIGADVGHIPVSNLYEVFVLFSLITALLYLYYEGHYGTRSLGAFVL
FT                   LVISAAVGFLMWYSVARDAQQIQPLVPALQSWWMKIHVPANFIGYGSFALSAMVSVAYL
FT                   MKERGVLADRLPTLEVLDDVMYKSIAVGFAFFTIATILGALWAAEAWGGYWSWDPKETW
FT                   ALIVWLNYAAWLHMRLMKGLRGAVAAWWALTGLLVTTFAFLGVNMFLSGLHSYGKL"
FT   gene            428994..429989
FT                   /locus_tag="Bcen2424_0383"
FT   CDS_pept        428994..429989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0383"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   bcn:Bcen_2724 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07137"
FT                   /protein_id="ABK07137.1"
FT                   /translation="MWIKRPLRNVLTGADIASSEITPRAVFENRRRVLQAAGLAAAGGL
FT                   FGTSGAALAAYASPDSRAAKLAAKTNPKFVAIDKVTPFKDITSYNNFYEFGTDKSDPAQ
FT                   NAGTLRPRPWRVSVEGEVQHPKVFDLDELLKLAPLEERVYRLRCVEGWSMVIPWIGVPL
FT                   SELIKRVQPTGNAKYVQFITLADPSQMPGLSTPVLDWPYSEGLRMDEAMNPLTLLTMGV
FT                   YGQVLPNQNGAPVRIVVPWKYGFKSAKSLVKIRFVDKQPKTSWNTYAANEYGFYSNVNP
FT                   NVDHPRWSQATERRIGEDGFFTPKRKTLMFNGYGDLVASMYQGMDLKKNF"
FT   sig_peptide     428994..429158
FT                   /locus_tag="Bcen2424_0383"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.745 at
FT                   residue 55"
FT   gene            430010..430696
FT                   /locus_tag="Bcen2424_0384"
FT   CDS_pept        430010..430696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0384"
FT                   /product="Ferric reductase domain protein protein
FT                   transmembrane component, N-terminal domain protein"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component, N-terminal domain; KEGG: bcn:Bcen_2723 ferric
FT                   reductase-like transmembrane component-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07138"
FT                   /protein_id="ABK07138.1"
FT                   /translation="MPTSTLTPARAASAGPAARTARAGGSRPAAPRWLVPAKALVFAAG
FT                   LYPLARLVLFGLTDRLGANPIEFITRSTGLWTLVLLCVTLAVTPLRRMTGFAPLLRFRR
FT                   MIGLFAFFYATLHFTTYLWFDKWFDVVAILKDVGKRPFITVGFAAFVLLIPLAATSPRA
FT                   MVRRLGRHWATLHSAIYAIALFGVLHFWWMRAGKHNLAQPKLYAAIVAVLLGWRLVAWG
FT                   WRRVRA"
FT   sig_peptide     430010..430081
FT                   /locus_tag="Bcen2424_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.735 at
FT                   residue 24"
FT   gene            complement(430792..431070)
FT                   /locus_tag="Bcen2424_0385"
FT   CDS_pept        complement(430792..431070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0385"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bcn:Bcen_2722 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07139"
FT                   /protein_id="ABK07139.1"
FT                   /translation="MRVVFRMSAIVAALAILAGCGQSGALYLPTVPPMPKPIQPQNTPP
FT                   SDVKPTDENASSDETPDTSGSPLMLSPELSSSASTLPAPASGPAATK"
FT   sig_peptide     complement(430993..431070)
FT                   /locus_tag="Bcen2424_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.840 at
FT                   residue 26"
FT   gene            431107..431433
FT                   /locus_tag="Bcen2424_0386"
FT   CDS_pept        431107..431433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0386"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein; KEGG: bcn:Bcen_2721
FT                   frataxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07140"
FT                   /db_xref="GOA:A0K3R3"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3R3"
FT                   /protein_id="ABK07140.1"
FT                   /translation="MSDTEYLARAEAVLAAVERTVDVANDGDHDIDLERNGSVLTLTFE
FT                   NGSKIIVNLQPPMKEVWIAAKAGGFHYRFIDGEWRDTRTGTEFFSALTEYATQQAGLPI
FT                   TFSA"
FT   gene            complement(431515..433908)
FT                   /locus_tag="Bcen2424_0387"
FT   CDS_pept        complement(431515..433908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0387"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: bcn:Bcen_2720 penicillin-binding protein 1A;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07141"
FT                   /protein_id="ABK07141.1"
FT                   /translation="MPMQSTTPTSPPPAPEPKKRPWWQKVLLGFAAMCVALVVAGGLVL
FT                   GYALVVAWPNMPSLDALTDYRPKVPLRIYTSDHVLIGEFGEERRDVVHFKDVPDSLKKA
FT                   ILAIEDARFYDHGGVDLTGIIRAGFVALTNGHASQGASTITMQVARNFFLSSEKTYTRK
FT                   IYEMLLAYRIERALTKDQILEVYMNQIYLGQRAYGFASAARVYFGKDLKDITLAEAAML
FT                   AGLPKAPSAYNPVVNPKRAKVRQEYILQRMLELNFITREQYDEAAAQPLVVKGPGRDFS
FT                   VHAEYVAEMVRQMMYAQYREETYTRGFNVVTTIDSADQQVAYTALRKGIMDYERRHGYR
FT                   GPEGFIELPAGADDREQAIDDALLEHPDNGELIAAVVTAASPRQITVAFIDGSTATIEG
FT                   DNLRFASGALSTNAQPNRRIRPGAIVRVVKNDAGKWSITQLPQVEGAFLSIVPQDGAIR
FT                   SLVGGFDYNKNKFNHVTQAWRQPGSSFKPFIYSASLDKGLGPATVINDGPLYFSAAETG
FT                   GQPWEPKNYGGGFEGPMSMRTALQRSRNLVSIRILNNIGTKYAQQYITRFGFDADRHPA
FT                   YLPMALGAGQVTPLQMAGAYSVFANGGYRVNPYLIAEVTDPNGAIVARAQPLVAEQNAP
FT                   RAIDARNAYVMNSLLQSVAQRGTGARTNVLKRTDLAGKTGTTNDSHDAWFAGYQHTLAA
FT                   IAWIGYDNPRSLGDRETGGGLSLPVWIEYMGAALKGVPEFKPTVPDGVESLGGELYFTE
FT                   FTPGHGFVSTVGVPQAPAAQNVDEAVPHVDEQEKQDIMNLFRGH"
FT   sig_peptide     complement(433786..433908)
FT                   /locus_tag="Bcen2424_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.303 at
FT                   residue 41"
FT   gene            434129..435052
FT                   /locus_tag="Bcen2424_0388"
FT   CDS_pept        434129..435052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07142"
FT                   /protein_id="ABK07142.1"
FT                   /translation="MAGRWVARFAQGRYRSTGIDVGAHEVRVAVVSRRGKCANVRVEGL
FT                   EREPVGLAGGPEDARWAAVARSLAAAVSRLSASDVQCDVRGVMALHDDEMRTATLDLAG
FT                   RGDIPDAARQAAERISGLAPDSLAFDWRHYGGVRSGEIAVAVAPLALLERRIDVAAQAG
FT                   IDLTVIDGESVAVLRALHYAAQFELDAQGAYAVLWFCDAGVRGWRIEGRSAVSVLTLSG
FT                   TLPEALPDALRRRVLGAVGCVFVAGDERCIARFDTSVAEIGDVLGTAVVPFDCTGWDGQ
FT                   PCARAGMPGGPAFAVAFGLALRGVWE"
FT   gene            435052..435696
FT                   /locus_tag="Bcen2424_0389"
FT   CDS_pept        435052..435696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0389"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   bcn:Bcen_2718 fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07143"
FT                   /protein_id="ABK07143.1"
FT                   /translation="MAGHVAASGAAAVAPGQAVLGDFNLLPYRERLAQALRRRRVAQCG
FT                   VAILLGVLGAGLWTGAAGLSRWRVDAERASVETRLRQLQPQVAAATRAANAAAAVAQRD
FT                   AQAAALAAPYRRVAGLLATLMQVRADHIRLDALRMTSTGAVLDARAASYRAAARWLAAM
FT                   AREQRDWRIDIETLKPASDAPAATAWMPFRFSVQLRWHDAMSSRTVSGGGA"
FT   sig_peptide     435052..435114
FT                   /locus_tag="Bcen2424_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.814) with cleavage site probability 0.661 at
FT                   residue 21"
FT   gene            435693..436559
FT                   /locus_tag="Bcen2424_0390"
FT   CDS_pept        435693..436559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07144"
FT                   /protein_id="ABK07144.1"
FT                   /translation="MTALVHRPALRGGAGSGGLPRVSPAAVHATGCVLAFVAVLAGGIH
FT                   LANAADWSGLTHSRALLAAAQARAADAQRMLAAAGQRRDGHRASTRDDHSPHAPEWAAL
FT                   MLELADLAASSGLRGVSIEPQRADGAEPDGRRTVHIAADGDFRALLHMVGGLARFPVLA
FT                   VPTALRIERGMAAARVDMSVDVFPALPATAVAADNTPVRAAAPDADPFGEAGPAEAAGH
FT                   AARFAGTIRDARAGLALFDDGDGVFTAVAPGDLLGAARVVRVERAAVTLATADGAQRLV
FT                   LDDGGRP"
FT   gene            436556..438187
FT                   /locus_tag="Bcen2424_0391"
FT   CDS_pept        436556..438187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0391"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB, short N-terminal domain; KEGG:
FT                   bur:Bcep18194_A3488 type II and III secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07145"
FT                   /protein_id="ABK07145.1"
FT                   /translation="MTKHGCWLFAIWAGVTAADAGASLPPLPAVWPAGATDVSVPGLPQ
FT                   SLRVADGADGAVAQDAGPPPFDQAARTALPTETAATPPTLEGPPIPLAPPARMSDAAAR
FT                   QPGDADDARRISLNLQGVGLAAAFDAIARFTGLNIVVGEQVRGTVTLRLNNVRWREAFD
FT                   TLLDTHGLAMSRRGNVIWVTPAAELAARERERFEMHARAADLEPLASRTFVLHYPRAQD
FT                   VQRLLAGATGQRLLSKRGAAAADPRTNLLFVTDLAPRITQIAGLIDAIDRPSRQVRIEA
FT                   RIVEGEQGFSRNLGARVALRAQGRPPAAEGASFTANARNALDLAARPLGGFDAATAGFT
FT                   LFAAPLSRVLDIELSALEAQGRGQIVSRPRVVTADRVKAIVEQGSELPYQAKVGNGMSG
FT                   VQFRRATLKLEVEPQITPDGRVVLDLDVTKDSVGEPTAAGPAIHTKHVQTRVEVENGGT
FT                   VAIGGIYEQLNRNDVTRVPLLGKIPFLGALFRHRAQRDQRNELVVFITPTVVDARCGAP
FT                   GAGDADAEETGPEAAGAGSTRQPLCQ"
FT   sig_peptide     436556..436618
FT                   /locus_tag="Bcen2424_0391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.601 at
FT                   residue 21"
FT   gene            438228..438782
FT                   /locus_tag="Bcen2424_0392"
FT   CDS_pept        438228..438782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0392"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: bur:Bcep18194_A3489
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07146"
FT                   /protein_id="ABK07146.1"
FT                   /translation="MQARDPHANVFFVGLMGAGKTTVGRAVARRLDRTFFDSDHEIEAR
FT                   TGARIPVIFELEGEAGFRDRETQVIAELAQRENIVLATGGGAVLRPENRDSLKTNGIVV
FT                   YLRANPHDLWLRTRKDKNRPLLQTEDPKGRLEALYEVRDPLYRECADFVIETGRPSVNG
FT                   LVNMVLMQLELAGVIAKPLQA"
FT   gene            438779..439858
FT                   /locus_tag="Bcen2424_0393"
FT   CDS_pept        438779..439858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0393"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: bcn:Bcen_2714
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07147"
FT                   /db_xref="GOA:A0K3S0"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3S0"
FT                   /protein_id="ABK07147.1"
FT                   /translation="MITVNVDLGDRAYPIHIGAGLIGRTELFAPHIKGSSVTIVTNTTV
FT                   DPLYGDALRAALAPLGKRVSTVVLPDGEAYKNWETLNLIFDGLLTDHADRKTTLVALGG
FT                   GVVGDMTGFAAACYMRGVPFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPQAV
FT                   IADIGALTTLPDRELAAGVAEVIKTGAIADAGFFDWIEANVEALNRREPAALAHAVKRS
FT                   CEIKASVVAADEREGGLRAILNFGHTFGHAIEAGLGYGEWLHGEAVGCGMVMAGDLSVR
FT                   LGLLDEASRQRLDAVIAAAHLPTRGPALGDARYMDLMRVDKKAEAGAIKFILLKRFGDT
FT                   LITQAPDEAVFATLAQTTR"
FT   gene            439900..441108
FT                   /locus_tag="Bcen2424_0394"
FT   CDS_pept        439900..441108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0394"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /note="KEGG: bcn:Bcen_2713 deoxyguanosinetriphosphate
FT                   triphosphohydrolase; TIGRFAM: putative
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase, HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07148"
FT                   /protein_id="ABK07148.1"
FT                   /translation="MSETSSSTLPEASRASAAPVAEPPTLAALEAHLAPYAAHASQSRG
FT                   RRHPETPPAARTEFQRDRDRIVHSTAFRRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIA
FT                   RSVARNLRLNEDLVEAISLAHDLGHTPFGHAGQDALNACMREHGGFEHNLQSLAVVDEL
FT                   EEHYGAFNGLNLCFETREGILKHCSRENARKLGALGERFLQGRQPSLEAQLANIADEIA
FT                   YNNHDVDDGLRSGLITIEQLAEVELWQRHYEAALAEFPHLEGRRLVHETVRRIINTLIV
FT                   DLIDETTRNLARVAPASLDDVRAAPPLVAHSPEVAAQAAALKRFLFKNLYRHYKVMRMA
FT                   SKAQRVVTGLFDAFIDDPRLLPPPYQSDDAAQQPRLVAHYIAGMTDRFALKEYQRLFVI
FT                   NDN"
FT   gene            441197..442528
FT                   /locus_tag="Bcen2424_0395"
FT   CDS_pept        441197..442528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0395"
FT                   /product="glycerol 3-phosphate-binding protein"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bcn:Bcen_2712 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07149"
FT                   /protein_id="ABK07149.1"
FT                   /translation="MKKPAGTLVRSIALGGALIFGVQHVALAATEIQFWHAMEAALGER
FT                   VNAIADQFNASQSDYKIVPVYKGTYDQALAAGIAAYRSGNAPAILQVYEVGTATMMQAK
FT                   KAVVPVYDVFKQAGVTLDEKAFVPTIASYYSDAKTGHLVSMPFNSSTPVLYYNKDAFKK
FT                   AGLDPNQPPKTWADVKADAEKLRKSGMACGFTTGWQGWIQLENYSAWHGLPFASRNNGF
FT                   DGTDAVLEFNKPQQIEHISFLQQMAKDGTFTYAGRKDEASAKFYSGDCGILTTSSGALA
FT                   NVQKFAKFSYGTGMLPYDANVKGAPQNAIIGGASLWVLAGKDPATYKGVAKFLSYLASP
FT                   AVAAKWHQDTGYLPVTTAAYDLTRQQGFYAKNPSAETAIKQMLNKPPLPYTKGLRLGNM
FT                   PQIRTVVDEEFEQVWAQKKSPKDALDSAASRGDELLRRFEKSGG"
FT   sig_peptide     441197..441283
FT                   /locus_tag="Bcen2424_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            442625..443509
FT                   /locus_tag="Bcen2424_0396"
FT   CDS_pept        442625..443509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0396"
FT                   /product="glycerol 3-phosphate ABC transporter membrane
FT                   protein"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_2711
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07150"
FT                   /protein_id="ABK07150.1"
FT                   /translation="MQSRSRFGTSPVPYLLIAPQLAITAVFFLWPAGVALWQSTQTQDA
FT                   FGTSSEFVGLANFTHLFADPLYLDSMRTTLVFSSLVTVSGLVVSLLLAACADRVIRGAR
FT                   VYRTLLIWPYAVAPTIAAVLWAFLFNPSIGLITYALAKGGIVWNHALNGEQAMFLVVLA
FT                   SVWKQVSYNFLFFYAGLQAIPRSLIEAAAIDGAGPVRRFFNIVLPLLSPTSFFLLVVNL
FT                   VYAFFDTFPVIDAATGGGPAQSTRTLIYKIFAEGFQGLDIGSSGAQSVVLMIIVVALTV
FT                   IQFRFVERRVQYA"
FT   gene            443506..444351
FT                   /locus_tag="Bcen2424_0397"
FT   CDS_pept        443506..444351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0397"
FT                   /product="glycerol 3-phosphate ABC transporter membrane
FT                   protein"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_2710
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07151"
FT                   /protein_id="ABK07151.1"
FT                   /translation="MIENRKGFDLFCHAVLIAGVVLIVFPVYVAFCAATMNAQEVLTVP
FT                   LSLVPSTHLFENVAYIWGHGSGGTTAPFGRLLVNSFAMALGIAVGKIAVSILSAYAIVY
FT                   FRFPFRNTAFWLIFITLMLPVEVRIFPTVQVVSTLHLTNTYAGLSLPLIASATATFLFR
FT                   QFFMTLPDELMDAARIDGAGPLRFFWDVVLPLSKTSIAALFVITFIYGWNQYLWPILIT
FT                   TEASLSTAVVGIKTMIASGDAATEWQYVMAALLLAMIPPLVVVLAMQRWFVRGLVDSEK
FT                   "
FT   gene            444382..445467
FT                   /locus_tag="Bcen2424_0398"
FT   CDS_pept        444382..445467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0398"
FT                   /product="glycerol 3-phosphate ABC transporter ATP-binding
FT                   protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: bcn:Bcen_2709
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07152"
FT                   /db_xref="GOA:A0K3S5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3S5"
FT                   /protein_id="ABK07152.1"
FT                   /translation="MAALSLKGVRKSYDGKQHVLHGIDVEIADGEFIVLVGPSGCGKST
FT                   LLRMIAGLESVTDGEIAIGDRVVNTLEPKDRDIAMVFQNYALYPHMTVAQNMGYGLKIR
FT                   GIERATIDSRVAAAAKILELEPLLARRPRELSGGQRQRVAMGRAIVREPSVFLFDEPLS
FT                   NLDAKLRVQMRLEIQRLHARLATTSVYVTHDQIEAMTLAQRVIVMNRGYAEQIGAPVDV
FT                   YEKPATVFVAGFIGSPAMNLMHGRLSEDGASFTVAGGGPALPVAGAPGIGREIATGRDW
FT                   VLGVRPEHMTPQPGVAQATLPVDSCELLGADNLAHGRWGDHDIAVRLPHADRPARGTAL
FT                   AAALPAHRLHFFDPESGKRAG"
FT   gene            445496..446266
FT                   /locus_tag="Bcen2424_0399"
FT   CDS_pept        445496..446266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0399"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bcn:Bcen_2708 glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07153"
FT                   /protein_id="ABK07153.1"
FT                   /translation="MITRIDWPYPRVVAHRGGGTLAPENTLAALDEGARRGHRMVEFDA
FT                   KLSADDVTFLLHDDTVDRTSNGHGAAAGMRYAALAALDAGAWRDARFAGERMPTLEAAA
FT                   ARCLAHGLAANVEIKPCPGRERETGQRVAADAAAYWRDAAVAPLLSSFSFEALQQARAT
FT                   VPALPRGMLYEVVPDDWHAQVIDALDCVSLHADHTRLDESLVRAIKAAGLRILVYTVND
FT                   LERARELARWGVDAVCTDRIDLIAPDALDDIDVV"
FT   gene            complement(446445..447176)
FT                   /locus_tag="Bcen2424_0400"
FT   CDS_pept        complement(446445..447176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0400"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bcn:Bcen_2707 OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07154"
FT                   /protein_id="ABK07154.1"
FT                   /translation="MKRKLAITGAAALAFTFAGGTAHAQSAGDFYVSTGWLHLSPQDSS
FT                   DPLFVYRVGGTPINQSIPNTGAGINDADTLGLAAGYFVTDHISTELVMGIPPKFDITGK
FT                   GQFDRFGVLGRAYQWSPAVLLRYHFNDANAKFRPYVGVGATYVWFTGAKITNSAFENGV
FT                   LGGPTSATTSNQWAPVLNAGFTYNFTKHWFAGLSLSYIPVSVTATFTTARRTPVGTLTE
FT                   TSKAHISLNPIVTYLNLGYRF"
FT   sig_peptide     complement(447102..447176)
FT                   /locus_tag="Bcen2424_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            447370..448083
FT                   /locus_tag="Bcen2424_0401"
FT   CDS_pept        447370..448083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0401"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   bcn:Bcen_2706 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07155"
FT                   /protein_id="ABK07155.1"
FT                   /translation="MARLARLYVPDQPQHVILRGLDQQPAFVDDQDYELFIDCLKAAAR
FT                   DHHLSVHAYVLLPRQVQLLVTPSDEASLPKAMQAVGRRYVAHFNRRYSRRGTLWEGRYR
FT                   ATVIEGERYFLLASRVVEMSPVRAQLVATPEAYRWSSYRHHVGLTVDSLITDHPLYWAL
FT                   GNTPFDRQRAYKELCEQPLDERQADQLQQATLKGWVLGGENYREWAARTANRRVSPLPR
FT                   GRPRKVRENTPPIQQ"
FT   gene            448372..453075
FT                   /locus_tag="Bcen2424_0402"
FT   CDS_pept        448372..453075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0402"
FT                   /product="glutamate synthase (NADH) large subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="PFAM: glutamine amidotransferase, class-II;
FT                   glutamate synthase, alpha subunit domain protein;
FT                   ferredoxin-dependent glutamate synthase; glutamate
FT                   synthase; KEGG: bur:Bcep18194_A3499 glutamate synthase
FT                   (ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07156"
FT                   /protein_id="ABK07156.1"
FT                   /translation="MNDHQQPLAAVPAAQGLYDPQNEHDACGVGFVAHIKGKKSHEIIQ
FT                   QGLKILENLDHRGAVGADPLMGDGAGILIQIPDAFYREEMAKQGVDLPPAGEYGVGMIF
FT                   LPKENASRLACEQELERTVKAEGQVVLGWRDVPVDHAMPISPTVKASEPLIRQIFIGRG
FT                   KDIMVTDALERKLYVIRKTASHRIQALKLKHGKEYFVPSMSARTIVYKGLLLAGQVGVY
FT                   YRDLQDPRVVSALALVHQRFSTNTFPAWELAHPYRMIAHNGEINTVKGNVNWLNARTGA
FT                   IASHVLADDLPKLWPLIYPGQSDTASFDNCLELLVMAGYPLVHAVMMMIPEAWEQHTLM
FT                   DENRRAFYEYHAAMMEPWDGPAAIAFTDGRQIGATLDRNGLRPARYIVTDDDLVIMASE
FT                   AGTLPIPESKIVKKWRLQPGKMFLIDMEHGRIIDDKELKDNLANAKPYKSWIDAVRIKL
FT                   DEIEPKAEEVAAGRTQGAALLDRQQAFGYTQEDLKFLMAPMAQQGEEAVGSMGNDSPLA
FT                   VMSNKNKTLYHYFKQLFAQVTNPPIDPIRENMVMSLVSFIGPKPNLLDTNNINPPMRLE
FT                   VSQPVLDFKDIAKIRAIDQYTGGKFSAYELNICYPVAWGKEGIEARLASLCAEAVDAVK
FT                   SGYNMLIVSDRKTDAEHVAIPALLATSAIHTHLVQQGLRTSTGLVVETGSARETHHFAL
FT                   LAGYGAEAVHPYLAMETLAKMAEGLPGDLSPEKAIYNFTKAVGKGLQKVMSKMGISTYM
FT                   SYTGAQIFEALGLSSDLVEKYFKGTASKVGGIGLFEVAEEAIRLHRDAFGDSPVLRDML
FT                   DAGGEYAYRVRGEDHMWTPDSIAKLQHATRSNSYQTYKEYAHLINDQTKRHMTFRGLFE
FT                   FKVEPTKAIPIDDVEPAKEIVKRFATGAMSLGSISTEAHATLAVAMNRIGGKSNTGEGG
FT                   EDQKRYRNELRGIPIKAGETLKSVIGDEIVSDIPLKDGDSLRSKIKQVASGRFGVTAEY
FT                   LASADQIQIKMAQGAKPGEGGQLPGHKVSEYIGKLRYSVPGVGLISPPPHHDIYSIEDL
FT                   AQLIHDLKNVNPSASISVKLVSEVGVGTVAAGVAKAKADHVVIAGHDGGTGASPLSSVK
FT                   HAGTPWELGLAETQQTLVLNRLRGRIRVQADGQMKTGRDVVIGALLGADEFGFATAPLV
FT                   VEGCIMMRKCHLNTCPVGVATQDPVLRAKFKGQPEHVVNYFFFVAEEVREIMAQLGVAK
FT                   FDDLIGRADLLDTRKGIEHWKAKGLDFSRVFYQPEECEDVAPRHVDVQDHGLERALDHV
FT                   LIEKAKAAIENGEHVSFIQPVRNVNRTVGAMLSGVIAKKHGHDGLADDAVHIQLKGTAG
FT                   QSFGAFLAKGVTLDLVGDGNDYVGKGLSGGRIIIRPTNDFRGKSEENIICGNTVMYGAI
FT                   EGEAFFRGVAGERFCVRNSGATALVEGTGDHGCEYMTGGTVVVLGETGRNFAAGMSGGL
FT                   AYIYDPEGTFAAKCNKSMVALEPVLQQAEQERTVDRALWHEGTTDEALLKGLVERHFQF
FT                   TGSPRAKSLLENWDAARRQFVKVFPHEYKRALGEIGAKKAAKEVLAA"
FT   gene            453095..454627
FT                   /locus_tag="Bcen2424_0403"
FT   CDS_pept        453095..454627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0403"
FT                   /product="glutamate synthase (NADH) small subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="TIGRFAM: glutamate synthases, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bur:Bcep18194_A3500 glutamate
FT                   synthase, NADH/NADPH, small subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07157"
FT                   /protein_id="ABK07157.1"
FT                   /translation="MPRAPDGRARLPHPIHRTEEHLMGKATGFLEFERRHEAYEAPLTR
FT                   VKHYKEFVAALTDADAKIQGARCMDCGIPFCNNGCPVNNIIPDFNDLVYRQDWQQAIEV
FT                   LHSTNNFPEFTGRICPAPCEAACTLGINDDPVGIKSIEHAIIDKAWAEGWVKPLPAEHK
FT                   TGKKVAVVGSGPAGLAAAQQLARAGHDVTVFEKNDRIGGLLRYGIPDFKLEKWLIDRRM
FT                   RQMEAEGVTFRTSVFIGKDPLPESIGSLAKETISPDTLKEEFDAVVIAGGSETPRDLPV
FT                   PGRELAGVHFAMDFLPQQNRVNAGDKLADQLLAKGKHVIVIGGGDTGSDCVGTSNRHGA
FT                   KHVTQFELLPQPPEEENKPLVWPYWPIKLRTSSSHDEGCERDWAVATKRLEGKNGKVEK
FT                   LIAVRVEWKDGKMQEVPGSEFEMKADLVLLAMGFTQPAAPVLDAFGVAKDARGNARAAT
FT                   EGDRSYYTSVDKVFAAGDMRRGQSLVVWAIREGRQCARSVDAYLMGHSELPR"
FT   gene            454973..456466
FT                   /locus_tag="Bcen2424_0404"
FT   CDS_pept        454973..456466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0404"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: bcn:Bcen_2703 amino acid
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07158"
FT                   /protein_id="ABK07158.1"
FT                   /translation="MEAFVQGLIEAVNGVLWNYVLIALLLGAGAWFTLRFRMIQLKALF
FT                   LSMKLVGSKGEPGSISSFQAFATGLASRVGTGNIAGVAVALTVGGPGAIFWMWMTALVG
FT                   MSSAFVEATLAQIFKVSHPDGSYRGGPAYYIQTGLRSCGFGVLFSLSLILAFGFVFNAV
FT                   QANAIADAFHTSFGWRRETVGLGLVLLSAPIIFGGIRRIATVAQVIVPLMAIGYLALAV
FT                   YAVATHITLVPGVIALIVKSAFGLEQAAGGLTGYAVSQAIAIGVKRGLFSNEAGMGSAP
FT                   NAAATASTRHPVTQGLIQMLGVFVDTIVICSATAFVILLSGQYELGTGMEGAALTQRAI
FT                   SSHVGDWGGIYMAVAIFFLAFSSVIGNYAYAEGNVEFITKRRGVLPLFRIAVLGMVMFG
FT                   SVGQLPLVWAMADTSMGLMAIINLIAILALGKYAHAAWADYRRQRAAGVADPVFTRNTI
FT                   PELARVLPADVWGEHGPLPQRPVASAGASNAPRAAASES"
FT   gene            456463..457047
FT                   /locus_tag="Bcen2424_0405"
FT   CDS_pept        456463..457047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0405"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: 2',5' RNA ligase;
FT                   KEGG: bcn:Bcen_2702 2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07159"
FT                   /protein_id="ABK07159.1"
FT                   /translation="MNGDRLRAFVALMPDAASRDALHALPVTRGARRTLPAQLHMTLAF
FT                   IGAIERERCDALAAHLPALAAAHALPSLPVERIAWWPSLPRARLIVAELAADAACVALN
FT                   AGLAALLRELGVPADRRPFRPHVTLARLPHDAIGQPAHGGAPGRPVEVRVEALTLFESR
FT                   LSQEGVSHRPIVSAPIARADDSVGAEERPHE"
FT   gene            complement(457121..458422)
FT                   /locus_tag="Bcen2424_0406"
FT   CDS_pept        complement(457121..458422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0406"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_2701 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07160"
FT                   /protein_id="ABK07160.1"
FT                   /translation="MHVIVLGAGVIGVTTAWHLREAGCDVTVIEREADVAQATSLGNAG
FT                   VIAPGYVTPWAAPGMPGKILKYLFKPASPLIFRPTLDAAQWRWIARWLRECEFERFRVN
FT                   KQRMQRIAYYSRACLHAFRERYSFDYGASRGYLQLLRGAFDVDMVQPALKVLRDAGIAF
FT                   RELDAAGCTAIEPGLRWARQAPVGGIYLPDDEAGDCARFTRELRALCEANGVAFRFNTE
FT                   LRALDVAGGKARGVHVVAVGGNHEGNGSGGARHGTTLAADAIVVALGVDSAGLLRPYGI
FT                   DVPLYPVKGYSATLAVVDDEKAPCAALMDESLKTAITRFGPTLRVAGTAELGNRHAALR
FT                   QQALDTLMKVLDDWFPHAADRTSARFWVGRRPMTPDGPPLLGASGIDGLWLNVGHGSTG
FT                   WAMSMGSGKVVADLVTGRTPEIDLAGLTLARYGR"
FT   gene            complement(458448..459710)
FT                   /locus_tag="Bcen2424_0407"
FT   CDS_pept        complement(458448..459710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0407"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_2700 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07161"
FT                   /protein_id="ABK07161.1"
FT                   /translation="MQAFQWFNELSTRERRTLYAGFGGYAVDAFDFMIYSFLIPTLIAT
FT                   WGMTKSEAGMIATSSLISSAIGGWVAGILADRYGRVRVLQWTIATFALFTCLSGFTHSF
FT                   WQLLATRTLQGFGFGGEWSVVTIMMAETIRSPEHRAKAVGTVQSSWSFGWGAAAILYWA
FT                   FFALLPEQVAWRACFWIGIVPALWILYIRRNVSDPDIYTATRRARDEGRVSGHFLEIFS
FT                   PPHLRATLFGSALCTGMLGGYYAITTWLPTYLKTVRHLSVFNTSGYLVVLIVGSFVGYV
FT                   VGAILSDRLGRRASFILFAVGSFSLGMAYTMLPITDTAMLLLGFPLGIVVQGIFAGVGA
FT                   YLSELYPGAIRGSGQGFCYNLGRGLGSFFPILVGALSQSMSLVKAIGLVAGGGYLLVIV
FT                   AALVLPETRGKSLVDDPAVAS"
FT   gene            complement(459839..460615)
FT                   /locus_tag="Bcen2424_0408"
FT   CDS_pept        complement(459839..460615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0408"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcn:Bcen_2699 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07162"
FT                   /protein_id="ABK07162.1"
FT                   /translation="MNARAAHLERIALITGAGSGIGAALARRLAAPGIALALHARGADE
FT                   AARSRLADVAHACTTAGAECITLTGDLGEPGIAAALVDSTATRFGGLDQLVANAGFAAR
FT                   QSFSELSANALASAFATMPGAFSALAGRARPLLETSATPRIVAVSSFVAHRYRADAPFA
FT                   TTAAAKAALESLVRSAAAEFAAHGITVNAVAPGFTRKDHGPSAGNAAAWAQAEQATPLG
FT                   RIAEPDDVAALIAFLLSDAARQITGQVIHVDGGLTL"
FT   gene            complement(460612..462381)
FT                   /locus_tag="Bcen2424_0409"
FT   CDS_pept        complement(460612..462381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0409"
FT                   /product="ABC transporter domain protein"
FT                   /note="PFAM: ABC transporter related; SbmABacA family
FT                   protein; ABC transporter domain protein; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_2698 ABC transporter-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07163"
FT                   /protein_id="ABK07163.1"
FT                   /translation="MTQSIDPVRSASDAPQDERPVSAWSLIKPYWVSSEWKIAWGLLVT
FT                   IIAINLCVVWINVRLNKWNAQFYNALQSKDVHDFPNLLMQFSALAFAFIILAVYGRYLR
FT                   QMLGFRWRQWLTDRFLGQWLGDRAFYRIERDRLADNPDQRITDDLQSFATTTLALSLDL
FT                   LSTVVTLVSFITILWSLAGALTFTLGATPIAIPGYMVWAAALYAVIGSLIIQKVGHPLV
FT                   SINYQQQRVEADFRFGLIRVRENAEQIAFYDGEKTEAGNAQTLFTRIRDNWWRVMKYTK
FT                   RLTFVLSFYGQIAIIFPLVVAAPRYFAGAFSFGVLMQISSAFGTVSDSFSWFINSYSTL
FT                   VEWRATVNRLREFKRVMGTSHLKESLSPATEHGGINLHYIDAAKLSTSSLKLALPNGNA
FT                   LANIGDVTIEPGSRWLVIGKSGSGKSTFMRALAGLWPFGDGAIDAPVGARMMFVPQTSY
FT                   LPIGTLKAALTYPATPDTFSDEACRDALRACRLEDYVERLDETAHWTRVLSPGEQQRLA
FT                   GARVLLHKPDFLFLDEATSALDADNEARLYHLFAERLPKAAIVSIAHRESLAAFHVGTI
FT                   NVERVGSDDKVAA"
FT   gene            463001..464137
FT                   /locus_tag="Bcen2424_0410"
FT   CDS_pept        463001..464137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0410"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_2697 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07164"
FT                   /protein_id="ABK07164.1"
FT                   /translation="MNVRDARPDFAVLGGGLVGRLIAWRLAGDGHRVALYERGGPDGEQ
FT                   SAAWIAAAMLAPLAEAASAELLITELGAASLARWPQWLAELPEPVFFQHHGTLVVWHHA
FT                   DRAEAPLFERRVRANAPAELLDGGFVTLAGAQVDAAEPVLAGRFARGLMLPREGQLDNR
FT                   QTLRALAAGLAERGVALHWHAAVDDANLPAAHFTIDCRGLGAKSALPALRGIRGEVARV
FT                   HAPGIGLTRPVRLLHPRYPLYIAPKQDDLYVIGATEVEGEDMSPVSVRSALELLSAAFS
FT                   VHPAFGEARILELNAQCRPTLPDHRPAVIWDGASTLAVNGLYRHGFMIAPEVAQAAVVF
FT                   AQAALGGALGDADAFAAWRDAARWPTLLHHRNDARQPA"
FT   gene            464170..464367
FT                   /locus_tag="Bcen2424_0411"
FT   CDS_pept        464170..464367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0411"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: bcn:Bcen_2696 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07165"
FT                   /protein_id="ABK07165.1"
FT                   /translation="MDIQINQQTLTLPDGATVADALAAYGARPPYAVALNGNFVARTQH
FT                   AARALAAGDRLDVVHPVAGG"
FT   gene            464406..465221
FT                   /locus_tag="Bcen2424_0412"
FT   CDS_pept        464406..465221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0412"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   bcn:Bcen_2695 thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07166"
FT                   /protein_id="ABK07166.1"
FT                   /translation="MTSHPSADALTLYGETFASRVLLGTSRYPSLQSLSDSIAASRPGM
FT                   VTVALRRQMTGGTAEAGFFDLLKRHAVPLLPNTAGCQTVAEAVTTAHMAREVFDTDWIK
FT                   LELIGDDYTLQPDPVGLIEAAAQLVKDGFKVLPYCTEDLVIGRRLLDVGCEALMPWGAP
FT                   IGTGKGVVNPYGLRVLRERLPDVPLIVDAGLGVPSHACQVMEWGFDGVLLNTAVSQATH
FT                   PEIMARAFAQGVEAGRAAYLAGPMDARDTAHASTPVVGMPFWHQDGGGA"
FT   gene            465218..466345
FT                   /locus_tag="Bcen2424_0413"
FT   CDS_pept        465218..466345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0413"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: bcn:Bcen_2694 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07167"
FT                   /protein_id="ABK07167.1"
FT                   /translation="MSAARFADAFWPPADELAEAAERIRARLGDWPEGAAPWRLCVAAP
FT                   DVPADGDVLIVSAGDRAAQARASAVSRPASPDAVAIEFDEQGAVLHAAGGRYALDAAHP
FT                   LADDWIAALAAFLDCGFAPVDALVLALAWRDGDETRAADAWPVDAARFPRVAGLPPAPE
FT                   PAFAPCPARLGLYPVVPSAEWVERVLDGGARTVQLRVKEATPDALRREIARAVAAGRRY
FT                   PDARVFINDHWEIAAEAGAYGVHLGQEDLETADLAAIAGAGLRLGLSSHGYYEMLRALH
FT                   ERPSYLALGPVYATATKAVAAPPQGLARIARYARFAGARAPLVAIGGVGLDTLPAVLAT
FT                   GVGSVAVVSAVTGAADYRTVLIALQQCFTGQFDNH"
FT   gene            466430..467251
FT                   /locus_tag="Bcen2424_0414"
FT   CDS_pept        466430..467251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0414"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_2693 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07168"
FT                   /protein_id="ABK07168.1"
FT                   /translation="MSPTPTETLLELRDVDFGYGDRLVLSNLNLRFGRGQVVAVMGGSG
FT                   CGKTTVLRLIGGLVRARRGQVLFDGADVGAQTRDGLYALRRKMGMLFQFGALFTDMSVF
FT                   ENVAFALREHTDLPEDLIRDLVLMKLNAVGLRGARDLMPSEVSGGMARRIALARAIALD
FT                   PQLIMYDEPFAGLDPISLGITANLIRTLNQALGATSILVTHDVPESFAIADYVYFLANG
FT                   GVLAQGTPDELRASTDPSVRQFIDGAPDGPFKFHYTSPPLAADFGLGGGRA"
FT   gene            467248..468015
FT                   /locus_tag="Bcen2424_0415"
FT   CDS_pept        467248..468015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0415"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   bcn:Bcen_2692 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07169"
FT                   /protein_id="ABK07169.1"
FT                   /translation="MISAIGRYVIGGLERAGYGTRLFVRLVLEFFPLLRRPRLVTKQIH
FT                   FLGNYSFVIIAVSGLFVGFVLGLQGYYTLNRYGSEQALGLLVALSLVRELGPVVTALLF
FT                   AGRAGTSLTAEIGLMKAGEQLTALEMMAVDPIKNVIAPRMWAGIIAMPLLAAIFNAVGV
FT                   LGGYFVGVVLIGVDPGAFWSQMQGGVQVWADVGNGVIKSIVFGFAVTFIALYQGYEAKP
FT                   TPEGVSRATTKTVVFASLAVLGLDFLLTALMFS"
FT   gene            468040..468609
FT                   /locus_tag="Bcen2424_0416"
FT   CDS_pept        468040..468609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0416"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bcn:Bcen_2691 mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07170"
FT                   /protein_id="ABK07170.1"
FT                   /translation="MTMKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVR
FT                   MKFDNIGGLKPRAAVKSAGVVVGRVKSIGFDPNTYQAVVTIDVDGQYPFPKDSSAKILT
FT                   SGLLGEQYIGLDPGGDTEMLKSGDTITMTQSAIVLENLIGQFLYSKAADAGGAKPAAGA
FT                   SAVPAAPAPVAVPASAVSGASGSAAQ"
FT   gene            468641..469603
FT                   /locus_tag="Bcen2424_0417"
FT   CDS_pept        468641..469603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0417"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein; KEGG: bcn:Bcen_2690
FT                   VacJ-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07171"
FT                   /protein_id="ABK07171.1"
FT                   /translation="MHTIRIRHAALAMAAVAALSGCATVQTPTKGDPLEGFNRSMYKFN
FT                   DTVDTYALKPVAKGYQYVVPQPVRDSVTNFFSNIGDVYIAANNIVQLRIADGVGDIMRV
FT                   VINTVFGVGGLFDVATIAKLPKHTADFGITMGRYGVPSGPYLVLPLLGPSTLRDTAGLG
FT                   VDYVGNPLTYVKPDGLSWGLFGVNLVNTRANLLGAGDVLDAAALDKYSFVRNAYLQRRQ
FT                   MLISNARGEAAATSSNDALPKYDLPEDGAAPAAAGAAGTAGAAAVGGAAPAPASGAAVA
FT                   APASGTAEAPNPASETNVPAMQVAPPSPGGFRFPSIRLH"
FT   sig_peptide     468641..468718
FT                   /locus_tag="Bcen2424_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 26"
FT   gene            469700..470344
FT                   /locus_tag="Bcen2424_0418"
FT   CDS_pept        469700..470344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0418"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   bcn:Bcen_2689 toluene tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07172"
FT                   /protein_id="ABK07172.1"
FT                   /translation="MQATMMKKLFLIPVFAALFSFGSAAHAQVDQSNPQALIKTATQQV
FT                   LDEVKQQTIKQGDTNRIISIVNKDILPYTDFRRTTQLAMGRNWRTATAEQQQQVQEQFK
FT                   LLLIRTYSGALAQLKPDQQIQYPPFRADPADTDVVVKTVALNNGQPVQIDYRLYKTANG
FT                   WKVYDLNVLGAWLIQTYQQQFNEKIQQSGVDGLIKFLTQRNQELAAGKQAS"
FT   sig_peptide     469700..469783
FT                   /locus_tag="Bcen2424_0418"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 28"
FT   gene            470341..470616
FT                   /locus_tag="Bcen2424_0419"
FT   CDS_pept        470341..470616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07173"
FT                   /protein_id="ABK07173.1"
FT                   /translation="MSGFEAGSSLTVASAKSALADGLARIGAGATAVDCAALTQFDSSA
FT                   LAVLLAWQRAAQARGAALDILNLPPKLASLARAYGVDALIEGTGRH"
FT   sig_peptide     470341..470403
FT                   /locus_tag="Bcen2424_0419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.875 at
FT                   residue 21"
FT   gene            470809..471735
FT                   /locus_tag="Bcen2424_0420"
FT   CDS_pept        470809..471735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0420"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_2687 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07174"
FT                   /protein_id="ABK07174.1"
FT                   /translation="MSAIEIRHVKKRYKSLQALKGVSLSVEEGEFFGLLGPNGAGKTTL
FT                   ISILAGLARADEGSISVRGHDVVQDFRNARRALGVVPQELVFDPFFTVRETLRIQSGYF
FT                   GLRRNDDWIDEVMANLDLTEKADANMRALSGGMKRRVLVAQALVHRPPVIVLDEPTAGV
FT                   DVELRQTLWKFISRLNREGHTIVLTTHYLEEAESLCDRIAMLRRGEVVALDRTDALLRR
FT                   FAGLQLYLRLATGALPAELRGLETDPAARAPGEHLLRLASYDEVERILAQCRAAGCTFD
FT                   EIEVRKADLEDVFVQVMNGAEVIEGLA"
FT   gene            471732..472553
FT                   /locus_tag="Bcen2424_0421"
FT   CDS_pept        471732..472553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0421"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bcn:Bcen_2686
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07175"
FT                   /protein_id="ABK07175.1"
FT                   /translation="MNQHSPRELRSLTSEGTARPVPGSGFRTLFYKELLRFWKVSFQTV
FT                   LAPIVTALLYLTIFGHALSGRVEVYPGVEYVSFLVPGLVMMSVLQNAFANSSSSLIQSK
FT                   ITGNLVFMLLPPLSYRDIFGAYVLASVVRGLAVGTGVFVVTIWFIPMHFAAPLFIIAFA
FT                   LLGSAILGTLGLIAGIWAEKFDQLAAFQNFLIMPLTFLSGVFYSTHSLPPVWREVSRLN
FT                   PFFYMIDGFRFGFFGASDINPFASLAIVTGFFVLLALIAMRLLATGYKLRH"
FT   gene            472609..472848
FT                   /locus_tag="Bcen2424_0422"
FT   CDS_pept        472609..472848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0422"
FT                   /product="transcriptional regulator, BolA protein family"
FT                   /note="PFAM: BolA family protein; KEGG: bcn:Bcen_2685
FT                   BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07176"
FT                   /protein_id="ABK07176.1"
FT                   /translation="MLPTPEQVKQYIAGGLACTHLEVEGDGQHFFATIVSAAFEGKRPI
FT                   QRHQLVYAALGDRMKQEIHALSMKTLTPAEWQNA"
FT   gene            472863..474212
FT                   /locus_tag="Bcen2424_0423"
FT   CDS_pept        472863..474212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0423"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   bcn:Bcen_2684 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07177"
FT                   /protein_id="ABK07177.1"
FT                   /translation="MQVTVNERDAVQSVATAHPAANGESQGQGMDKLAIEGGNRLSGEI
FT                   VVSGAKNAALPILCAGLLTADPVDLDNVPNLKDVRTTLKVLNQMGVKSETDGCRVQLDA
FT                   SRVDNLVAPYELVKTMRASILVLGPLLARFGEAKVSLPGGCAIGARPVDQHIKGLQAMG
FT                   AEISIEHGFIEARAKRLKGARIVTDMITVTGTENLLMAATLADGETVIENAAREPEVSD
FT                   LAHLLVAMGAKIDGIGTDRLVIQGVERLHGARHSVIPDRIEAGTFLCAVAAAGGDVMLT
FT                   GVRPHILDAVIDKLREAGVSIEEGDSWLRVKMDRRPSAVTIRTSEYPAFPTDMQAQFMA
FT                   LNTVATGTAQVVETIFENRFMHVQELNRLGANITIDGNTALVTGVDKLSGANVMATDLR
FT                   ASASLVIAGLRADGETLVDRIYHLDRGYDRMEAKLTAVGANVRRLSGSQA"
FT   gene            474209..474862
FT                   /locus_tag="Bcen2424_0424"
FT   CDS_pept        474209..474862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0424"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /note="PFAM: ATP phosphoribosyltransferase; KEGG:
FT                   bcn:Bcen_2683 ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07178"
FT                   /db_xref="GOA:A0K3V1"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3V1"
FT                   /protein_id="ABK07178.1"
FT                   /translation="MTAPLTLALSKGRIFEETLPLLAAAGVQVAEDPETSRKLILPTTD
FT                   PNLRVIIVRASDVPTYVEYGAADFGVAGKDVLVEHGGSGLYQPIDLNIARCRMSVAVPA
FT                   GFDYANAVRQGARLRVATKYVETAREHFAAKGVHVDLIKLYGSMELAPLVGLADAIVDL
FT                   VSSGGTLKANNLVEVEEIMAISSRLVVNQAALKLKRAALKPILDAFERASQNGG"
FT   gene            474887..476203
FT                   /locus_tag="Bcen2424_0425"
FT   CDS_pept        474887..476203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0425"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: bcn:Bcen_2682
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07179"
FT                   /protein_id="ABK07179.1"
FT                   /translation="MSITIRKLDSTNEGFGAALRAVLAFEASEDEAIEQSVAKILADVK
FT                   SRGDAAVLEYTNRFDRLSANSVAALELPQDALQTALDGLAPKARAALEAAAARVRAYHE
FT                   KQKIECGTHSWQYTESDGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVG
FT                   EIVMVVPTPDGVKNDLVLAAALLGGVDRVFTIGGAQAVGALAYGTETVPAVDKICGPGN
FT                   AYVASAKRRVFGTVGIDMIAGPSEILVLCDGTTDPNWVAMDLFSQAEHDELAQSILLCP
FT                   DAAFLDRVEKAIGELLPTMPRQDVIRASLEGRGALIKVRDMAEACRIANDIAPEHLEIS
FT                   ALEPQQWGQQIRHAGAIFLGRYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRS
FT                   SLIEVSAEGAQTLGEIASELAYGEGLQAHARSAEFRMKG"
FT   gene            476347..477420
FT                   /locus_tag="Bcen2424_0426"
FT   CDS_pept        476347..477420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0426"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase, class I and II; KEGG: bcn:Bcen_2681
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07180"
FT                   /protein_id="ABK07180.1"
FT                   /translation="MTTPQDIIRRDVLAMTSYPVPDASGFVKLDAMENPYPLPAPLAAA
FT                   LGERLAQVALNRYPAPRPAALLDKLRHAMRVPAGCDVLLGNGSDEIISMISVACAQPGA
FT                   KVLAPVPGFVMYELSAKFAQLEFVGVPLKADLTLDVDAMLAAIAEHRPAIVYLAYPNNP
FT                   TGTLYDDADVERIVAAARHSLIVIDEAYQPFAERSWLPRAAEFDNVVVMRTVSKLGLAG
FT                   IRLGYLVGLPAWLNEFDKVRPPYNINVLTQATADFLLDHLDVLDAQAAELRAERTRLAQ
FT                   AVAALPGATVFPSAGNFLLVRVPDAAAVFDALLTERVLVKNVSKMHPLLAECVRLTVGS
FT                   PDENARLLAALKLALPG"
FT   gene            477486..478073
FT                   /locus_tag="Bcen2424_0427"
FT   CDS_pept        477486..478073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0427"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   bcn:Bcen_2680 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07181"
FT                   /db_xref="GOA:A0K3V4"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3V4"
FT                   /protein_id="ABK07181.1"
FT                   /translation="MRVAEVVRNTSETQIRVKLDLDGTGRQKLATGVPFLDHMLDQIAR
FT                   HGLVDLEVEAHGDTHIDDHHTVEDVGITLGQAVAKAIGDRKGIRRYGHSYVPLDEALSR
FT                   VVIDFSGRPGLEFHVPFTRARIGTFDVDLSIEFFRGFVNHAGVTLHIDNLRGINAHHQL
FT                   ETVFKAFGRALRAAVELDERAAGQIPSTKGSL"
FT   gene            478134..478754
FT                   /locus_tag="Bcen2424_0428"
FT   CDS_pept        478134..478754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0428"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: bcn:Bcen_2679 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07182"
FT                   /protein_id="ABK07182.1"
FT                   /translation="MDLLKSFISLLALINPVGAVPFFLSLTAQQTDDERRRTIRIASVS
FT                   VFCVMTVTALLGQQIINFFGISVGSLEVGGGIIMLLMAINMLNAQIGNTRSTPEERHEA
FT                   ELKDNIAVVPLAIPLLTGPGSISTVIIYAANAHHWYERAGLVAIGAVLAFLCFVAMRLA
FT                   EPIANWIGRTGINIATRLMGLMLSALAVEFIVNGLRALLPALR"
FT   sig_peptide     478134..478220
FT                   /locus_tag="Bcen2424_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.679 at
FT                   residue 29"
FT   gene            478751..479392
FT                   /locus_tag="Bcen2424_0429"
FT   CDS_pept        478751..479392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0429"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: bcn:Bcen_2678 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07183"
FT                   /protein_id="ABK07183.1"
FT                   /translation="MKTSIAIVDYGMGNLRSVAQALKKAEPAADVAIVDTPAAIRAADR
FT                   VVLPGQGAMPDCMRCLGESGLQEAVIEASRTKPLLGVCVGEQMLFDWSAEGDTKGLGLL
FT                   PGKVVRFELDGRVQDDGSRFKVPQMGWNRVRQAQPHPLWDGVPDDAYFYFVHSYYVSPD
FT                   NPAHTVGETAYGAPFTSAVARDNLFATQFHPEKSAEVGLRLYRNFVHWKP"
FT   gene            479556..480311
FT                   /locus_tag="Bcen2424_0430"
FT   CDS_pept        479556..480311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0430"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis; KEGG: bcn:Bcen_2677
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07184"
FT                   /db_xref="GOA:A0K3V7"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3V7"
FT                   /protein_id="ABK07184.1"
FT                   /translation="MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGAR
FT                   RLHLVDLNGAFAGKPKNLEAIEAILDEVGDEIPVQLGGGIRSLETIEKYLDAGLSYVII
FT                   GTAAVKNPGFLQDACTAFSGSIIVGLDAKDGKVATDGWSKLTGHEVIDLAKKFEDYGVE
FT                   SIVYTDIGRDGMLQGINIDATVKLAQAVGIPVIASGGLSNLPDIESLCEVEEHGVEGVI
FT                   CGRAIYSGDLDFAAAQKRADELNGELDNA"
FT   gene            480418..481191
FT                   /locus_tag="Bcen2424_0431"
FT   CDS_pept        480418..481191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0431"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis; KEGG:
FT                   bcn:Bcen_2676 imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07185"
FT                   /db_xref="GOA:A0K3V8"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3V8"
FT                   /protein_id="ABK07185.1"
FT                   /translation="MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGA
FT                   DELTFLDITATSDQRDLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKVSMN
FT                   SSAVANPQLVRDAADKYGSQCIVVAIDAKRVSADGETPRWEVFTHGGRKNTGLDAIEWA
FT                   RKMAELGAGEILLTSMDRDGTKSGFDLALTRGVSDAVPVPVIASGGVGSLQHLADGIKD
FT                   GRADAVLAASIFHYGEHTVGEAKRFMSDQGIPVRL"
FT   gene            481191..481607
FT                   /locus_tag="Bcen2424_0432"
FT   CDS_pept        481191..481607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0432"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   bcn:Bcen_2675 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07186"
FT                   /db_xref="GOA:A0K3V9"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3V9"
FT                   /protein_id="ABK07186.1"
FT                   /translation="MNTETKSLPAWLDKVRWDDNGLVPVIAQEASTNDVLMFAWMNREA
FT                   LAKTIETQRAVYYSRSRKRLWFKGEESGHVQHVHEVRLDCDEDVVLLKVEQVSGIACHT
FT                   GRHSCFFQKFEGTVDGGDWVAVEPVLKDPEHIYK"
FT   gene            481604..481969
FT                   /locus_tag="Bcen2424_0433"
FT   CDS_pept        481604..481969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0433"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /note="PFAM: phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   bcn:Bcen_2674 phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07187"
FT                   /db_xref="GOA:A0K3W0"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3W0"
FT                   /protein_id="ABK07187.1"
FT                   /translation="MTQSTEDTLLRLAAVIDSRKGGDPDQSYVSRLFHKGDDAVLKKIG
FT                   EEATEVVLAAKDVRQGGAPSALVGEVADLWFHCLVMLSHFDLSPADVIAELERREGLSG
FT                   IEEKALRKRREREENGG"
FT   gene            482040..482432
FT                   /locus_tag="Bcen2424_0434"
FT   CDS_pept        482040..482432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0434"
FT                   /product="membrane protein"
FT                   /note="KEGG: bcn:Bcen_2673 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07188"
FT                   /protein_id="ABK07188.1"
FT                   /translation="MNDTSNQFPTPAVSGAAEAERLNGLRTLTHVLYGLYAIHWLTGGV
FT                   TGIIAIIINYVKRGDVAGTPYADHFEWQIRTFWRALIAYVIGFALMFVAIGFVVMFVTW
FT                   IWTLYRIIKGWLYLNDNKTLDPQAWF"
FT   gene            482464..482829
FT                   /locus_tag="Bcen2424_0435"
FT   CDS_pept        482464..482829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0435"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bcn:Bcen_2672 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07189"
FT                   /protein_id="ABK07189.1"
FT                   /translation="MSHDPNCLFCKIAAGEIPSTKVHEDDEFVAFRDIRPAADTHVLVI
FT                   PRRHLPTLSAASEADAPMLGRLMLLVARLADQLGVAYTGGETGFRTVINTGPGGGQEVY
FT                   HLHAHILAGPRPWQRMG"
FT   gene            482923..483153
FT                   /locus_tag="Bcen2424_0436"
FT   CDS_pept        482923..483153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0436"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: bcn:Bcen_2671 twin-arginine
FT                   translocation protein, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07190"
FT                   /db_xref="GOA:A0K3W3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3W3"
FT                   /protein_id="ABK07190.1"
FT                   /translation="MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKE
FT                   GETPADAQQLPRSGAVDVNAKETTRSDSNKA"
FT   gene            483180..483719
FT                   /locus_tag="Bcen2424_0437"
FT   CDS_pept        483180..483719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0437"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: bcn:Bcen_2670 twin-arginine
FT                   translocation protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07191"
FT                   /db_xref="GOA:A0K3W4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K3W4"
FT                   /protein_id="ABK07191.1"
FT                   /translation="MLDLGLSKMALIGVVALVVLGPERLPRVARTAGALFGRAQRYIND
FT                   VKAEVSREIELDALRTMKTDFESAARNVETTIHDNLREHEKELNDTWHSAVGGLDGAAG
FT                   DAGSVGSPGSDTPAAPSWRGSSAALAPKRRNWRIKQAATPVWYKRATTRRTHVQSGAAR
FT                   VARHQPASLRRPTRFF"
FT   gene            483761..484549
FT                   /locus_tag="Bcen2424_0438"
FT   CDS_pept        483761..484549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0438"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: bcn:Bcen_2669 sec-independent protein
FT                   translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07192"
FT                   /protein_id="ABK07192.1"
FT                   /translation="MSDPQQNPGDAPEETFISHLVELRDRIIRAGLAVIVVFLGLVYWA
FT                   PDIFKLLARPLMDNLPKDGKMIVTDVTGSFFVPMKVTMLVALVIALPIVLYQIWAFVAP
FT                   GLYQHEKKLVAPLVGSSYFLFLCGMAFAYFLVFPTIFRVMAHYNAPLGAEMTTDIDNYL
FT                   SFVLGMFIAFGVTFEVPIVVVLLVRMGVLSLKKLKEMRPYVIVGAFVVAAVVTPPDVFS
FT                   QLMLALPLVVLFEIGLLAARFFVPKKPVEEGEAGNGEAAG"
FT   gene            complement(484755..485960)
FT                   /locus_tag="Bcen2424_0439"
FT   CDS_pept        complement(484755..485960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0439"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bcn:Bcen_2668 peptidase
FT                   S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07193"
FT                   /protein_id="ABK07193.1"
FT                   /translation="MLRRFWLFFAQAVTVLLALMFIVVTLKPQWLQRQGQLGKQLATPI
FT                   VALREVAPGIGGAPATTSYAEAAQKAMPAVVNVFSSKDGSLPPDPRAKDPLFRYFFGDR
FT                   NARKQQDEPAANLGSGVIVSPEGYILTNQHVVDGADQIEVALADGRTATAKVIGSDPET
FT                   DLAVLKINMTNLPTITLGRSDQSRVGDVVLAIGNPFGVGQTVTMGIISALGRNHLGINT
FT                   FENFIQTDAPINPGNSGGALVDVNGNLLGINTAIYSRSGGSLGIGFAIPVSTARTVLES
FT                   IITTGSVTRGWIGVEPQDVTPEIAESFGLQQKSGAIVAGVLQGGPADKAGIKPGDILVS
FT                   VNGDEITDTTKLLNTVAQIKPGTPTKVHVVRKGKQFDVNVVIGKRPPPPKQALDEQDND
FT                   SE"
FT   sig_peptide     complement(485880..485960)
FT                   /locus_tag="Bcen2424_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.421 at
FT                   residue 27"
FT   gene            485982..486728
FT                   /locus_tag="Bcen2424_0440"
FT   CDS_pept        485982..486728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0440"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   bcn:Bcen_2667 protein of unknown function DUF34"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07194"
FT                   /protein_id="ABK07194.1"
FT                   /translation="MDRIELELYLNNTLETARFKDYCPNGLQVEGRRKIEKIATGVTAS
FT                   VAFLEAALEWGADAVLVHHGYFWRNEAPQITGRKYQRLKLLLANDLNLFAFHLPLDAHP
FT                   EFGNNAQLGEKLGLIGDQRFGEGDLGWMATLPMPVTLEHFVAKVERTLGRTPLVLGEPD
FT                   TQLRRIAWCTGAAQSYFDAAIDAGADVFLTGEVSESTTHAAAESGVAFVAAGHHATERY
FT                   GIQALGRHLSEEFDLEHLFIDIHNPV"
FT   gene            486947..487567
FT                   /locus_tag="Bcen2424_0441"
FT   CDS_pept        486947..487567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0441"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="KEGG: bcn:Bcen_2666 ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; TIGRFAM:
FT                   ubiquinol-cytochrome c reductase, iron-sulfur subunit;
FT                   PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07195"
FT                   /protein_id="ABK07195.1"
FT                   /translation="MRDKEEKRVDSGRRTWLIATSVAGGVGGVATVIPFAASLAPSAKA
FT                   KAAGAPVEVDISGLKPGEMVTVPWRGKPVWILNRTDSMLADVVKADKEVADPATKSPYS
FT                   MPLPAYCANEYRSRADRKNILVVMAVCTHLGCTPSQRFTPGPQPNLPDDWPGGFLCPCH
FT                   GSTYDLAGRVFKNKPAPQNLDIPPYMFTSATTLVIGKDEKGEA"
FT   gene            487567..488949
FT                   /locus_tag="Bcen2424_0442"
FT   CDS_pept        487567..488949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0442"
FT                   /product="Cytochrome b/b6, N-terminal domain protein"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; KEGG:
FT                   bcn:Bcen_2665 cytochrome b/b6-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07196"
FT                   /protein_id="ABK07196.1"
FT                   /translation="MAADNKEVSTTGFTGWIDQRFPLTSTWKKHVSEYYAPKNFNFWYF
FT                   FGSLALLVLVNQIVTGIFLTMNYKPDSTLAFASVEYIMREVPWGWLIRYMHSTGASMFF
FT                   VVVYLHMFRGLLYGSYRKPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVN
FT                   LFSAIPFVGPDLSLWIRGDYVVSDVTLNRFFAFHVIAIPLVLVGLVVAHLVALHEVGSN
FT                   NPDGIEIKAKKDENGVPLDGIPFHPYYSVHDFLGVCVFLMVFALIVFFSPEMGGYFLEA
FT                   NNFVPANPLQTPPEIAPVWYFTAFYAMLRATTDPFKIVLMIVIALLGVLALIRARGKWK
FT                   VGLPVLAAAIVVFMYLTESKFWGVVVMGSAVISLFFLPWLDRSPVKSIRYRPLFHKVFL
FT                   GIFVAAFLTLAFLGTRPPSPAATLIAQACALIYFAFFLGMPVWTPLGTFKQPPERVRFK
FT                   PH"
FT   gene            488971..489729
FT                   /locus_tag="Bcen2424_0443"
FT   CDS_pept        488971..489729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0443"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: bcn:Bcen_2664 cytochrome
FT                   c1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07197"
FT                   /protein_id="ABK07197.1"
FT                   /translation="MKKLLSTLALIGATACALLAAPAVRAEGNFPLDRAPDNTENLVSL
FT                   QHGAQLFVNYCLNCHSANLMRYNRLTDLGISQKEIETNLLFTTDKVGNTMSVAMRPDDA
FT                   KNWLGTTPPDLSVEERARGRDWLYTYLRSFYRDDTRPTGWNNAVFENVGMPHVLWQLQG
FT                   QRVAKFEDKTDEETGEKAHVLVGFQQVTPGTLSSPDYDAAVADLVAYMTWMSEPAQQTR
FT                   KRLGVWVLIFLGVLTFLAWRLNAAYWKDIK"
FT   sig_peptide     488971..489051
FT                   /locus_tag="Bcen2424_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.783 at
FT                   residue 27"
FT   gene            489824..490435
FT                   /locus_tag="Bcen2424_0444"
FT   CDS_pept        489824..490435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0444"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: glutaredoxin; Glutathione S-transferase,
FT                   N-terminal domain; KEGG: bcn:Bcen_2663 glutathione
FT                   S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07198"
FT                   /protein_id="ABK07198.1"
FT                   /translation="MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMN
FT                   PYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVH
FT                   VSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLLWRL
FT                   DHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR"
FT   gene            490507..491028
FT                   /locus_tag="Bcen2424_0445"
FT   CDS_pept        490507..491028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0445"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   bcn:Bcen_2662 stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07199"
FT                   /protein_id="ABK07199.1"
FT                   /translation="MQEISTKPYLLRALYEWCTDNGYTPHIAVRVDNSTRVPRQFVRDG
FT                   EIVLNISFEATSQLQMGNEWIEFTARFSGKAHKIEIPVANVLAIYARENGQGMAFQVDA
FT                   VAGEGEDSGAFDDDAAPADDAQRDESVSPLAPVADSGANEEPSEGADEPPKTDGDGSKG
FT                   GSRPRLKIVK"
FT   gene            491047..491122
FT                   /locus_tag="Bcen2424_R0015"
FT                   /note="tRNA-Thr2"
FT   tRNA            491047..491122
FT                   /locus_tag="Bcen2424_R0015"
FT                   /product="tRNA-Thr"
FT   gene            491220..492263
FT                   /locus_tag="Bcen2424_0446"
FT   CDS_pept        491220..492263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0446"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bcn:Bcen_2661 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07200"
FT                   /protein_id="ABK07200.1"
FT                   /translation="MATIVKTPSGTWKAVIRKIGWPTSAKTFRTKRDAEDWARRTEDEM
FT                   VRGVYLSRAPSEKLTVSAALKRYMEEVSVTKKATTQRSESFSAKHLEAFFGKYSMAAVS
FT                   AELVAKYRDERLAAGKSNNTVRLELAMLGHLFRMAIQEWGIGLTFNPVANVRKPSPGAG
FT                   RDRRLSRDEHQRLFAAADAHSNPMLGWIVRLAVETGMRSSEITGLCRSQVDLDRRVVTL
FT                   RDTKNGSSRVVPLTREAAEVLRAALDNPIRPIDTDLVFFGEPGRDGKRKPYVFQKLWTG
FT                   IVRDLGMVDLHFHDLRHEAVSRLVEAGLSDQEVASISGHKSMQMLKRYTHLRAEDLVQK
FT                   LDTLRRA"
FT   gene            492888..493622
FT                   /locus_tag="Bcen2424_0447"
FT   CDS_pept        492888..493622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07201"
FT                   /protein_id="ABK07201.1"
FT                   /translation="MHGRVDTTFITVQRELYTSGLARELGSDAINVWLAIKWHADFNTG
FT                   VGYPSIRRLMDLTKLASATVQKALMRLEAARLLKKVGKKGRAQCYLARERLDVTSEQGK
FT                   CCSIVIDYVPRSLSKWIARIKAALETGEHDPDAFARVEVVPGAGLTWDSKTGELRAAIP
FT                   VAVTPQAAGPPSDKPLSPLAARVAEIGANAMRGPDNAASGPPRCTNTKTGLTTTHLPRG
FT                   ESWLELSVPATHSNTKRLTSLV"
FT   gene            493927..494166
FT                   /locus_tag="Bcen2424_0448"
FT   CDS_pept        493927..494166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07202"
FT                   /protein_id="ABK07202.1"
FT                   /translation="MKKYLYVLVACVLAACGQEYHTKAWYIEHDAERASRFKVCENDPA
FT                   QYLRQGSDCLNAKEANAMVTFYGKEAALRAAREQ"
FT   sig_peptide     493927..493980
FT                   /locus_tag="Bcen2424_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.645 at
FT                   residue 18"
FT   gene            494177..495316
FT                   /locus_tag="Bcen2424_0449"
FT   CDS_pept        494177..495316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0449"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: bcn:Bcen_2658 TrbL/VirB6 plasmid conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07203"
FT                   /protein_id="ABK07203.1"
FT                   /translation="MAFDAVTQIFDYMDAVTLQIVAENVSRMIAWVTPLAALGLTIMLI
FT                   IDGVATMLRPSGVPLTHLVEKFLKYYAIVGIAGAGGLYETTLASTAIHLPDELASKLLI
FT                   HGSLGASNSAIASLIDGAIDHSLTVMRTVFANSSLLTSTGIGAFILGIVLVLSTLLICG
FT                   VGAVSILIAKFLLALSVCFGPFFIFMLLAPPLANLFGNWLGSVLNYVILIAITAMSFGV
FT                   FMHFYDSAISAAAKPNPDAAIIGPIITAGLVTVMALGLLKVLPDLAARWTSGAKTNFDR
FT                   FLPQPSSFSAAPGGGGGSQSGGNNGGSAGAGSGSNSGGGSAGGYSSSGSGYSYARGSQG
FT                   SAGTGSGSNSGTGSAGGNSSSGGGYSYAQGSQGSQNRGT"
FT   gene            495319..495774
FT                   /locus_tag="Bcen2424_0450"
FT   CDS_pept        495319..495774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07204"
FT                   /protein_id="ABK07204.1"
FT                   /translation="MIEVSNDALRTIVVTGMAVVGATVIFRFVVPFIGSRLRGETIADH
FT                   VTRVESEQREKRLFQSNLNTSPREALSIRVVNMAIALTVMWLLSRFPTSYLVVYFVLYV
FT                   AVGMGFCWWAKVIPDEKFHCLNWNSRLQLRLFYVWLWPINVVRSLMR"
FT   gene            complement(496114..496842)
FT                   /locus_tag="Bcen2424_0451"
FT   CDS_pept        complement(496114..496842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07205"
FT                   /protein_id="ABK07205.1"
FT                   /translation="MSMVVIKDRAALMQRLMDAVIQGYHSYTFGTVKTERVHALCEKFS
FT                   DRYLVALNRNQLAYRRAKGFGNARLILADLGDPNGLHWWLLVTDGAHPAREREKGSRKT
FT                   REDLKDALKPGERIHVSGYELLKMAHSKAVGGGVRLTWRMTDETKRQWRYQIRVAVRAR
FT                   HADDAVARVTRLMYKAPRFDSIKAQVDKLTDFLRAEWDRTGHDVQLLSIPAALKPIPRV
FT                   ASDGIPVAEWIAAQMPEQAA"
FT   gene            497082..497807
FT                   /locus_tag="Bcen2424_0452"
FT   CDS_pept        497082..497807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07206"
FT                   /protein_id="ABK07206.1"
FT                   /translation="MKLYENIVIGNFLYALGFAVRARRPSGVTASAVNLLQQTPADTLL
FT                   GDLLLEFPGVVRLIEFKAEDNRESKELSRHRKLAAGMSGNAELQAVSRDVHWYVETAPS
FT                   TEHGVVARVVPYLDAFPRERAKRDRLETFIERLAREVAEERPRVRADREAAYLRWVKQT
FT                   QGDGMVGSGGLILVADANGALRYAQLLDMLEMRLSHRQWVELHHQRRERELALERELGR
FT                   RLERRHDKSIEGPTHEIPL"
FT   gene            497867..498466
FT                   /locus_tag="Bcen2424_0453"
FT   CDS_pept        497867..498466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_3030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07207"
FT                   /protein_id="ABK07207.1"
FT                   /translation="MLEATYEDEQRSRQAITSLERLRTTVEEKVGTLSRDTVKLIEGSS
FT                   EATATQAAKLLREKFVEADVAAEHARARYVRATHSLGWRLFGLAVLVQLLIFVGVWVIV
FT                   ARTLPSQDDIAARRQTLQELAQQISGQQSQAAELDRQIKAKQRKVNDLDRRGARVEWTT
FT                   CSDSEQVSHLCFRTDDQAGDFTSGNGGKTFRVPWGY"
FT   gene            499546..501162
FT                   /locus_tag="Bcen2424_0454"
FT   CDS_pept        499546..501162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0454"
FT                   /product="phage protein"
FT                   /note="KEGG: bcn:Bcen_2653 phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07208"
FT                   /protein_id="ABK07208.1"
FT                   /translation="MWERLTISRLLSRESSRSMTISEILAKQLKAHSSGPFLFAGSGLS
FT                   RRYLGLDDWAGLLRRFCSHIKTYEYYLSSANGDLPSVAAAMAEDFHEVWWNHDDYAVSR
FT                   EKHSKKITERTGPLRVEICDYLKSVGLADLSQNPYGDELAALSRLNVDGIITTNWDTFL
FT                   QSLFPDYRVYVGQGELLFSNPQSIGEIYKIHGCVNTPRSLVLTQQDYQGFNERNAYLAA
FT                   KLITIFVEHPVIFMGYSLNDGNILSLLRAICACIGQDKLQQLNNNLIFVQRAGDGDEES
FT                   VSQTIIALETVQIPITLVKAISFTGIYEAIESTKRKIPARVLRYCKEQLYELVKTTEPH
FT                   GKLVVVDVDQVNGRQDIEFVVGVGVAAEREEEERRRLGDVGYRGITPLDLFHDLVFRDK
FT                   GYDARRVLTEAMPRLSRGLTYLPVFFLLHAAGITSAAEYAASGFGVDKYVNLTPHAFQL
FT                   KNLKKGFMRNYRELTVTEMIHRNPPEIVAQYLPFTQWTRADYGVIHEFLVAHADRFSNS
FT                   NYSTAFRKLACLYDRAAYGWE"
FT   gene            501276..502160
FT                   /locus_tag="Bcen2424_0455"
FT   CDS_pept        501276..502160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07209"
FT                   /protein_id="ABK07209.1"
FT                   /translation="MTNLPDRIRLLASAFTRPVFAAMARTGDHDVPLRALVKAGVLKTH
FT                   RDDRQPLSSVFDEAWDHIARTYRNEYVYKNDLASRLVFGRHSPRTASFQVELPVGRSIV
FT                   DVAVANGTTTAYEIKTEYDTAKRLKTQTYDYLQAFDRVFVVTHPAHLKRFESEVDSRVG
FT                   LISLSTKGTLSIRREAHSNLERLDSATIFRCLRQSEYLDAIEMLFGERPSLPNGLIGAY
FT                   CEKLFSTVSSEDAHRIFVNALRARTTDSNTVGFVSQLPTSLRALGYATPLSGRQRSNIL
FT                   ALLSKPVGLTVVV"
FT   sig_peptide     501276..501341
FT                   /locus_tag="Bcen2424_0455"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.480 at
FT                   residue 22"
FT   gene            502224..503174
FT                   /locus_tag="Bcen2424_0456"
FT   CDS_pept        502224..503174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07210"
FT                   /protein_id="ABK07210.1"
FT                   /translation="MYLPFVFGRQSELRALSDVNKKYTVSGRVVPIIEPVVAKPNDLLR
FT                   CLGNFGKSQAKALVIVNPSQGDFKKVAAKAWRVEVDAELVKYPTLMPAFQCGPKTSFSA
FT                   IDAFLSEYAGRQVGLVYYSPSLTDAEVKKLAGKSIIDFHISLQGKMTSTQRSLLPISKA
FT                   IDIIDHFNKQDRNSDYSGAELFTDRHKTYSTTGVGFGDYTVTGSTFQPGGGKPAAVAIH
FT                   ATFKNPKNKDVWVEHFVSDDIDIKTGSANSKYLEAVAKLALAVPKRSSEFGKNAALTAY
FT                   IEDYKTSHFSGLGKSKERQIYHHIAVMHDILHGTL"
FT   gene            503892..504095
FT                   /locus_tag="Bcen2424_0457"
FT   CDS_pept        503892..504095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07211"
FT                   /protein_id="ABK07211.1"
FT                   /translation="MLSPHEFSMLLRIARAPDSVDLANPAFAVLVEKRLVDDTQVRVNA
FT                   VAARPALTPIGQMLLSRFDEAA"
FT   gene            complement(504205..505005)
FT                   /locus_tag="Bcen2424_0458"
FT   CDS_pept        complement(504205..505005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0458"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; SMART: ionotropic glutamate receptor; KEGG:
FT                   bcn:Bcen_2649 extracellular solute-binding protein, family
FT                   3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07212"
FT                   /protein_id="ABK07212.1"
FT                   /translation="MKRSKFLLSGLLLASALGFTAVAAHADDLLDSVKKAGVLRVGLEG
FT                   TYPPFNSRGTSGQLEGFDVDVANAVAGKLGVKTQFIPTEWSGIIAGLQAGKFDVIVNQV
FT                   TITPQRKEALDFSEPYTYSAAQLIQRKDDTRNFKSLDDFKGKKLGVTLGTNYDQMARTV
FT                   PGIEVQTYPGAPEKLRDLAAGRIEATLDDRLMLPYMIKTSNLPLRAGAVLNGGKQEMAI
FT                   PFRKGNPKFEKAINDALESLRKDGTLKKISTHWFGSDVTVPVAQ"
FT   sig_peptide     complement(504925..505005)
FT                   /locus_tag="Bcen2424_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 27"
FT   gene            505362..508553
FT                   /locus_tag="Bcen2424_0459"
FT   CDS_pept        505362..508553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0459"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG: bcn:Bcen_2648
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07213"
FT                   /protein_id="ABK07213.1"
FT                   /translation="MNMQNTIAALRGGLLQQDRLLKLDTPLGSNVLTVQRAVGRSRIGR
FT                   AYEFTLDVLSTDSDLELKKLIAQPVTLWIQQGDRSYRPMNGYVHTARRLGADGGLTTYQ
FT                   LTFADFTHFLKFRRDQRIWNDTTVDQIISDVLNQHPQAKGHFRFALSKPLPNRSYTRQH
FT                   DTDWHFIHRLMEDEGLYCAWQQADDGKSHTLVVTDNLQAFAPLSPQTVRFYRGGAASEA
FT                   DAFTQWSGTRTLQSVTRSTRTFDYKNPAQPSNPKGTSLPTMAGQGELPDQLEVYEYTGA
FT                   YTYLDQTRGDHLTKIRMEQWESEAKRFHGAGGVRAIDAGRRFTLADHPEHDRDPADQRE
FT                   FAAIGVEWWIENNLPVSNGSADFPYSLREALTQAQEGYGADPAFRVPHDDGSVGFYLVE
FT                   VEAQRVNVPYRSPFEHKKPEMHLETAIVVGPQGEEVYTDELNRTRVQFVWDRLNPGNEN
FT                   ASCWVRVVQSDTGGGYGGVHVPRIGEEVLIDYVGGDCDRPLAVGRVYNGANQPQWHSDG
FT                   ILSGYRSKEYSGGGYNQLVMDDATGQNRVQLMSSSANSLLHLGYIIDQNGNARGSYLGS
FT                   GFDLRSDAYGAVRASQGLYVTTHPKAANSQPLDVKEAQQQLVAGESLVEAMSGVSEQHQ
FT                   AESLKDAQDTMRAFTDATQDSQSGSAAGGRTAGGGTGNANAFKEPVMLFGSPSGIGMST
FT                   QQSVHMVANDHVNVASGQSVHVAAGKSLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQ
FT                   SDNIEVTAQKAVRVVSATDRIEIAADQGILLTSGGGYIRIKDGDIEIHTPGAVDVKGAS
FT                   HTFAGPASMGYPLPSPRPDQPGQLELFHKYVNGEAVKGGLFTVKDVNGAVLKKGALDNS
FT                   GYTVVSGLPPGAVRVEFGKDPRESDQPANYFKQAKWPAEPVQPSPEAAQAAASGQLASQ
FT                   LQGMAPAATTAAMGLVSGGGAGAALGGLASAALPAAATALGGAGVASALQTASSLSGAA
FT                   KQVAGMVQAARQGGLAALAAPAANAASGALQGALPGALPGVAGIAGKGATTVASAAGAT
FT                   GMKLPTSGFGGPLKS"
FT   gene            508605..513260
FT                   /locus_tag="Bcen2424_0460"
FT   CDS_pept        508605..513260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0460"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; YD
FT                   repeat-containing protein; KEGG: bcn:Bcen_2647 YD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07214"
FT                   /protein_id="ABK07214.1"
FT                   /translation="MAQQLPPGAEKEQAVSWLSDISPKDVAAGGDRFNKWLLKISGNHI
FT                   SFEDLKTVASAVPIIGNLMAFYDAVCDIVTIVEKRHADLLDYLGLAINLIGVIPVPPPL
FT                   ASFRLSARPLLALVRNQLLVSRGNLGAAIIGVLVAHVNAAAATEIENFLKTLQEVLVDL
FT                   LNDCAAKAQELMVGIASGLELALKGQIFDSSANVRRTQQIARKMGERSWYNPKLLVDAF
FT                   EYGYEGSIALGKEAGNATVGTAAKLAPDSWLQPFRDIVAFLKTEAPKVAKAIRDLNGSE
FT                   EGKMLWLIAQVIEAVARVRAGGKLREKTADVPTGGKGRAHHDRPQEPVGAVEQHAHPEG
FT                   PGQSPCKGCGVGASTGSIDFAFGDETFTHTDFELPGALPLVWARTYRSRLSAYDTGELG
FT                   ARWITPYTTRIDIEGDTWFYRDASGRSIEYRALAAGSVHDDLSENLTLSRLDDTWVTIA
FT                   YGHDELHVYERRGNAFRLAMQKDRAGNTITLDYDARDHVARLIDANGNVLSFEHDKHGR
FT                   IVLIEQVLEDGKRRTLASYAYDEAADLIRATDRHGNAWNYQYDRHLVTRYTDRTGRGMS
FT                   LEWDGADADDNANAKCVREYADDGSLDIRLAWHPNIRLTYVTDALGQTTRYYFNIKGYV
FT                   YRIAYPDGSEEWFRRDEHNNLTLHILPDGSVEQMRYDARGNRTWHERADGSIVEMAYDD
FT                   KDQMIRLVDPNGHVWQRKYDDAGNLVEEIDPLEHSTKYSYNDKGLPTQITDAKGGSKAL
FT                   EYNAAGQLTGYTDCSGKKTAWRYDDIGRAIETKDASGGVVAYAYGPNGQLTEIRSPAGV
FT                   EHVQYDAEGRLLGRTDQLNRSTRYGYDAVGRIASRSDALGQTIAYRYDRLGRLTALTDA
FT                   NFATYQFRYDPAGRLIEEIAFDGKSTRYQYDPDSGSLVSIDEAGCVTSVDVDANGRLLK
FT                   RIAGDSEERFAYDPSGRLIDAVNRYSRVQFFFDPVGNLVREHHAYDLFGDRRSYVWHHE
FT                   YDELGNRRRTVRPDGHAVDWLMYGSGHVHGMLLDGEERVQFERDDLHRETVRVLSSKVG
FT                   QRTHYDPAGRVLQQTIQRSTSPAPLAERRYRYDAVGQLSRIEDSRKGGTDYRYDPVGRL
FT                   IEAISPVAKERFAFDPASNIIDPVRITETPASRPSPVRPESTLPVEVPKVLGNLLKAYA
FT                   GMHFEYDARGNLVRKRTPAGQQEYEWDEFNRLLSARVAETSRQSQARYFYDAFGRRIAK
FT                   EVNGERTVFGWDGDTLAYESDGERGTHYLYEPGTFVPLAQYVAEPVEGIETPVWTSTDR
FT                   YVPEDDPLQKVPERRGDAAVFYYHCDQIGTPQLLTDDDGDVVWEASYKAWGEAREVIAR
FT                   ASKAAGIVAKNPLRFQGQQVDAETGLHYNWHRYYDSGIGRFVSKDPIGLVGGINVYQYA
FT                   SNPVEWIDPLGLAPRRPAHEASIQRRVNCLKSQGFQEHHIISDKNSQTKNHPLIALAGF
FT                   DLQSQANKIYLPDDESLHPTRSIHNGRHPNIVSTNLSRQMNDAVVIGKQQGWGQKQYDA
FT                   ALRGIIARERMELKAGNRMLNKNHRPWACPN"
FT   gene            513271..513846
FT                   /locus_tag="Bcen2424_0461"
FT   CDS_pept        513271..513846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07215"
FT                   /protein_id="ABK07215.1"
FT                   /translation="MTKIWTTEADYPESRMALYDEAKNQVDRFDLQAATRLTKSNPLVF
FT                   DLPKKGVAKIQDYGVIWSNILIPLVSEAVRVAIEGLANDGDVQFIPAVIESDGKAIDGS
FT                   YFLLNPVRKVDVIDHDASEPIVVKIPGFPDAKVGFKKMVLRSDFSANGIGRQYDSLTYI
FT                   VVGDRLAEAVLCATKKGVRFTTGIPPAD"
FT   gene            514382..514699
FT                   /locus_tag="Bcen2424_0462"
FT   CDS_pept        514382..514699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07216"
FT                   /protein_id="ABK07216.1"
FT                   /translation="MSTTPATIASLQHILEHPGDFSGWLCLPPTPWALDTEGVFTEDAD
FT                   NTEVDTPPAAAPQPGWRVTLNSATIEDIVINAHDQVDEPTVAQLFDAFVFYVDNDEFIL
FT                   L"
FT   gene            complement(514786..515568)
FT                   /locus_tag="Bcen2424_0463"
FT   CDS_pept        complement(514786..515568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07217"
FT                   /protein_id="ABK07217.1"
FT                   /translation="MSYAPSLFGDNVPPPLHSPASTDSAFQARSLLDLLYDGFFMLFLL
FT                   KNKREPDSASEFSTRIQEFLSDFERGAKKLNIAAEDVYGAKFAFCAAIDEMVLSSQFKI
FT                   RADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLE
FT                   GPEKLAYLTARLGDEIAHMKGKRAAFAPHWPLPDQIAHRLKREVPVWAIGTVFALVALL
FT                   GYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP"
FT   gene            complement(515565..516911)
FT                   /locus_tag="Bcen2424_0464"
FT   CDS_pept        complement(515565..516911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0464"
FT                   /product="protein of unknown function DUF876"
FT                   /note="PFAM: protein of unknown function DUF876; KEGG:
FT                   bcn:Bcen_2642 protein of unknown function DUF876"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07218"
FT                   /protein_id="ABK07218.1"
FT                   /translation="MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGV
FT                   RSVRIDRDALGSNVLRVAELALVFPDGALYAAPQADDLPPPIALDTLPDGINEFVFYLA
FT                   LHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTDAAEADITFLKTQVKLIAHSEPRD
FT                   QLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDALQAKVNALYGFH
FT                   REPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMTF
FT                   SKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDS
FT                   GKIDDKTEFYLAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPP
FT                   AIPVRPGACYFALDSRSPLYERMLQAQSAMIYAPTGINDLKFELIAVTS"
FT   gene            complement(517014..517625)
FT                   /locus_tag="Bcen2424_0465"
FT   CDS_pept        complement(517014..517625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07219"
FT                   /protein_id="ABK07219.1"
FT                   /translation="MRSSMIRYALPLVACALLAGCAAAPLLGSAASAVMSAAGIGKPEV
FT                   PDAQKPPRNIGLTLAAAPNLNAATDHKPLALVVRLYALKDPTSFQQAPFDAFTDPTKEK
FT                   AALGADLLNVREITLIPGQRYTATEKVSREAQAFGIVALFRDPALQRWKLTFDPAKSEK
FT                   SGIIIGLHNCAMTVTDGTVIAPQQGAPSQPLNLLSSVSCG"
FT   sig_peptide     complement(517515..517625)
FT                   /locus_tag="Bcen2424_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.515 at
FT                   residue 37"
FT   gene            517998..518633
FT                   /locus_tag="Bcen2424_0466"
FT   CDS_pept        517998..518633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0466"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   bcn:Bcen_2640 tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07220"
FT                   /protein_id="ABK07220.1"
FT                   /translation="MKDRLFAKLSGVVVACGVIAGCASQPPAPPTAEVFNKSLADADAV
FT                   AKAGDQDKALGLYQQLAKSDPTREEPWSRIAQIQFAQNHYGQAIVAAQEALQRDATDRQ
FT                   AKSVLAVAGLRIATQSLGELRQDASLAGDAKSDAQALAKQLRDTLGESALFPPETKTVK
FT                   PRPPRRVVHRPKGGAAPAADAAAPAAPSAPTPPVAQKGSADPFGALRN"
FT   sig_peptide     517998..518096
FT                   /locus_tag="Bcen2424_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.336 at
FT                   residue 33"
FT   gene            518680..519195
FT                   /locus_tag="Bcen2424_0467"
FT   CDS_pept        518680..519195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0467"
FT                   /product="Uncharacterized conserved protein UCP028301"
FT                   /note="PFAM: Uncharacterised conserved protein UCP028301;
FT                   KEGG: bcn:Bcen_2639 uncharacterised conserved protein
FT                   UCP028301"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07221"
FT                   /protein_id="ABK07221.1"
FT                   /translation="MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGD
FT                   LAGQSEIEQPKLRDRKFVNIDRDNFDDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRS
FT                   LSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGNDKLEDLLSEVLKNTQQLQELAKG
FT                   TGGDKDGE"
FT   gene            519211..520701
FT                   /locus_tag="Bcen2424_0468"
FT   CDS_pept        519211..520701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0468"
FT                   /product="protein of unknown function DUF877"
FT                   /note="PFAM: protein of unknown function DUF877; KEGG:
FT                   bcn:Bcen_2638 protein of unknown function DUF877"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07222"
FT                   /protein_id="ABK07222.1"
FT                   /translation="MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLI
FT                   GELVHQVLDGTVIVSDNLSATIDARVAELDRLISTQLSAVMHAPEFQRLESTWRGMDYL
FT                   VKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSALFKKVYEEEFGTFGGSPFGALIG
FT                   DYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGKPRDLGKVFDTVE
FT                   YAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCNA
FT                   AWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRR
FT                   EKELSDLGFIPLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRV
FT                   AHYLKAMMRDKIGSFASAQNVETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEI
FT                   PGKPGSYRSVAFLRPHFQLDELSISLRLVADLPKPANS"
FT   gene            520772..521275
FT                   /locus_tag="Bcen2424_0469"
FT   CDS_pept        520772..521275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0469"
FT                   /product="protein of unknown function DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   bcn:Bcen_2637 protein of unknown function DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07223"
FT                   /protein_id="ABK07223.1"
FT                   /translation="MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATAST
FT                   AGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEV
FT                   KLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDK
FT                   TYAV"
FT   gene            521338..521823
FT                   /locus_tag="Bcen2424_0470"
FT   CDS_pept        521338..521823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0470"
FT                   /product="protein of unknown function DUF1316"
FT                   /note="PFAM: protein of unknown function DUF1316; KEGG:
FT                   bcn:Bcen_2636 protein of unknown function DUF1316"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07224"
FT                   /protein_id="ABK07224.1"
FT                   /translation="MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAIL
FT                   NTRIAHTENELAALPECQKSVLTYGLNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQ
FT                   QVQVTFELNEQATNALYFAIQALLVVHPAEEPVSFDAMLQPSTLQYSVTRARAARMQ"
FT   gene            521900..523735
FT                   /locus_tag="Bcen2424_0471"
FT   CDS_pept        521900..523735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0471"
FT                   /product="protein of unknown function DUF879"
FT                   /note="PFAM: protein of unknown function DUF879; KEGG:
FT                   bcn:Bcen_2635 protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07225"
FT                   /protein_id="ABK07225.1"
FT                   /translation="MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHV
FT                   ERMIESFALLGARINKKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTE
FT                   PVVIDRGTELKSRPIRGVQCRFRTAYDVTLAPIRISEARYTPVALAPSATVLPSNATGV
FT                   ISITFESLAAQLDLGALKLSTLRAHLHGEQSFVAALTDCLFVNVLGAYVEPERNGRWTA
FT                   LRKLPIAQAGFAEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRCQ
FT                   RATLHLVLQDVRSDSHIARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVI
FT                   AEARRAFAYEVYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVA
FT                   QKSPGYETEISIVDIDFEPTSPQTDTLSLDLTCTNRDLPSMLAFGLEGGDLFQEGGAQT
FT                   SGISLLRRPTQSVRFERGRAAHWRLVSHLALNHVSLVAHGLAPLKEMLTLYDLRRTAVS
FT                   MRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFVGASLASFVRVLDSFFG
FT                   LYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA"
FT   gene            523699..524799
FT                   /locus_tag="Bcen2424_0472"
FT   CDS_pept        523699..524799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0472"
FT                   /product="protein of unknown function DUF1305"
FT                   /note="PFAM: protein of unknown function DUF1305; KEGG:
FT                   bur:Bcep18194_A3564 protein of unknown function DUF1305"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07226"
FT                   /protein_id="ABK07226.1"
FT                   /translation="MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPG
FT                   AWRQGDVVAQHIAFRNTLSLGFPPSEIEGARSFDDDGAPLNSDDERGTALAAGELGRVE
FT                   LTPAFFGLLGGQGALPLHYTEQIVAREHLRRDHAARAFFDVFSNRATALFYAAWKKYRL
FT                   PFHYELDRDERYLPLLLAIAGVPSDEVRDSLAAGPGGVLDEAVAGYALAARHRPMSAAY
FT                   LQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRARI
FT                   VVGPLSKRDYEAFLPGGAHAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRL
FT                   GWDAFLCTRDALEDRSDARYELHVIH"
FT   gene            524841..527510
FT                   /locus_tag="Bcen2424_0473"
FT   CDS_pept        524841..527510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0473"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: bur:Bcep18194_A3565 chaperonin
FT                   ClpA/B/, ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07227"
FT                   /protein_id="ABK07227.1"
FT                   /translation="MSTPLKTLITKLNPLCRHATERAASACLARGHYEVDLEHLFLALL
FT                   DEATGDLPLALRASRVDPHALHADLERELTRLKTGNTRTPVFSVHLIALFEQAWLIASL
FT                   DSQLGRIRSGHLLLALLTAPDLAQFAQRMSSRFAEMNVTDLKHKFDEIMAGSSEAEPRQ
FT                   ADDDGSDVAPAADGFAPAAGPSKTPALDTYTTNLTQRARDGKIDPVIGREAEIRQAIDI
FT                   LMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASVK
FT                   GEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTI
FT                   AATTWSEYKKYFEKDAALARRFQVVKVEEPSEPLAAAMLRGMSGLMEKHFNVRILDDAI
FT                   TEAVRLSHRYISGRQLPDKAISVLDTACAKVALAHSATPAAIDDTKKRIERIDAEIASL
FT                   EREAAGGAAHDERLGELRGARDTALEQLAKDEERYEAERVIVAEITELRDALDRARGPS
FT                   EDGQPVDVQATREKLAERVAALHALQGGEPMVPLQVDGHVVAEIVAAWTGIPLGRMVKD
FT                   EIDTVLNLQPLLTARVIGQDHALEAIAQRVRTATANLEDPNKPRGVFMFVGPSGVGKTE
FT                   TALALADILYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYS
FT                   VVLLDEVEKAHPDVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSAAVMQACLN
FT                   KPAEELPDPDALAEALRPQLYKTFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRRR
FT                   IEANHKAAFEWDESLVDAVLARCTEVDSGARNVDHILNGTLLPEIAGHVLGRIADGAAI
FT                   ARIAVRADEAGEFAYTVE"
FT   gene            527554..528675
FT                   /locus_tag="Bcen2424_0474"
FT   CDS_pept        527554..528675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0474"
FT                   /product="ImpA domain protein"
FT                   /note="PFAM: ImpA domain protein; KEGG: bcn:Bcen_2631
FT                   ImpA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07228"
FT                   /protein_id="ABK07228.1"
FT                   /translation="MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQG
FT                   EWVTEIKEADWGFVVDHAGELLRTRTKDLRLAVWLTEALALEDGITGLTEGYALLEGLC
FT                   RDFWDTFHPLPEDDDIEHRLGNVAWLSGRTAELLRAVPLTDGASNAFSTLDWEVAQHVA
FT                   QSIKRDPEHADDIARGKPSIDQIDASRRVTSIAFYTALLANLKAFEFALDAFEERLVER
FT                   AGDSAPSFRQARDAFETVYRLAERFAREQGYTGSAPHAQAAPQAQPERVEPVFGQPIQT
FT                   EETHVQQQTASRPPVTQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWA
FT                   DMPLHKWLESVVKDDGSLSHIRELLGVRPDEQA"
FT   gene            528742..531303
FT                   /locus_tag="Bcen2424_0475"
FT   CDS_pept        528742..531303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0475"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG:
FT                   bur:Bcep18194_A3567 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07229"
FT                   /protein_id="ABK07229.1"
FT                   /translation="MNVTELAQAIRGGLIQQDRLLKTDIPSLPNNALVPRRAVTRSELG
FT                   RDFSVTLDLVSTASDVELKTLVAQPITLWIQQADRSYQPINGYIHTARRLGADGGLSSY
FT                   QLRFASWMHFLKFRSDMRYWQDQPVDAILADVFDRHPQARGQYRFALSKPLPSRSYCRQ
FT                   SETDWNFVHRLMEDEGLFGFWRHSEDGKAHTFVITDDLHTVDALSPNTVRFDRSGSGAE
FT                   TAGFTQWTASRTLQSTLHTTRTFDYKSPSSAGNPNGTSLPTKSGQGELPDQAEIYEYTG
FT                   AYTYPAQDRGEHLSKIRLEEWESRAKRFFGVGGVRSIDAGRRFTLVDHPEHDRDAASDR
FT                   EFAAIGVTRYIENNLPASDHEASFPHSLQDALAQVKAGHGKGGAFEVGHDDGSAGFYLV
FT                   EVEAQRASMPYRSPFEHRKPAMQLETAVVVGPKGEEVYTDALNRIKVMFVWDRQSEGRE
FT                   TASCWMRVVQSDTGGGYGAVHIPRVGEEVLIGYIGGDCDRPIVMHRVYNGAAKPQWHSD
FT                   GLLSGFRSKEYAGSGHNEMVLDDATGQNRARLFSSSGNSLLHLGYLIEQNGNTRGAYLG
FT                   SGFDLRTDAYGALRAGQGLYVTTHPKQANSQPLDVTEAKQQLGSAEGLIESMSQVSEMH
FT                   QAESLGTGRDALKQFADATQNSVAGVASGGGRTAGGGTGNANAFKEPVMLFASPAGIGM
FT                   ASQQSVHLASEQHTNIVSGQSTFVTSGKSLIAGIRDRISLFAQNAGMKLFAGKGKVEVQ
FT                   AHADNVELTAQKAVKMVAATEAVDVAAKQEILLTSGGAYIRIKGGKIELHAPGKVDFKG
FT                   AQHQFSGPTSMQYPLPAMPGGTCKQCVLNAHSGRESMVEAD"
FT   gene            531303..532343
FT                   /locus_tag="Bcen2424_0476"
FT   CDS_pept        531303..532343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07230"
FT                   /protein_id="ABK07230.1"
FT                   /translation="MDEVNDTVARNDPVGVSEAVDAEPNPREPEWPAFLETLKASVTRT
FT                   DDAGSAMRIYALVDTRGYQELDVQLAAVPRLRCASLWADTGLDAYTDIAPYLIAFDHDA
FT                   INDENAEQHRLLRQLWLEAVDLHAVTWLWSTWSFDALDQHLCQYVQYKLPNGRAYYLFF
FT                   FDNHVLGRLRQVWSDTQAQQFVAPFGEIRYRDRRLDEVVWRNDMPASEGAVPVGDAPGL
FT                   SERQHAQLIELGYPDKLVLKFRETMGAMADHLSDVELHDRVVEQLDRAAAHGIAEEAEL
FT                   QCYVMTGVLVAPRFDEHPAVKSCLEAASRGETSVDAALASIDDATWDAIRDAHERGLLE
FT                   ARSDVA"
FT   gene            532330..533166
FT                   /locus_tag="Bcen2424_0477"
FT   CDS_pept        532330..533166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07231"
FT                   /protein_id="ABK07231.1"
FT                   /translation="MTWRRSGLVVGLLAVALSLSACGKSEPVYSGISVMGRNYLPYNMN
FT                   GFTIADANGNKANGGGDDPPGAGGGSVACCYTLKGTEFTVKWKYYDADRWTMDDSHAQQ
FT                   VETKVVMPRSVVPGKVGSRILEVHFYPDRHVEFQFPGELLDESRIPVADVSRWMATHYQ
FT                   EQLDKKFGDTDGQSHRRIARVVASAWLKYRLTDRDDLEQYVYYALLVNGRFDAHSEVQR
FT                   ILQTAAGKPGMFAKSMQSLPKRVLSSLSNDAFEAATVPAISDGLLPPPRVEEALHG"
FT   sig_peptide     532330..532401
FT                   /locus_tag="Bcen2424_0477"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.871 at
FT                   residue 24"
FT   gene            533386..534321
FT                   /locus_tag="Bcen2424_0478"
FT   CDS_pept        533386..534321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07232"
FT                   /protein_id="ABK07232.1"
FT                   /translation="MKRVLMPDFMQYAAPKFHAIVPDRHGARAARGRFLAALRVAAAGL
FT                   LFVSMAACSKSDPTYTSISTEALNYLPYNLVRFTITDQFGNKARGGGDLEPGAGEGSIA
FT                   CCYLLKGNDFKVQWTYYDADDWRPGEQVKKQQAEANVSLPPTKEPDSIGSRILEVHFYP
FT                   DHHVELVFPGEMLGSTRLPIVDVSRDLTKQYGKRLDKKYEDNDAQSHRRISRTVAEAWI
FT                   KYRFTDRSDLEQYAYYALLVNPRFDAHPAVQKLIQSSKGKPGAFAKAVAALSPTVVKEL
FT                   GQNRFQAVAVPSIPAGLVPPPREENSHGRG"
FT   gene            534308..536569
FT                   /locus_tag="Bcen2424_0479"
FT   CDS_pept        534308..536569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07233"
FT                   /protein_id="ABK07233.1"
FT                   /translation="MAGANDRNAIRLDPDDATPQSVRMAVDKMATANYPKGDCLPCGAT
FT                   IRIGVFFDAFGRSRDEDDPDSGLYSNISRLFDAHRTNLDVDRPVNQFWFRLYYSGLGTD
FT                   LNADAKSNDWLNAGLAAGKMVGKKVLAATKGVAESVARVNQPIKQLDVKGRVTTATKQS
FT                   ASEFSFRPMLNAFNDFKKDIQNIPRTARRIANVLDASPERIWERTKAGGIAVFRNAKND
FT                   AKRNPLKIVQSTVRQVITGIAIENVPIVRDAQVMSAYFGTGVDSRLVAAKDQLEKAVEA
FT                   VKGQASKIRKIEVSVFGADRGCVLARAFVNDLATKYKRRDDQDLALNGISLEIKFVGLL
FT                   DAVSSIMSEEAGEIIGILPFLGTIKPNYKDRSLAVPASVQRCVHFAAAHEMRMYQRLDS
FT                   LEKTRAEQRLYPGTSSDIAGGSLHGSLGFNAELMRIPLRDMLFEALKAGSALLDMETLA
FT                   KRRPDVFSRFSIATPITYDGKQYRIKALVDAYRKVVPDTQGVNFLPHAEVFLRWIAVRY
FT                   QDPEFRHSVTDPATEWRKDVERADYDRRDAKAKLDWAMMGRQRMDSPEIQKLKLAKQAA
FT                   DKRYNDLWKDVPPSNYTTVWQRLDKEAKEMTGKWEKMRPEYEAEQQRRFTQSFNNKPTY
FT                   TPLFLAPAFARHVELNEDEVALVRAWEQGYAGKNPLPSEVMAMFDMLVHDTLLTSWQDH
FT                   VLAPSLYFRTRDKDVFGKTDYAKEDKQRKSDDLTAERVDQASKQSQQWARGYQGTPPTH
FT                   "
FT   gene            complement(536652..536909)
FT                   /locus_tag="Bcen2424_0480"
FT   CDS_pept        complement(536652..536909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0480"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bcn:Bcen_2625
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07234"
FT                   /protein_id="ABK07234.1"
FT                   /translation="MAAALAKMQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLIT
FT                   KSIPPQQMTTTGVGPDQPIAPNDTADGRARNRRIEFRVGQ"
FT   gene            537086..537955
FT                   /locus_tag="Bcen2424_0481"
FT   CDS_pept        537086..537955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07235"
FT                   /protein_id="ABK07235.1"
FT                   /translation="MYVKVALWKANAIKFVREKNGTFAGAGGSYAKVAGAFLESQGFVN
FT                   VTSQLPDARWALPGDVIVYHVMGDAETADGKGQPGHIDIRTYHYYVSDFKRNYLCVSGA
FT                   GPGKTRHFYEPIGIYRKQGFSDPLPLARMKAFLKIIRSREAKTFLELAGDAKTYYASQG
FT                   VYTLSGALKDLSTYPDGAHHQGAYQMTKAAWLAGQRPEQGALPADFQPATQDRYAVFLM
FT                   EGHPGRFDKSGQPQPTALGYVRTGEIEKAVALLRNEWACMPGTSQDQGYTMAQLKADFD
FT                   KYVKEFSN"
FT   gene            537988..538608
FT                   /locus_tag="Bcen2424_0482"
FT   CDS_pept        537988..538608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07236"
FT                   /protein_id="ABK07236.1"
FT                   /translation="MLAWCAASEAQVARVAAADAVQIEATVKQYYSLSHADASCRFSRT
FT                   DDNGMPLDPRVHHRAYRDAQYTRTFKTVFSHALFALMKRTCVDSDKVTGMLDVRLSDSE
FT                   IDSDPSNYGNDVRMKVTRPVRILAADPSRVRVRVDWSEMVKGARKPYSVGRSDVILVKE
FT                   GDAWLIDDVYSLGVADGPPSQLDMSIQDFEQSPGVVRLRGNAP"
FT   gene            complement(538876..539826)
FT                   /locus_tag="Bcen2424_0483"
FT   CDS_pept        complement(538876..539826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0483"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   bur:Bcep18194_A3573 outer membrane protein, OmpA/MotB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07237"
FT                   /protein_id="ABK07237.1"
FT                   /translation="MHRTIQVRRARLSAAVSPALAALFAAGLVASGAAFAQNTGATVTP
FT                   VGNGTVATTALPQANPNAGGASGTVVHGTAGTIAPPPANATPGQVVVGGKVPDEATKAA
FT                   VLQKLRDTYGATNVVDQVEVGDVATPPNWSANVQKLLGAQLKQISKGQLKINGTQIEMK
FT                   GEVHNEAQRQQLASDMANTLNPTYTIKNGLRVSASEQGVLDQTLANRTIEFETGSATLT
FT                   PQGKLILDQMAAALAKMQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSIPP
FT                   QQMTTTGVGPDQPIAPNDMADGRARNRRIEFRVGQ"
FT   sig_peptide     complement(539716..539826)
FT                   /locus_tag="Bcen2424_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 37"
FT   gene            complement(539831..540820)
FT                   /locus_tag="Bcen2424_0484"
FT   CDS_pept        complement(539831..540820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07238"
FT                   /protein_id="ABK07238.1"
FT                   /translation="MTQTVQAQIAYFGKIPSRGDFVKSAHNPQLLQTLDRWIAQALELL
FT                   AEDPRWKIVYEDAKPMHFAFLGSRSKLAIAGHMVASHDVSMRRFPFLGATALEVDRPLA
FT                   FLARSPLAFARLWSRVAAQIPPLLGKDEPPGALQALGDTQVPIDIGGPGTSHDGTFNDF
FT                   VEHQTLYGLQEMLLESGHPVRLRGAMLALGSLLRPVMQSGSSHIERGLTLPLPVDPFYR
FT                   SLVAAFWLELIAPFVAQADFELAIFIGTIAERERLVIGFNGASAKTLLSVVDPQTYAAH
FT                   NIDIDDPEWIDAHAQNDHQISKLVSYLEQPQLSLRVAIDAFREAFIGG"
FT   gene            complement(540817..544761)
FT                   /locus_tag="Bcen2424_0485"
FT   CDS_pept        complement(540817..544761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0485"
FT                   /product="ImcF domain protein"
FT                   /note="PFAM: ImcF domain protein; protein of unknown
FT                   function DUF1215; KEGG: bcn:Bcen_2620 ImcF-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07239"
FT                   /protein_id="ABK07239.1"
FT                   /translation="MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAALAFA
FT                   AVLALWLVVALWRRWRVKRANQQLGQVLEEQAETGKIAAPAAAALAPDAKTADLDVLRT
FT                   RLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKSSAVLNSGLQFPFADKNSAV
FT                   IHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRYRPKAPINGIIVT
FT                   ASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSSD
FT                   KHEYDRVWGATLPYEPDDKRDVVAQFDTHFEELYEGLKEISVAQLSLSRGNQLSPGQLS
FT                   FPLEFSTIKPSLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGL
FT                   DGSALPKPHSAFSKNGFFLRDLFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALAL
FT                   ALGGWTWSTIGNQQLVANVQADLDNVTRLQQGRNDLQSRLQAMDIIEDRIEQLEQFRRD
FT                   KPLSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFMKDVNAHPEQLVPMTRP
FT                   PESGAVQGGTLPVSTNAAGAAPQAGAMLAASGTAPAAAPQQAAAPQGGLYSDASPTNVQ
FT                   DAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIRSAERMISFYL
FT                   SRVNDDDWPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIV
FT                   GDGNQGLVAGSYAIPGTFTREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGS
FT                   PEQIQKTLVGMYKTEYAQHWQKFMQGIAVQGFTSFGQAVDGMNRLGDPQDSPIRKILET
FT                   AYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFTRSQAGQMAAANIDINGNPAEVPMGPI
FT                   GQEFVGLARIVATHDGTSMLKGYMESLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGNG
FT                   SELADSLKLVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASAEVNKVWNAQVYQ
FT                   PFQSSLATKYPFAANAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLAARTW
FT                   GDMGIGLTPDFTNGFARWVAPLAGGAAGSAAASAEPQTVFQILPQPSTGTTEYTIAIDG
FT                   QQLRYRNTPPQWTNFVWPNPQGAPGATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRK
FT                   RRPDGTFDLTWAQGSVNVSVTMRIISTSQPSAGGGDQPQQQSLRGLQLPSSVADASAGA
FT                   AQNATQAGTGTPGAAPAVAAANATNAQRAQ"
FT   sig_peptide     complement(544669..544761)
FT                   /locus_tag="Bcen2424_0485"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.383 at
FT                   residue 31"
FT   gene            complement(545063..545908)
FT                   /locus_tag="Bcen2424_0486"
FT   CDS_pept        complement(545063..545908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0486"
FT                   /product="peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysins; KEGG: bcn:Bcen_2619 peptidase M15B and
FT                   M15C, D,D-carboxypeptidase VanY/endolysins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07240"
FT                   /protein_id="ABK07240.1"
FT                   /translation="MIAVALVAYFTLAVAVAALLLLPGIRATVFESVAQFHGRLTRRAN
FT                   ERAARTRSQIVKSATVTRGALSDVQNLLVRRRLMIMVSAGILATPPLVAIALRGRQLFQ
FT                   YDDTARVPDEKIAALLQGEQLVPPPPLPPEVFATKEVEQIRPALKDASRDWNLLDPDFR
FT                   TRLLLVYKIMHEQHGYEMALLEGYRSPERQNRLAQMGTNVTNAAAFQSYHQFGLAADNA
FT                   FLRDGKLVISEKDPWAMRGYQLYGQVAEQVGLTWGGRWKMMDLGHVEYHKPGFKLGRGS
FT                   "
FT   sig_peptide     complement(545855..545908)
FT                   /locus_tag="Bcen2424_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.265 at
FT                   residue 18"
FT   gene            546030..547034
FT                   /locus_tag="Bcen2424_0487"
FT   CDS_pept        546030..547034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07241"
FT                   /protein_id="ABK07241.1"
FT                   /translation="MSAPENSNSKTPPSLLSDTKPAGEGGPRQSRILADLEGRVTPPAE
FT                   PPRRSLKAPIAAVVALVVAVGGWGAWRMQQSSGEPHVAVAAATAPAAAAPDKAAPASGA
FT                   AVQVAQNGAFAASAAQPATIVNDDSASQTVASASASAASAADNSRLSRALANGADDGSG
FT                   TAAAAGVAATAAAAAATTKTAKADASKSTKVAAHGKTDTKTEAKADTKADTKAEARKHR
FT                   KEQQAELAQAKKRREATPTRTAKAAGKDDPDADLLAALVARTKPADKKLAAEKAQAVPT
FT                   KASATTGGSLASRVKACSERGFFEDQLCRWRVCDGHWGKDPACPSAAQSETRQ"
FT   gene            547247..548275
FT                   /locus_tag="Bcen2424_0488"
FT   CDS_pept        547247..548275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0488"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: bcn:Bcen_2617 Mg2+ transporter protein, CorA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07242"
FT                   /protein_id="ABK07242.1"
FT                   /translation="MDLIVQTYGADTSGMVCGFRFDPGGAGAMLDADAAAAWLRTCREH
FT                   GAAASGDFVWLHFNLAHGASERWMRTHLGLPDSFFEFLHEGSRSTRIEQEDGALRAIVN
FT                   DVMFNLELTPSEIATLFVHVERRIMVTARLKPLRSVDTLRACVRDGEQFRSPAELLVHL
FT                   LRDQADLLIQIMRRTSVDVDRIEDRFLSQRLTSSRIELGAMRRTLTRLQRMLAPEPGSI
FT                   FRLLAKPPAWLHTEDVQELRESTEEFSLVLADLAGLNERIKLLQEEIGSRLDEQNNRTL
FT                   FTLTLVTVIALPINIVAGFFGMNVGGVPFSENKHGFWLMVLLVAGFTALAAWWAFRRRD
FT                   DR"
FT   gene            complement(548319..548471)
FT                   /locus_tag="Bcen2424_0489"
FT   CDS_pept        complement(548319..548471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07243"
FT                   /protein_id="ABK07243.1"
FT                   /translation="MMDYVTSLAVGVGVGVLYALLHVRSPAPPLVALVGLLGMVIGERA
FT                   IALLR"
FT   gene            complement(548496..549473)
FT                   /locus_tag="Bcen2424_0490"
FT   CDS_pept        complement(548496..549473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0490"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcn:Bcen_2615 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07244"
FT                   /protein_id="ABK07244.1"
FT                   /translation="MRSIRFDTPAADIESLDARVRDIAPPVPADGQMLIEVRAAGVNPS
FT                   DVKAALGRMPHAVWPRTPGRDWAGIVRSGPDNWIGAPVWGSGGDLGVGRDGSHAEWLVL
FT                   DAAHVRRKPGVLTLEEAAGVGVPFVTAYEGLRRAGMPTADDVVLVFGANGKVGQAAIQL
FT                   ATARGATVIGVERGPGDYRGHASGDVSMIDASSRTVADAVRELTGGHGADIVYNTVGSP
FT                   YFEAANASMAIGARQIFISTIERSVPFDIFAFYRGQHTFVGIDSLQLGPAAVAQILDTL
FT                   APGFGNGTLRPFPIGDDYVYPLEHAHDAYRAVLAGARERVILKP"
FT   gene            549637..550557
FT                   /locus_tag="Bcen2424_0491"
FT   CDS_pept        549637..550557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0491"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_2614 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07245"
FT                   /protein_id="ABK07245.1"
FT                   /translation="MDDFLSPHLALFVDVVDQQSFSAAARRLGVAASSVTRRIDRLETQ
FT                   LGIRLLHRTTHALRPTEAGQLLYGRATRMLAELRGLQEDLHSQHDEPGGLLRVDCPAPF
FT                   GRRHLMAALAAFMQRYPALQVDLVLTDSMVDLQGARLGSDVDLAVRIGPLEDTRFVATV
FT                   LAPQRRVLCASAAYLARCGEPASPDALGGHDCLAWHGAPPPGAWRFGERRHVPAQPRFR
FT                   SNHSEALLEAAIDGLGLAHLPTWLVADALRDGRLRALLPQYAAAPEPATIHVLRQHARG
FT                   SARTSRLVAFLATWFAQPAWDAAWA"
FT   gene            complement(550679..552847)
FT                   /locus_tag="Bcen2424_0492"
FT   CDS_pept        complement(550679..552847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0492"
FT                   /product="peptidase M1, membrane alanine aminopeptidase"
FT                   /note="PFAM: peptidase M1, membrane alanine aminopeptidase;
FT                   KEGG: bcn:Bcen_2613 peptidase M1, membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07246"
FT                   /protein_id="ABK07246.1"
FT                   /translation="MSIHIRKMRYLPLVAALALAGCGGDDGGAGSASALSSAGAPHTSS
FT                   SPAVTAPPSASNVDKSVSPVELPDTVVPVNYRLWFRPNDALNAFDGRADVEIKVLKPVN
FT                   NIVIAGHRIKFTNGRITLQPGNIQLIATPQDKGDFYQLRPVAGTIAPGNYSLHMEWSGI
FT                   INFKSYDDPATQTGGSCGDDPYPGCSAAEGVFRVDLKGTDGKTSGAILTQGETNLSRQW
FT                   FPGWDEPAFRPTYEVTAEVPQSWRVVSNAAEKPSTNVGGGYKLVQFEKTPPMPSYLLFF
FT                   GGGLFDTYEDDFTSPLPGGKGGLHLRVFTPPGMSEWAKPAMDRTKQALDYYYRYTGIPL
FT                   PLTKFDTVAANDAFKDQKDLNFGGMENWGSILEFADDILPQPGQPMSHYGNEVLTHEVA
FT                   HQWFGDLVTTDWWDNVWLNESFATFFETKTTIQFFPNEFSWLDQVKNKYRVINRDIGPN
FT                   AFPVAPNFNDWASNDFVLSASAFTYDKGGHVLKTLENYLGEQTLRKGLQQYLVDYSFGN
FT                   GTPKRLWDALSKESGQAVGPIGDSYVRQTGVPLISLDTQCDLTKNQTVVTLKQQPFPNK
FT                   NAYPGLQWTVPITLAYGQGLAKRTTLALKDTQAQTRIEGCTGVVADPSGLDYYVVNYSD
FT                   TAWSGLLTQVNSSTDPVLLANLKSEAALLVANNLAPASRSTSIGSVASPAAMKLRQTPT
FT                   FGGIEAVTKERPARQYQGLFKPRKVVTQ"
FT   sig_peptide     complement(552743..552847)
FT                   /locus_tag="Bcen2424_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.450 at
FT                   residue 35"
FT   gene            complement(552952..553209)
FT                   /locus_tag="Bcen2424_0493"
FT   CDS_pept        complement(552952..553209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07247"
FT                   /protein_id="ABK07247.1"
FT                   /translation="MTANLRDGDTLSFRPADWPGQPRRSSVQRDCAPASGVRPRVVRAK
FT                   SIQYNTRPAILNRPVNRHPENPEGAVNHDYLYVVGRRLFE"
FT   gene            553491..553985
FT                   /locus_tag="Bcen2424_0494"
FT   CDS_pept        553491..553985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07248"
FT                   /protein_id="ABK07248.1"
FT                   /translation="MPRALFHIAPLRTVLLLFAAVFLLGGCAGFTREPVRVSVAGLDPL
FT                   VGQGLEMRFSLKLRVQNPNDAPIDYDGISVALDLNGTPFASGVSDRAGTVPRFGEAVLD
FT                   VPVSVSAFAAARQAWNLPGAAANGELPYALRGRLAGSMLGTVHFNDAGTLRLPTMPGWG
FT                   G"
FT   sig_peptide     553491..553586
FT                   /locus_tag="Bcen2424_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.541 at
FT                   residue 32"
FT   gene            554141..554473
FT                   /locus_tag="Bcen2424_0495"
FT   CDS_pept        554141..554473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0495"
FT                   /product="protein of unknown function DUF1508"
FT                   /note="PFAM: protein of unknown function DUF1508; KEGG:
FT                   bcn:Bcen_2610 protein of unknown function DUF1508"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07249"
FT                   /protein_id="ABK07249.1"
FT                   /translation="MAAKFELKKAVNGQYYFHLKSANGEIILASERYEEKSGARNGIAS
FT                   VRENAPLDERYERKLAHNGEPMFNLKAANHQIIGTSETYKTVQGRENGIAAVKRDAPIA
FT                   ETVDLG"
FT   gene            554549..555742
FT                   /locus_tag="Bcen2424_0496"
FT   CDS_pept        554549..555742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0496"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: bcn:Bcen_2609
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07250"
FT                   /protein_id="ABK07250.1"
FT                   /translation="MVWSARRILAAAEANRNRVRVTDSPVFHWTDADGVDHAVRWRSEA
FT                   GVQPPKRAVPADDRLTADAAYRLACEGTALVWQGDFQNARQLVQAMARRVERKPKKAKA
FT                   AAGVEAFNLHRLAQSQRARTLGMLLIPLDADYTIPLRRAPDVRAACEEAYGPGGAPSVV
FT                   SLRELLGLVGAHEWRKKGVPIPALGGAPIHPHYGVFSPVRGEYVELVARAPLPATSLAF
FT                   DIGTGTGVLAAVLASRGVERIVATDHDSRALACARENVARLGHAGQVEIVEADLFPAGR
FT                   APLVVCNPPWVPARPSAPIEYAVYDPDSRMLRGFLAGLAAHLEPGGEGWLILSDFAEHL
FT                   GLRPRETLLQWIDEAGLVVLGRDDIRPAHPKSTDADDPLHAARRAEVTSLWRLGARA"
FT   gene            555832..556722
FT                   /locus_tag="Bcen2424_0497"
FT   CDS_pept        555832..556722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07251"
FT                   /protein_id="ABK07251.1"
FT                   /translation="MSNKTHEIRPEQSVELLKELHILTRDGKLNQDSRRKLKQVYHLFQ
FT                   FIEPLLAGVQADKGHVTLVDHGAGKSYLGFILYDLFFKQQPGHGTPAFASHVYGIETRE
FT                   ELVTRSTELAARLGFGGMSFLNLSVADSITSPQLPDTVDVVTALHACDTATDDAIRFAL
FT                   AKRAQHIVLVPCCQAEVAGVLRKNKGKSLANALTEVWRHPLHTREFGSQITNVLRCLQL
FT                   EAHGYQVSVTELVGWEHSMKNELIIAQYKNLPRRKPGERLNEILGMFGLAELNERFFVA
FT                   QAAAAGDAAVEPAEG"
FT   gene            complement(556762..557334)
FT                   /locus_tag="Bcen2424_0498"
FT   CDS_pept        complement(556762..557334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0498"
FT                   /product="protein of unknown function DUF1415"
FT                   /note="PFAM: protein of unknown function DUF1415; KEGG:
FT                   bcn:Bcen_2607 protein of unknown function DUF1415"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07252"
FT                   /protein_id="ABK07252.1"
FT                   /translation="MTDTRPDSHDDILAATRHWLARAVIGLNLCPFAKSVYVKEQVRYA
FT                   ISEATTLEDALAELETELRLLDAADPQQIDTTLVIYPHAFADFVDYNDALFFAERLVQQ
FT                   LRLDGVLQIASFHPQYQFDGTEPDDIENYTNRAPYPILHLLREDSIARAVDAFPDASAI
FT                   YEKNQETLRRLGHEGWREWMRRPGDDV"
FT   gene            complement(557412..558032)
FT                   /locus_tag="Bcen2424_0499"
FT   CDS_pept        complement(557412..558032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0499"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_2606
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07253"
FT                   /protein_id="ABK07253.1"
FT                   /translation="MSGIEVAKPPARRTRRPIDGATAQEHLLRAAEELFYKEGVRTVGV
FT                   EAVVERAGVNKMSLYRQFSSKDELILAYLERMDACFFERLDTSAAKHPGQPKAQLIQYF
FT                   VDLAERATQKDYRGCPFVNVAAEFPDASHPARERVAQNKEQLMKRLVALCEGAGARQPK
FT                   ALADALALVVEGIYAASQTYRHGETPIGSAPALVTQLIEAACA"
FT   gene            558252..559535
FT                   /locus_tag="Bcen2424_0500"
FT   CDS_pept        558252..559535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0500"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_2605 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07254"
FT                   /protein_id="ABK07254.1"
FT                   /translation="MNWAVTRIRGRFHYGWLAAAVVFLILLAAAGTRATPSVLMVPLER
FT                   ELGWSRAAISLAISVNIALYGLTGPFAAAAMQRFGLRPTILTALVTMSAGVALSSMMTQ
FT                   SWQMVVIWGLMVGCSTGVVALTLSATFVTRWFHARRGLVMGILTASTATGQLVFLPMLA
FT                   AIAQRHGWRPVVLVVAVAAAIVIPLVAFLLPERPADVRLRPYGEPADAPPAPDATKENP
FT                   LAVAFRTLLMASRSRDFWLLFFSFFICGASTNGYVGTHLIAMCSDYGMTEVQGASLLAA
FT                   MGIFDLFGTTLSGWLSDRYDNRVLLFWYYGLRGLSLIYLPHAFGIDFFGLPLFAMFYGL
FT                   DWIATVPPTVRLATDVFGKAAAPVVFGWIVAGHQLGAAFAALGAGLLRASLGTYTIASM
FT                   ISGGLCIIGALIVLRINRGPSRAAAQAA"
FT   sig_peptide     558252..558356
FT                   /locus_tag="Bcen2424_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.770 at
FT                   residue 35"
FT   gene            559693..560298
FT                   /locus_tag="Bcen2424_0501"
FT   CDS_pept        559693..560298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0501"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bcn:Bcen_2604
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07255"
FT                   /protein_id="ABK07255.1"
FT                   /translation="MSVKPAPTTVSIHDLIAGRWSPRAYSDEAVSAGDLHAVLEAARWA
FT                   PSAYNAQPWRFIVFDRTQDEDAFKRAFATLVPFNQGWNAPAPVLIAVTAHTLTPKGEPA
FT                   PTALYDAGAAAMSLVLQAHALGLAAHQMSGFDAKAFRDAFAIPADVAIASIISLGHYGN
FT                   VDKLDPVLRDREKAPRTRHAIGEVVYAGAWKKSFDAAA"
FT   gene            560523..561773
FT                   /locus_tag="Bcen2424_0502"
FT   CDS_pept        560523..561773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0502"
FT                   /product="molecular chaperone-like protein"
FT                   /note="KEGG: bcn:Bcen_2603 molecular chaperone-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07256"
FT                   /protein_id="ABK07256.1"
FT                   /translation="MTYCAIDFGTSNSAVALPDGDCMRLAPVEGDHLTLPTAIFFNNDE
FT                   ETVEYGRAALASYIDGFDGRLMRSMKSILGSPLAETTTDLGDGSAIAYTEIIARFLTHL
FT                   KRKAEARARAPIGRAVLGRPVFFVDDDPRADRLAQDQLEAAARSVGFADVHFQYEPIAA
FT                   AFDYESRQPAERLVLVADIGGGTSDFSLVRVGPERMARLERKDDVLAHHGVHVAGTDYD
FT                   RRVELAAILPAFGYRSLDPEGRELPNKIYFDLATWHLINTVYTPKRVGELKLMKHLYQD
FT                   VRQYDRLTSVVEQRLGHALMARAEEAKIGVAAGGETMIDLNDVEEDLLIAFDADRLVDA
FT                   SRDDTARIVDAARETVRLAGVAPRDVGALYFTGGSTGLAFLSGALAGAFPDAQPVFGDR
FT                   LASVATGLGIHAQRLFG"
FT   gene            complement(561877..562080)
FT                   /locus_tag="Bcen2424_0503"
FT   CDS_pept        complement(561877..562080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0503"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bcn:Bcen_2602 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07257"
FT                   /protein_id="ABK07257.1"
FT                   /translation="MATGTVKWFNDAKGFGFITPEGGGDDLFAHFSEIRVEGFKTLQEN
FT                   QKVEFEVKTGPKGLQAANIRPV"
FT   gene            562500..564098
FT                   /locus_tag="Bcen2424_0504"
FT   CDS_pept        562500..564098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0504"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bcn:Bcen_2601 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07258"
FT                   /protein_id="ABK07258.1"
FT                   /translation="MKSSIQRNIGPFALMLTGLGSIIGSGWLFGAWKAAKIAGPAAICA
FT                   WIIGAVVILAIALTYAELGAMFPESGGMVRYARYSHGSLVGFISAWANWIAIVSVIPIE
FT                   AEASIQYMSTWPYPWAHALFVNGELQTLGLLLSAVLVVVYFMLNYWGVKAFARANTAIT
FT                   IFKFLIPGLTILGLMLTSFHSENLGVASNASFAPYGWSAVLTAVATSGIVFAFNGFQSP
FT                   VNLAGEARNPSRSVPFAVITSILLALVIYVLLQMAYIGSVNPADVAKGWAHFNFSSPFA
FT                   ELAIALNLNWLAILLYVDAFISPSGTGTTYMATTTRMIYAMERNNTMPKMFGNVHPIYG
FT                   VPRQAMWFNLLVSFVFLFFFRGWSSLAAVISVATVISYLTGPISLMALRRSATDIERPL
FT                   SIPLMKLIAPFAFVCASLILYWAKWPLTGEIILLMIVALPVYFYFQAKSGWTGWGADLK
FT                   AAWWLVAYLPTMAVLSLIGSKEFGGHGYLPYGWDMLIVAAISLVFYFWGVNTGYRTQYL
FT                   DERESHDEILEGIGA"
FT   sig_peptide     562500..562592
FT                   /locus_tag="Bcen2424_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.526 at
FT                   residue 31"
FT   gene            564249..565274
FT                   /locus_tag="Bcen2424_0505"
FT   CDS_pept        564249..565274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0505"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bcn:Bcen_5872
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07259"
FT                   /protein_id="ABK07259.1"
FT                   /translation="MDTVSLIGVDLGKHCFHLHGQDASGRMVFRKKLTRSQMFTLLGNF
FT                   PSCTVVMEACAGAHWIARRLQALGHEAKLISPQFVKPFRQGNKNDFADAQAICEAASRP
FT                   SMRFVSPHNEAQQIVSALHRVRGGLVRERTGTINQIHAFLLEFGISLPRGMAVIRRLPA
FT                   VLEAESLPPRLVSVIERLHAHCKYLDEQIHQLERELLTQLHEDERSERLLEIPGIGPMT
FT                   ASVLMSELGDARQYGSARQFAASVGLVPRQYSTGGKPTLLGISKRGDKELRRLLVQCAR
FT                   TIMQRIEHRTDALGVWIRGLLARRHSNVVACALANKLARIAWAILAKGTHYRSTEAVPA
FT                   V"
FT   gene            complement(565570..566361)
FT                   /locus_tag="Bcen2424_0506"
FT   CDS_pept        complement(565570..566361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0506"
FT                   /product="Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B; KEGG: bcn:Bcen_2599 extradiol
FT                   ring-cleavage dioxygenase, class III enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07260"
FT                   /protein_id="ABK07260.1"
FT                   /translation="MNRLPSLYLSHGAPTLPIDPALPSGAFTHLGAELPRPRAVLMLSA
FT                   HWGTQRPVASVAAHPDTIHDFYGFPQALYDIRYPAPGAPDVAERAAALLNAAGIATATT
FT                   EHGLDHGAWVPMLLMFPEADVPVAQLSIQPRADAAHHFALGRALRPLRDEGVMVIGSGQ
FT                   ITHNLRAADFGAAPEDADPRVAEFTDWFEAKLAARDVDALLDYRRQAPHAALMHPTDEH
FT                   LLPVFTALGAADDDYQLGIQSLGTYQRVLAMTNYVFASAGA"
FT   gene            complement(566564..567160)
FT                   /locus_tag="Bcen2424_0507"
FT   CDS_pept        complement(566564..567160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0507"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: bcn:Bcen_2598
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07261"
FT                   /protein_id="ABK07261.1"
FT                   /translation="MASPSAPPRRLIVAITGATGVIYGVRLLDLLRAAGGVETHLLISN
FT                   AGWLNIQHELKLPKADVESRADVVHSVRDVGATIASGSFATDGMVIAPCSMKTLASVAH
FT                   GLSDNLITRAADVTLKERRRLVLMVRETPFNLAHLRNMTAVTEMGGIVFPPLPAFYAMP
FT                   KTIEELVDQTVTRVLDLFALSAPLTTPWPGIRHAQ"
FT   gene            complement(567184..567495)
FT                   /locus_tag="Bcen2424_0508"
FT   CDS_pept        complement(567184..567495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0508"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: bcn:Bcen_2597 glutaredoxin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07262"
FT                   /protein_id="ABK07262.1"
FT                   /translation="MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVD
FT                   QFKTVNVLEDDEIRQGIKAFSNWPTIPQLYVKGEFIGGSDIMMEMYQSGELQQLFAAA"
FT   gene            complement(567563..568405)
FT                   /locus_tag="Bcen2424_0509"
FT   CDS_pept        complement(567563..568405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0509"
FT                   /product="[protein release factor]-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: bcn:Bcen_2596 modification
FT                   methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07263"
FT                   /protein_id="ABK07263.1"
FT                   /translation="MSDTTADALLRASPLDPVDARVLLAHALGWTRTQLITRGDAPLDA
FT                   AAVERYRALEARRVAGEPVAQLVGMREFFGRPFDVTPDVLIPRPETELLVEAALDAIDG
FT                   LPHAAVLDLGTGSGAIAVSIAAERPDARVWALDRSPAALAVAQRNADKLLDAHRPGGPL
FT                   HWLQSDWYAALDPALGFDAIVSNPPYIAQHDPHLAQGDLRFEPRGALTDDADGLSAIRA
FT                   IVAGAGAYLKPGGTLWIEHGYDQAEAVRAILASHGFVAVESLADLAAIERTTGGRLPG"
FT   gene            complement(568413..569495)
FT                   /locus_tag="Bcen2424_0510"
FT   CDS_pept        complement(568413..569495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0510"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   bcn:Bcen_2595 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07264"
FT                   /db_xref="GOA:A0K437"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K437"
FT                   /protein_id="ABK07264.1"
FT                   /translation="MKTSMQRKLDQLSTRLAELNDLLSRENVTADLDQYRKLTREHAEL
FT                   GPVVEQYALWRQSRSDETAAQELLADPSMRDFAEDEIRSAREGMARLETELQKMLLPKD
FT                   PNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESASDLGGYKEVI
FT                   VRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADL
FT                   RIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDK
FT                   QYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAIMDGDLDEL
FT                   IGALVTEHQAELLASLGEAD"
FT   gene            complement(569589..570887)
FT                   /locus_tag="Bcen2424_0511"
FT   CDS_pept        complement(569589..570887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0511"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase; KEGG: bur:Bcep18194_A3598 glutamyl-tRNA
FT                   reductase, HemA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07265"
FT                   /db_xref="GOA:A0K438"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K438"
FT                   /protein_id="ABK07265.1"
FT                   /translation="MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAP
FT                   NTPEAAILSTCNRTELYCATDDRAAREGAVRWLSEYHRIPVDELAPHVYALPQSEAVRH
FT                   AFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEI
FT                   GTQSVSMAAAAVRLAQRIFEKVSDQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAE
FT                   RGQRLAERFNGRAMPLADLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFM
FT                   VDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQW
FT                   LDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTS
FT                   ALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH"
FT   gene            complement(570914..571678)
FT                   /locus_tag="Bcen2424_0512"
FT   CDS_pept        complement(570914..571678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0512"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcn:Bcen_2592 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07266"
FT                   /protein_id="ABK07266.1"
FT                   /translation="MRIALIDPESRHTALLNRLLFAGGHVCHAFPSGAAFFEWLAADNT
FT                   CDMLVTGHWAGDQPAQEVIPRAQAVLPGLPAIAVMQSARESEIVSCLHAGADDCLVRPV
FT                   SGPELLARVNALSRRAGVRRLPTRSREMYGEYTFDATHCLVRFGDAIVSLTPKEFRFAQ
FT                   LLFTNLSRPVSRAHILETVWARRRDMKSRTLDTHASRLRSKLQLLPERGYRLLPLYGFG
FT                   YQLDRVPIEPPNSRPRHADARYAASEEIAETL"
FT   gene            571850..572104
FT                   /locus_tag="Bcen2424_0513"
FT   CDS_pept        571850..572104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07267"
FT                   /protein_id="ABK07267.1"
FT                   /translation="MNWFGILVLGAAVGLFGRWLHPMRRTGRPAWWIAVLVGIVGAAAA
FT                   RMVGNLSGLFYDGETLEWPVCTGVAFLAVAVTVALSARR"
FT   gene            572123..573937
FT                   /locus_tag="Bcen2424_0514"
FT   CDS_pept        572123..573937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0514"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: bcn:Bcen_2590 peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07268"
FT                   /protein_id="ABK07268.1"
FT                   /translation="MNARLPEVSPVPARLALLRDAMVRENLAAYLVPSADPHLSEYLPE
FT                   RWQARRWLSGFTGSVGTLVVTADFAGLWVDSRYWVQADAELAGTGVQLMKMTGGQQSAP
FT                   HVDWLAQNVAAGATVGVDGAVLGVAAARGLTAALSARGIALRTDVDLLDAIWPERPGLP
FT                   GDAVFEHVAPQADTTRASKLAEVRRAMQAQGAQWHFVSTLDDLAWLFNLRGADVNFNPV
FT                   FVAHAMIGAERATLFVADGKVPPALAASLAQDGVDVRAYDAARASLAALPDGATLLIDP
FT                   RRVTFGTLEAVPAGVKLVEAVNPSTFAKSRKTSAEIEHVRVTMEHDGAALAEFFAWFEQ
FT                   AVNRETITELTIEEKLTAARARRPGYVSASFATIAGFNANGAMPHYHATRESHATIAGD
FT                   GLLLIDSGGQYMTGTTDITRVVPVGTVSDLQRRDFTIVLKSMMALSRARFPRGIRSPML
FT                   DAIARAPMWAAGLDYGHGTGHGVGYFLNVHEGPQVISHYAPAEPYTAMEEGMITSIEPG
FT                   VYRPGQWGIRIENLVVNRAAGKTEFGDFLAFETLTLCPIDTRCVLIEMLHDEERAWLNT
FT                   YHATVRERVGRHVSGDAKAWLDARTQPI"
FT   gene            574015..574566
FT                   /locus_tag="Bcen2424_0515"
FT   CDS_pept        574015..574566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0515"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bcn:Bcen_2589
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07269"
FT                   /protein_id="ABK07269.1"
FT                   /translation="MADTAVIVVDMQRGLVERAQPAYRLDDVVSGINRLTAAARAANAP
FT                   VCFVQHDGDADDDVVPGTPGWELHAGLVVGRDDWRVRKQASDAFHDTPLAAQLDRHGIR
FT                   SVLICGYATEFCVDSAARRAALLGYRTTVVSDLHTTNERAHLSAAQIVAHHHFIWNNNS
FT                   LSGNAVTPRPLADVLATEFA"
FT   gene            574563..575186
FT                   /locus_tag="Bcen2424_0516"
FT   CDS_pept        574563..575186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0516"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bcn:Bcen_2588 HAD-superfamily hydrolase
FT                   subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07270"
FT                   /protein_id="ABK07270.1"
FT                   /translation="MTIKAVVFDFGGVLIDWSPEYLYRELIPDAAERRWFLTHVCAMDW
FT                   VVRQDGGQTIEEGTAELVAKFPEHEALIRAFYARWHEMIGGVLEEGAALVDRLEAQGMP
FT                   LFGLTNWSAQTFPYAWDNFPVLRRFKDIVVSGRVKLVKPDPAIYREMHARIEPHLPGIA
FT                   PHELVFIDDNAHNAAAATALGWHGIHHTSAAATEARLRELGALV"
FT   gene            complement(575317..576984)
FT                   /locus_tag="Bcen2424_0517"
FT   CDS_pept        complement(575317..576984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0517"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_2587 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07271"
FT                   /protein_id="ABK07271.1"
FT                   /translation="MAQYVFTMNRVGKIVPPKRQILKDISLSFFPGAKIGVLGLNGSGK
FT                   STLIRIMAGVDKDIEGEATPMPNLNIGYLPQEPQLDPTKTVREAVEEGLGDLFQANKKL
FT                   EEIYAAYAEPDADFDALAAEQAKYEAILASSDGGSPEQQLEVAADALRLPPWDAKIEHL
FT                   SGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVDWLEQFLVRFPGTVVAVTHDRYFL
FT                   DNAAEWILELDRGHGIPWKGNYSSWLDQKEERLKQEEASESARQKAIKKELEWVRQNPK
FT                   GRQAKSKARIARFEELSSQEYQKRNETQEIFIPAGERLGNEVIEFKNVSKSFGDRLLID
FT                   NLSFKIPAGAIVGIIGPNGAGKSTLFKMLTGKEQPDSGEVVMGPTVKLAYVDQSRDALD
FT                   GSKTVFEEISGGADVLTVGKYETPSRAYIGRFNFKGGDQQKIVGNLSGGERGRLHLAKT
FT                   LISGGNVLLLDEPSNDLDVETLRALEDALLEFAGSVMVISHDRWFLDRIATHILAFEGD
FT                   SQVTFFDGNYQEYEADKRARLGEEAAKPKRLRYKPISR"
FT   gene            complement(577154..577462)
FT                   /locus_tag="Bcen2424_0518"
FT   CDS_pept        complement(577154..577462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07272"
FT                   /protein_id="ABK07272.1"
FT                   /translation="MRALLHRATHVATLSAALFVAGAALPPAAHAYRASPGYGNEADLD
FT                   RHDTYRNRDGETVHAPAHSKSGRVPDGASARCRDGTYSFSRHRRGTCSGHGGVAAWL"
FT   sig_peptide     complement(577367..577462)
FT                   /locus_tag="Bcen2424_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 32"
FT   gene            complement(577552..578469)
FT                   /locus_tag="Bcen2424_0519"
FT   CDS_pept        complement(577552..578469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0519"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_2586 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07273"
FT                   /protein_id="ABK07273.1"
FT                   /translation="MNRSRLPPLNALRAFEAAARHLSVKSAAEELSVTPGAVSQMIRTL
FT                   ETHLGVQLFERVNRGILLTAAGRDYLPPVRNAFRQIADASQRVSGAADSGVLTVSVTPF
FT                   FASAWLVPRLAQFRQACPDVDLQVLTSHALADFARDGVDVAIRHGLGRYIGLCSERLLT
FT                   VEIVALASPGLVARLGMPATPAELVGWPQLHDAERKGWHIWFGAQRIDDFGPPRGPAFD
FT                   DSGLLLQAIVAGQGAGLLPAAMVRGELASGRLVQLADVAWLDDFAYYLVYPPHHAERPK
FT                   VAAFRRWILDAAQADGAASMTGAA"
FT   gene            578675..579946
FT                   /locus_tag="Bcen2424_0520"
FT   CDS_pept        578675..579946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0520"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_2585 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07274"
FT                   /protein_id="ABK07274.1"
FT                   /translation="MNRPGASRVFHGWYVVAAAFAVTFVGFGSAYTFSAFVESLQRDFA
FT                   ASRGQISLVFSLAGFLYFGFGIVSGPLADRFGSRRLAVAGMLLTGAGLAAAGAAHTLLQ
FT                   VYVAYGLGVGFGVGCAYVPAVGAVQRWFVRRRGFASGLAVAGIGVGTLVMPPLASALIA
FT                   QVGWRGAYFTLAALVIVLGAGMSLLIENDPRGRRLLPDGDVAPDGDGRNGGASPAAAAC
FT                   VPAGATVREAVTSRPFASLYAACLVCSFGVFVPFVHLVPYALDHGVAPSTAVLLLGAIG
FT                   VGSTAGRFFLGGLADRFGRRASLLAMFAGMAVALVAWAGAGTVATLAGFALVFGVFYGG
FT                   WVAVLPAVVMDYFGGRNVSAIIGILYTSVAFGTLIGPAAAGFIYDAGGGYLVPILASAA
FT                   ANAIAFAIVATTGRAPAAARAAGG"
FT   sig_peptide     578675..578788
FT                   /locus_tag="Bcen2424_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.814) with cleavage site probability 0.413 at
FT                   residue 38"
FT   gene            580028..580372
FT                   /locus_tag="Bcen2424_0521"
FT   CDS_pept        580028..580372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0521"
FT                   /product="protein of unknown function DUF661"
FT                   /note="PFAM: protein of unknown function DUF661; KEGG:
FT                   bcn:Bcen_2584 protein of unknown function DUF661"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07275"
FT                   /protein_id="ABK07275.1"
FT                   /translation="MTFDEVRQIALAWRGVEDGTSYGTPALKVKGKVLARLREDGDTLV
FT                   VKGVGPDERAWLIESAPDVYYVTDHYVGWPIVLVRLSAAHPDAVKNLLLREWHAIVPAT
FT                   WRDDAARGAN"
FT   gene            580749..582140
FT                   /locus_tag="Bcen2424_0522"
FT   CDS_pept        580749..582140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0522"
FT                   /product="gamma-aminobutyrate:proton symporter, AAT family"
FT                   /note="TIGRFAM: GABA permease; PFAM: amino acid
FT                   permease-associated region; KEGG: bcn:Bcen_2583 GabA
FT                   permease; TC 2.A.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07276"
FT                   /protein_id="ABK07276.1"
FT                   /translation="MSGSNTGLGTGLKQRHVTMMSIAGVIGAGLFVGSGHAIAEAGPAS
FT                   ILAYAIAGVLVVLVMRMLGEMAVAHPDSGSFSTYADRAIGHWAGFTIGWLYWWFWVLVI
FT                   PIEATAAATILNAWFPGIATWIFALGITLLLTVTNLFSVKNYGEFEFWFALIKVVAIVV
FT                   FLCIGGAAIVGIIPAPAVSGVSNLFVHDGFMPHGASAVLAAMLTTMFSFLGTEIVTIAA
FT                   AESDNPQRQIVRATNSVIWRITLFYLGSILVVAAIVPWNDPLLPKHGSYQRAMELIGVP
FT                   NAKAIIDVIVLVSVASCLNSALYTASRMLFSLSRRKDAPAFLHRTDSTGTPRAAVLAST
FT                   AFGFLTVIANYLMPEQVFGFLLATSGAIALLVYLVIAISQLRMRKTLESGGADLTLRMW
FT                   LFPWLTWAVILFICGTLTVMFVSEEHRMEVGATAVLALIVLLASWLNKRGRDARANAGR
FT                   RVSAT"
FT   sig_peptide     580749..580868
FT                   /locus_tag="Bcen2424_0522"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.824) with cleavage site probability 0.703 at
FT                   residue 40"
FT   gene            582370..583569
FT                   /locus_tag="Bcen2424_0523"
FT   CDS_pept        582370..583569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07277"
FT                   /protein_id="ABK07277.1"
FT                   /translation="MGTVHESGNRAVDARRVGTYAAAVLALQIVVLAVWAMRYYGWHDR
FT                   SSPMVGSDFAIFWAAARVAIEHGAAAIFSPGWMQPIEAALRPFDDFAPWPYPPTFLLVI
FT                   LPFGLVPFAFALVVFATLQIACYAAVVARVVRPLDTQLRVAIAAFPGLLGAALTMQNSF
FT                   MTVAAAAAALLLLESSPVLAGACIAVLIVKPQFGVLFPLALVCGRHWKALISAGAFSAG
FT                   IVAVSLAAFGVRAWAAFFAFMPAFHHNVVEYGDTLRRAMPSTISLARAAGLSVGPAYAV
FT                   HAVVGVLAVAVVIDVWIRRSRFALRAAALAAGTLLVQPYYVYYDLLWLVLPVAFLLLDA
FT                   RNVPLRRAEIVIVVLAWLAPAQAFIAVISGTGWPVASAMLVALLAMIVRRSRAPAPVAA
FT                   "
FT   gene            complement(583720..584814)
FT                   /locus_tag="Bcen2424_0524"
FT   CDS_pept        complement(583720..584814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0524"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein, HSR1-related; Protein of unknown function DUF933;
FT                   KEGG: bcn:Bcen_2581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07278"
FT                   /protein_id="ABK07278.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGIVE
FT                   VPDTRLKALSEIVKPERVVPAVVEFVDIAGLVAGASKGEGLGNQFLANIRETDAITHVV
FT                   RCFEDDNVIHVAGKVSPIDDIEVINTELALADLGTIEKALTRYSKAAKSGNDKEAAKLV
FT                   AVLEKVRAQLDQGKAVRGLALSDDEQALIKPFCLITAKPAMYVANVKDDGFENNPHLEA
FT                   VRKYAESENAPVVAVCAAIEAEIADLDDADKEAFLADMGMEEPGLDRVIRAGFKLLGLQ
FT                   TYFTAGVKEVRAWTIHIGDTAPQAAGVIHTDFERGFIRAQTIAFDDFVTYKGEQGAKEA
FT                   GKMRAEGKEYVVHDGDVMNFLFNV"
FT   gene            585063..586241
FT                   /locus_tag="Bcen2424_0525"
FT   CDS_pept        585063..586241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0525"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; KEGG: bcn:Bcen_2580 ubiquinone biosynthesis
FT                   hydroxylase, UbiH/UbiF/VisC/COQ6 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07279"
FT                   /protein_id="ABK07279.1"
FT                   /translation="MPAMTAHHSFDVAVVGGGLVGKTAALALTQSGYKTALLAQPATPR
FT                   PADLAFDTRVYALSSSSQALLERLRVWQALDHGRLAPVYDMRVYGDAHAELHFSAYQAS
FT                   VPQLAWIAESSLVEASLDAALRFQPNLTWFDSRAQGFDVRDDAAVLTLSSGQVLEADLV
FT                   VGADGAHSWVRSQMGARVERRDYRQTGVVANFKASLPHRETAYQWFHEGEIVALLPLPD
FT                   GHVSLVWSAHTAHADALLALDPAQLAAEVERVSHGQVGTLECVTPAAGFPLALQTVDKL
FT                   IAPRVALVGDAAHLIHPLAGQGMNLGLRDVAALADAIAGKESFRNLGDTVLLRRYERSR
FT                   REDIRALMVATDGLQRLFAVPGSLAKAVRNAGMAFVGAQPLVKRWLVSAALG"
FT   gene            586332..587060
FT                   /locus_tag="Bcen2424_0526"
FT   CDS_pept        586332..587060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0526"
FT                   /product="protein-disulfide isomerase-like protein"
FT                   /note="KEGG: bcn:Bcen_2579 protein-disulfide
FT                   isomerase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07280"
FT                   /protein_id="ABK07280.1"
FT                   /translation="MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGNDAP
FT                   IKSVSKSPVAGLYEVNLGSQIIYSDAAGDYVLLGDLVDAKTHKNLTDARLSEINKIDFA
FT                   SLPFANAIKIVKGNGARKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTA
FT                   KSKAIWCATDRAKTWESWMLDHRAPSGAGTCDTTALDKNLALGRGMNVTGTPTIFLPDG
FT                   RRLPGAVSADQLNQALASSK"
FT   sig_peptide     586332..586409
FT                   /locus_tag="Bcen2424_0526"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 26"
FT   gene            587166..588965
FT                   /locus_tag="Bcen2424_0527"
FT   CDS_pept        587166..588965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0527"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: peptidase M61 domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein; KEGG: bcn:Bcen_2578 peptidase
FT                   M61"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07281"
FT                   /protein_id="ABK07281.1"
FT                   /translation="MTQPIRYSIVPKDLAAHLFEVTVTVADPDPEGQRFSLPVWIPGSY
FT                   LVREFARNIVTLRAFNDAGRKVRIAKTDKHTWQAAPVTGALTLRYDVYAWDLSVRSAYL
FT                   DESGGFFNATAVFLSVAGREDAPCEVDIAKPAGAAFRTWRVGTALPEAGGTRRYGFGAY
FT                   RAANYDELSDHPVTIGEFALATFDAHGVPHDIVIAGRVTQLDLERLRTDLKRVCEAQIA
FT                   LFEPKSKKAPMDRYVFMTLAVSDGYGGLEHRASTALICNRTDLPVKGRPETTEGYRTYL
FT                   GLCSHEYFHTWNVKRIKPAAFVPYDLTRENYTSLLWLFEGFTSYYDDLMLVRSGLMSQD
FT                   DYFAALGRTIGGVLRGTGRLKQSVAESSFDAWIKYYRQDENATNAIVSYYTKGSLVALA
FT                   FDLAIRAQTRNRKSLDDVMRLLWQRYGRDFYRGKQAGVDENEVEALIEEATGVALGRLF
FT                   ADAVHGTRDLPLGELLAPFGVTLAPDVATGAAAKPTIGARLRGGADCTLAAVYEGGAAH
FT                   RAGLSAGDTLIAVDGLRVTGTNLDALLARYRPGDKVEIHAFRRDELRTAKLKLDGPEVT
FT                   RYRLTAAAKPAAATKAREAWLKG"
FT   gene            589114..589710
FT                   /locus_tag="Bcen2424_0528"
FT   CDS_pept        589114..589710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0528"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: bcn:Bcen_2577
FT                   (acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07282"
FT                   /protein_id="ABK07282.1"
FT                   /translation="MTTILQINSAARSQGAQSTLLANELTAKLQQSNPGANVVVRDLLA
FT                   DALPHLDESVLGAFFTPADKRTAEQNAIVAKSDALIAELQAADIIVIGAPMYNFGISSQ
FT                   LKTYFDWIARAGVTFRYTENGPEGLIKGKKVHVVTARGGKYLGTPNDSQTPYLRTFLGF
FT                   IGLTDVSFIHAEGLNLGPDAQSAALAGAREAIAAA"
FT   gene            complement(589840..590757)
FT                   /locus_tag="Bcen2424_0529"
FT   CDS_pept        complement(589840..590757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0529"
FT                   /product="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: uracil-DNA glycosylase; PFAM: Uracil-DNA
FT                   glycosylase superfamily; KEGG: bcn:Bcen_2576 uracil-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07283"
FT                   /protein_id="ABK07283.1"
FT                   /translation="MATRKTSRAPQQASLFDDPVPETAPADIPSPASEPPAAGRKPAKK
FT                   TAAPAPAAAPAAAVLRPVAADVPHLAEQFDALPAVWRDVLKPFTDSDAYAPLCRFVDEE
FT                   RAAGKTVYPTDVFRALRLTHPDDVKVVILGQDPYHGDDRGTPQAHGLAFSVPPAVRTPP
FT                   SLRNIFKEIAANFGHDTPRHGCLDTWARQGVLLLNTVLTVERGAAASHAKRGWEQCTDT
FT                   LIRELAGRHRGLVFMLWGAHAQAKRALFDANAHCVLEAPHPSPLSAHRGFLGCRHFALA
FT                   NDYLAAAGREPIDWRLPDVAETLA"
FT   gene            complement(590771..591397)
FT                   /locus_tag="Bcen2424_0530"
FT   CDS_pept        complement(590771..591397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0530"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: bcn:Bcen_2575
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07284"
FT                   /protein_id="ABK07284.1"
FT                   /translation="MAIEQEIKLALPAGQADAARRFFETLTGEPGRAITLANVYYDTPD
FT                   LALARSKSAVRVRRTPDGWLQTFKTVGSAEGGLHSRHEWELPVAGDALEIDALVAACDV
FT                   PEAAAALNDAAGALHALFRTDFSRTLWRIAIGGATVEAAVDLGEIVVQAEHETRREPIS
FT                   EIELELIDGPETALATLAAELQQALPGLVPENISKAQRGYRLRAQ"
FT   gene            complement(591397..592182)
FT                   /locus_tag="Bcen2424_0531"
FT   CDS_pept        complement(591397..592182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0531"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   bcn:Bcen_2574 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07285"
FT                   /db_xref="GOA:A0K458"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K458"
FT                   /protein_id="ABK07285.1"
FT                   /translation="MSDILDRIIAVKREEIAAALRSTPLEALKLEASARDLRDFVGALR
FT                   AKHAAGNAAVIAEIKKASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGGVR
FT                   YLEEARAACTLPVLRKDFIVDAYQIVEARAMGADAILLIAAALDTPLMQDLEAYAHSLG
FT                   LAVLVEVHDRHEMEQALTLKTPLLGINNRNLRTFETSIQTTLDMLDMIPADRIVVTESG
FT                   ILSRTDVDTMRAANVNTFLVGEAFMRAEQPGEELARMFF"
FT   gene            complement(592211..593278)
FT                   /locus_tag="Bcen2424_0532"
FT   CDS_pept        complement(592211..593278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0532"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: bcn:Bcen_2573 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07286"
FT                   /db_xref="GOA:A0K459"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K459"
FT                   /protein_id="ABK07286.1"
FT                   /translation="MPPHRLPDERRTMTITPQEALQRTIEHREIFHDEMLHLMRLIMRG
FT                   DLSPVMAAAIITGLRVKKETIGEIAAAATVMREFANHVEVQDNSNFVDIVGTGGDGSHT
FT                   FNISTASMFVTAAAGAKVAKHGNRGVSSKSGSADVLEALGVNIDLQSEQVAASIAETGM
FT                   GFMFAPNHHPAMKNIAAVRRELGVRTIFNILGPLTNPAGAPNQLMGVFHPDLVGIQVRV
FT                   MQRLGAQHVLVVYGKDGMDEVSLGAATLVGELRDGKVHEYEIHPEDFGLQMVSNRTLKV
FT                   ENADESRTMLLGALDNQPGVAREIVTLNAGTALYAANIAESIADGIQLAREAIASGKAR
FT                   AKVDELVRFTQQFKR"
FT   gene            complement(593256..593855)
FT                   /locus_tag="Bcen2424_0533"
FT   CDS_pept        complement(593256..593855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0533"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   bcn:Bcen_2572 glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07287"
FT                   /protein_id="ABK07287.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFGELGEDVRTYRNDEITLDDIARLNPD
FT                   TICLSPGPSNPQHAGITLDVLREFAGKKPILGVCLGHQAIGEAFGGRVVRAKTIMHGKV
FT                   SRIETDCRGVFADLPKHFDVTRYHSLAIERESLPDCLEVSAWTDDGEIMGVRHKTLPVE
FT                   GVQFHPESILSEHGHALLENFLKQHRAAAHAAAPAA"
FT   gene            complement(593869..595362)
FT                   /locus_tag="Bcen2424_0534"
FT   CDS_pept        complement(593869..595362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0534"
FT                   /product="anthranilate synthase, component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: bcn:Bcen_2571 anthranilate synthase component
FT                   I; TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein; Anthranilate synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07288"
FT                   /protein_id="ABK07288.1"
FT                   /translation="MTELEFQSLANEGYNRIPLIAEALADLETPLSLYLKLAQPERAGA
FT                   NSFLLESVVGGERFGRYSFIGLPARTLVRTRNGVSEVVRDGQVVETHDGDPFQFIESFQ
FT                   ARFKVAQRPGLPRFCGGLAGYFGYDAVRYIEKKLANTAPRDDLGLPDIQLLLTEEVAVI
FT                   DNLAGKLYLIIYADPGQPEAYAKAKQRLRELKQRLRTTVQPPVTSASVRTETFREFKKD
FT                   DYLAAVRQAKEYIAAGELMQIQVGQRLTKPYRDNPLSLYRALRSLNPSPYMYYYNFGDF
FT                   HVVGASPEILVRQEKRGEDQIVTIRPLAGTRPRGNTPERDAELATELLNDPKEIAEHVM
FT                   LIDLARNDVGRIAEIGSVQVTDKMVIEKYSHVQHIVSSVEGKLKPGMTNYDVLRATFPA
FT                   GTLSGAPKVRAMELIDELEPVKRGLYGGAVGYLSFSGEMDLAIAIRTGLIHNGNLYVQA
FT                   AAGVVADSVPESEWQETENKARAVLRAAEQVQDGLDSDF"
FT   gene            complement(595720..596484)
FT                   /locus_tag="Bcen2424_0535"
FT   CDS_pept        complement(595720..596484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0535"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: bcn:Bcen_2570 phosphoglycolate phosphatase;
FT                   TIGRFAM: phosphoglycolate phosphatase ; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07289"
FT                   /protein_id="ABK07289.1"
FT                   /translation="MADSSFAGRAPAGAATDAAPIRFAAPRIDAALIDLDGTMVDTADD
FT                   FTAGLNGMLAQLGAPATSRDEVIGYVGKGSEHLIQSVLKPRFPADEAHARFDDALAIYQ
FT                   SEYAKINGRHTRLYPDVAAGLDALRAAGIRLACVTNKPHRFAVELLEQYGLAGCFGIVL
FT                   GGDSVARKKPDPLPMLTACDALGVAPDAAVAIGDSENDALAGRAAGMATLTVPYGYNHG
FT                   KAIQTINSDGIVDSLLVAARAISAHNAGRPTL"
FT   gene            complement(596489..597175)
FT                   /locus_tag="Bcen2424_0536"
FT   CDS_pept        complement(596489..597175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0536"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; Orotidine
FT                   5'-phosphate decarboxylase; KEGG: bcn:Bcen_2569
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07290"
FT                   /protein_id="ABK07290.1"
FT                   /translation="MTQFRIAPSILSADFARLGEEVRNVVAAGADWIHFDVMDNHYVPN
FT                   LTIGPLVCEAIRPHVQVPIDVHLMVRPVDRIVPDFAKAGANLISFHPEGSDHIDRTLSL
FT                   IRDHGCKAGLVFNPATPLNYLDHVMDRLDFVLLMSVNPGFGGQSFIPETLNKLREARAR
FT                   IDAYTERTGREILLEVDGGVKADNIAEIAAAGADAFVAGSAIFGKPDYRKVIDEMRAAL
FT                   ATVERS"
FT   gene            597353..597727
FT                   /locus_tag="Bcen2424_0537"
FT   CDS_pept        597353..597727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0537"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: bcn:Bcen_2568 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07291"
FT                   /protein_id="ABK07291.1"
FT                   /translation="MSQYQFTVSVKTSYLPEQSDPDHRQYAFAYTLTIRNTGQVAAQLI
FT                   ARHWIITDSESHVQEVKGLGVVGHQPLLQPGEHFEYTSWAVIATPVGTMRGAYFCVAED
FT                   GERFEAPVDEFALHMPRTLH"
FT   gene            597813..599045
FT                   /locus_tag="Bcen2424_0538"
FT   CDS_pept        597813..599045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0538"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   bcn:Bcen_2567 MltA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07292"
FT                   /protein_id="ABK07292.1"
FT                   /translation="MKISRASATKASSAKMSIGYWSRKSDMAVSIKNGHCMWFGPRLAG
FT                   WMAAAAAAALLAACGGAPTRTSALKPPTGAAIVPGQVAAKRLTPVAWQQVPGWQDDSLI
FT                   GATAALRQNCARLARQPAWTRACAAADRLDELDVSSARTFFETYFTPFQLANTDGTLDG
FT                   LVTGYYEPLLHGSRVRRGPYQYALYRWPAGYRAGAALPARAQLERAGILNGNELVWVDD
FT                   PIEAFFLQVQGSGRVLLDDGSVMRVGFGGTNNQPYRSIGKWLLDRGELTPAQATMQGIK
FT                   AWAKANPTRVDALLDTNPRFVFFRDMPTKEDAPHGGADGPIGALGVPLTPERSIAVDPS
FT                   SIPLGTPVFLQTTRPLTNTPMNRLVFAQDTGSAIKGGVRADYFWGLGDDAGDQAGRMKQ
FT                   VGRMWLLFPNS"
FT   gene            complement(599333..600631)
FT                   /locus_tag="Bcen2424_0539"
FT   CDS_pept        complement(599333..600631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0539"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="TIGRFAM: phenylacetate-CoA ligase; KEGG:
FT                   bcn:Bcen_2566 phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07293"
FT                   /protein_id="ABK07293.1"
FT                   /translation="MTTPLPLEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFD
FT                   EAGVHPDDVTTLADLSRFPFTTKGDLRDSYPFGMFAVPQDQISRIHASSGTTGKPTVVG
FT                   YTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGG
FT                   GQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMR
FT                   VAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDG
FT                   ELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFP
FT                   TQIEEQLLKQCALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQAAKQALAYDIK
FT                   SLIGVTAVINVLPVNGIERSVGKARRVIDKRKS"
FT   gene            complement(600670..601122)
FT                   /locus_tag="Bcen2424_0540"
FT   CDS_pept        complement(600670..601122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0540"
FT                   /product="phenylacetic acid degradation protein PaaD"
FT                   /note="TIGRFAM: uncharacterized domain 1; phenylacetic acid
FT                   degradation protein PaaD; PFAM: thioesterase superfamily
FT                   protein; KEGG: bcn:Bcen_2565 phenylacetic acid degradation
FT                   protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07294"
FT                   /protein_id="ABK07294.1"
FT                   /translation="MTNATATLDPDSLARATAQAMYDADACSRAFGMEIAEVRAGYARL
FT                   QMRVRPEFLNGHQTCHGGIIFTLADSTFAFACNSYNLNAVAAGCSIEFLRPVHGGDLLT
FT                   AEAIEQARAGRHGIYDIRVTNQTGETVAMFRGKSAQIKGTVIPEDH"
FT   gene            complement(601124..601915)
FT                   /locus_tag="Bcen2424_0541"
FT   CDS_pept        complement(601124..601915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0541"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="TIGRFAM: phenylacetate degradation probable
FT                   enoyl-CoA hydratase paaB; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: bcn:Bcen_2564 phenylacetate
FT                   degradation probable enoyl-CoA hydratase PaaB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07295"
FT                   /protein_id="ABK07295.1"
FT                   /translation="MSYQAIQLDIDQAAGVATVTLNRPDKLNSFTRVMHRELQSALDEV
FT                   EVAGARALILTGAGRGFCAGQDLADLDFTPGASTDLGTLIDEHFNPLIRRLQRLPIPVI
FT                   AAVNGTAAGAGANLALACDLVFAARSSSFIQAFIKIGLVPDSGGTWFLPQRVGMARALG
FT                   LALTGDKLGAEQAEQWGLIWRAVDDDALVATTRQLATQLAQQPTLAIASIKQSMRDSVT
FT                   NTLDQQLDVERDLQRKLGQSHDYAEGVQAFIEKRAPRFEGR"
FT   gene            complement(601961..603163)
FT                   /locus_tag="Bcen2424_0542"
FT   CDS_pept        complement(601961..603163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0542"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bcn:Bcen_2563 beta-ketoadipyl CoA thiolase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; beta-ketoadipyl CoA
FT                   thiolase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07296"
FT                   /protein_id="ABK07296.1"
FT                   /translation="MTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALIERNRDVD
FT                   WAAIDDVIYGCANQAGEDNRNVARMSALLAGLPTAVPGTTLNRLCGSGMDAVGTAARAI
FT                   KAGEARLMIAGGVESMTRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQLYGVDSM
FT                   PETAENVAVDYDISRADQDLFALRSQQKAARAQQDGTLAEEIVAVTIPQKKGDAIVVSR
FT                   DEHPRETSLEALAKLKGVVRPDGSVTAGNASGVNDGACALLLANAQAADQYGLRRRARV
FT                   VGMATAGVEPRVMGIGPAPATQKLLRQLDMRIDQFDVIELNEAFASQGLAVLRMLGVAD
FT                   DDPRVNPNGGAIALGHPLGASGARLVTTALHQLERTGGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT   gene            complement(603251..604957)
FT                   /locus_tag="Bcen2424_0543"
FT   CDS_pept        complement(603251..604957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0543"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="TIGRFAM: phenylacetic acid degradation protein paaN;
FT                   PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_2562
FT                   phenylacetic acid degradation protein paaN2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07297"
FT                   /protein_id="ABK07297.1"
FT                   /translation="MTHALFTKHEDTLKHALAAIESRGYWSPFAEMPSPKVYGESASAD
FT                   GEAAFKSHLDKTFVLDQPATGETVGAERSPYGIALGVRYPKSAPDALIAAAAAAQRTWR
FT                   EAGPSAWVGVSLEILARLNRASFEIAYSVMHTTGQAFMMAFQAGGPHAQDRALEAVAYA
FT                   WDELRRIPADAHWEKPQGKNPPLAMHKRYTIVPRGTGLVLGCCTFPTWNGYPGLFADLA
FT                   TGNTVIVKPHPGAILPLAITVRIARDVLREAGFDPNVVTLLATEPNDGALVQDLALRPE
FT                   IKLIDFTGSTQNGTWLERHAHQAQVYTEKAGVNQIVIDSTDDLKAAAKNIAFSLALYSG
FT                   QMCTAPQNIYVPRGGIRTTDGHASFDEVAQAIAVAVQKLTGDPARSVELIGAIQNEGVT
FT                   ARIDDARKLGRVLADSVTLQHPAFPDARVRTPLVLQLDVADREKFTQEWFGPISFVIAT
FT                   DSTAQSLDLAGEIAAEHGALTLSVYSTDDAIVDAAHDAAVRGGVALSINLTGGVFVNQS
FT                   AAFSDFHGTGANPAANAALADPAFVANRFRVVQSRVHVAPKAAPAEAGQTA"
FT   gene            605087..605863
FT                   /locus_tag="Bcen2424_0544"
FT   CDS_pept        605087..605863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0544"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bcn:Bcen_2561 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07298"
FT                   /protein_id="ABK07298.1"
FT                   /translation="MAYENIQVETRGRVGLVTLNRPKALNALNDALMDELGAALKAFDA
FT                   DDDIGAIVVTGSEKAFAAGADIGMMATYSYMDVYRGDYITHNWETVREIRKPIIAAVSG
FT                   FALGGGCELAMMCDIIFAADTAKFGQPEIKLGVMPGAGGTQRLPRAVSKAKAMDMCLTA
FT                   RFMDAAEAERAGLVSRVLPADKVLEEAIAAATTIAEFSLPAVMMVKESVNRAYETTLAE
FT                   GVHFERRLFHSLFATEDQKEGMAAFVEKRKPVFKHR"
FT   gene            606485..607962
FT                   /locus_tag="Bcen2424_R0016"
FT   rRNA            606485..607962
FT                   /locus_tag="Bcen2424_R0016"
FT                   /product="16S ribosomal RNA"
FT   gene            608027..608103
FT                   /locus_tag="Bcen2424_R0017"
FT                   /note="tRNA-Ile4"
FT   tRNA            608027..608103
FT                   /locus_tag="Bcen2424_R0017"
FT                   /product="tRNA-Ile"
FT   gene            608145..608220
FT                   /locus_tag="Bcen2424_R0018"
FT                   /note="tRNA-Ala5"
FT   tRNA            608145..608220
FT                   /locus_tag="Bcen2424_R0018"
FT                   /product="tRNA-Ala"
FT   gene            608496..611377
FT                   /locus_tag="Bcen2424_R0019"
FT   rRNA            608496..611377
FT                   /locus_tag="Bcen2424_R0019"
FT                   /product="23S ribosomal RNA"
FT   gene            611528..611640
FT                   /locus_tag="Bcen2424_R0020"
FT   rRNA            611528..611640
FT                   /locus_tag="Bcen2424_R0020"
FT                   /product="5S ribosomal RNA"
FT   gene            612016..614091
FT                   /locus_tag="Bcen2424_0545"
FT   CDS_pept        612016..614091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0545"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: bcn:Bcen_0063 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07299"
FT                   /protein_id="ABK07299.1"
FT                   /translation="MNAATQVARAVCPHDCPDTCAMRVTVENGKAIKVTGDPDHPPTQG
FT                   VLCTKVSRYADRVHHPDRLTVPLKRVGAKGEGRFVPISWSEAFDEIGRRLGEITARAPE
FT                   AIVPYSYAGTMGLVQGEGIAQRFFHKLGASRLERAICAAAGAAGLRYTYGGSVGMHLEY
FT                   FEESELILIWGANPIASSLHFWTRAQEAKRRGARLVAIDPYRSLTAEKCHQHIALKPGT
FT                   DGAFALGMMHVLITENLLDHDYIADHTLGFDALKARAMSYPPERVAQICGIDASELVDL
FT                   ARRYGATRKASIRLNYGMQRVRGGGNAVRAIASLPALTGAWRDRAGGLLLSSSESAPVN
FT                   QAALLRPDLMPGWPHKLPRIINMNAIGDALLHPGDATFGPKVEAVIVYNSNPVAVAPDS
FT                   SKVAAGFARDDLFTVVLEHFKTDTVDFADIVLPATTQLEHLDVHKSYGHTYVMANLPAI
FT                   PPVGDARPNTEIFRGIARSMGLDEPALYHSDEEVARAALRWDDPALDSDWDTLKQAGWL
FT                   KLKLPEAPFANGGFRTPSGKCEFYSPRLEQMGMDPVPDYLPPFESAEAAPELAARYPLA
FT                   MISPPARHFLNSTFVNVDSLRSTEGEPHLDMHPSDADARGIAEGDTVRIFNDRGSMQAL
FT                   ARITDRARAGLVVGLSIWWKKLSPDGRNANEVTSQALTDLGNSATFYDCLVEVERI"
FT   gene            614229..615902
FT                   /locus_tag="Bcen2424_0546"
FT   CDS_pept        614229..615902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0546"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_0064 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07300"
FT                   /protein_id="ABK07300.1"
FT                   /translation="MDKIWLKSYPPGVPAEIDSSPYPSVPDLLDESFRQYRDRTAFVCM
FT                   GKGITYGELDKLSRQFGAWLQSRGLARGSRVAIMMPNVLQYPVTIAAVLRAGYTVVNVN
FT                   PLYTPRELEHQLKDSGAEAIVILENFASTLQAVIANTAVKHVVVASMGDLLGIKGWLVN
FT                   YVVRNVKKMVPAWQLPSFTRFKAALSEGARLAFKPQKIGPDDVAFLQYTGGTTGVAKGA
FT                   TLLHRNIVSNVLQAGAWHHPAHEKYPEVEQFVTVVALPLYHVFALTVCGFLTMRTGGMG
FT                   ILIPNPRDIAGMIKELKGYQISTIPAVNTLYNALLNHPEFGQLDLSKLVIANGGGMAIQ
FT                   EGVAKRWYEKTRTAIIEGYGLSETSPVATCNPVTATEYSGTIGLPLPSTEVAIRDDAGN
FT                   DVALGEPGEICIRGPQVMAGYWNRPDETAKVMFADGFFKTGDVGVMDARGYVKIVDRKK
FT                   DMILVSGFNVYPNEVEDVVASHPGVFEVAAVGVPDEHSGEAVKLFIVKKDPALTDKDIL
FT                   AYCKERLTGYKRPKLVEFRTELPKTNVGKILRRELRDGRA"
FT   gene            616024..616392
FT                   /locus_tag="Bcen2424_0547"
FT   CDS_pept        616024..616392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07301"
FT                   /protein_id="ABK07301.1"
FT                   /translation="MRFELTAGGRVDIYHPITNHQSPITNHQSPITDHRSPITDHRSPI
FT                   TDHRSPITDHRSPITDHRSPITDHRSPITDHRSPIHRSTDPPIHRSTDPLIHHRHRLTT
FT                   KEKGARRRLQYAAACQAS"
FT   gene            complement(616393..617544)
FT                   /locus_tag="Bcen2424_0548"
FT   CDS_pept        complement(616393..617544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0548"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_0066
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07302"
FT                   /protein_id="ABK07302.1"
FT                   /translation="MKKSLLALVALGAFAGAAHAQSSVTLYGIIDEGFLFNNNAGGKHL
FT                   YGLASGVMQGSRFGLRGTEDLGGGLKAIFTLENGFDVNSGRLGQGGLMFGRQAYVGLSS
FT                   QYGTVTLGRQYDSVVDFVGPLEAGDQWGGYIAAHPGDLDNFNNAYRVNNAVKFTSANYG
FT                   GLTFGGLYSFGGQAGQFSKNQVWSLGAGYTNGPLVLGVGYLNARTPNQFGGMFNNGSAS
FT                   SSVSSPVYGAYANNANTYQVIGAGGAYTFGAATIGATYSNTKFKGFSAGPFVNQTATFN
FT                   NGEINFKYQLTPALILGAAYDYTQGSKIDGNSAAKYHQGSLGVDYFLSKRTDVYAIGVY
FT                   QHASGNVLDSNGNVLKATAAINGLAGSSTSNQVAARVGIRHKF"
FT   sig_peptide     complement(617482..617544)
FT                   /locus_tag="Bcen2424_0548"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            617821..618447
FT                   /locus_tag="Bcen2424_0549"
FT   CDS_pept        617821..618447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0549"
FT                   /product="ubiquinone biosynthesis protein COQ7-like
FT                   protein"
FT                   /note="KEGG: bcn:Bcen_0067 ubiquinone biosynthesis protein
FT                   COQ7-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07303"
FT                   /db_xref="GOA:A0K476"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K476"
FT                   /protein_id="ABK07303.1"
FT                   /translation="MVLDELISEFDRGLRSLTGISRMSRPVPVPADTPDVELTPAERTH
FT                   AAGLMRVNHVGEVCAQALYQAQKLTARTASAKAMFEEAAREEEDHLAWTAHRLKELDSR
FT                   PSLLNPLWYAGALAIGVAAGTLGDKVSLGFMAETERQVESHLEGHMSELPPTDTASRAI
FT                   VDQMRIDEVKHGKAATDAGGIELPLPARMLMRAASKVMTSTAYYL"
FT   gene            618834..619262
FT                   /locus_tag="Bcen2424_0550"
FT   CDS_pept        618834..619262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0550"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: bcn:Bcen_0068 protein of unknown
FT                   function UPF0040"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07304"
FT                   /db_xref="GOA:A0K477"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K477"
FT                   /protein_id="ABK07304.1"
FT                   /translation="MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHPDGCLL
FT                   LFPRPEWEVFRAKIAALPMDAHWWRRIFLGNAMDVDLDSAGRILVSPELRMAAGLEKEV
FT                   MLLGMGSHFELWDSQTYNAKEQAAMAQGMPDALKNFTF"
FT   gene            619286..620227
FT                   /locus_tag="Bcen2424_0551"
FT   CDS_pept        619286..620227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0551"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: bcn:Bcen_0069 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07305"
FT                   /db_xref="GOA:A0K478"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K478"
FT                   /protein_id="ABK07305.1"
FT                   /translation="MGNELRHRTVLLDEAVESLVTRPDGVYVDGTFGRGGHSRAVLARL
FT                   ASAGRLIAFDKDPRAIETAQGIEDARFSIVHDSFASMRDALAARGVEKVSGVLLDLGVS
FT                   SPQVDDPARGFSFRADGPLDMRMDPTRGESAAEWLARASVQELTEVIRDYGEERFAFQI
FT                   AKALVARRAESDRLGPLDTTGELAQIVGHVVKTREKGKDPATRTFQAIRIHVNQELADL
FT                   QVVLDAALSLLEQGGRLVVISFHSLEDRIVKRFMQAHASAPAVDRRLPIRAVDLPSPPL
FT                   KIISRQFPSEAEVAANPRARSAVMRIAERVTP"
FT   gene            620224..620565
FT                   /locus_tag="Bcen2424_0552"
FT   CDS_pept        620224..620565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0552"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL; KEGG:
FT                   bcn:Bcen_0070 cell division protein, FtsL -like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07306"
FT                   /protein_id="ABK07306.1"
FT                   /translation="MSRLNIFLLIIVMGCALSVVNSTNQQRQIFIQLQRAQSQERQLQQ
FT                   DYAQLQYQQSALSKTSRIEQLANDSLKMQPISTGRTQYLTLPAGAAKAIDAPIPASADT
FT                   AGKGKGGAR"
FT   sig_peptide     620224..620292
FT                   /locus_tag="Bcen2424_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.372 at
FT                   residue 23"
FT   gene            620562..622409
FT                   /locus_tag="Bcen2424_0553"
FT   CDS_pept        620562..622409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0553"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   bcn:Bcen_0071 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07307"
FT                   /protein_id="ABK07307.1"
FT                   /translation="MKPSPKRQNVKFSSSPVLGVHLPMWRSKLVVFLLFMAFVALAARA
FT                   FWIQGPGNAFYQKQGESRYQRTIELPATRGKILDRNGLVLATSLPVRAIWAIPDAVPDD
FT                   LDADKVNQLGKLLGMTSKELRVKLSEDKGFVYVKRQVPIDVADKVAALDIPGIYQRNEY
FT                   KRFYPEGEITAHLIGFTNVEDEGQEGVELGDQKMLSGTSGMRRVIKDRMGHIIEDVAEQ
FT                   IPPHNGTDVDLSIDSKIQYIAYANLKAAVEKFKAKAGAAMVVDVRTGEVLALVNYPTYN
FT                   PNDRSRMTGEQLRNRIMTDVFEPGSIMKPFTVSLALDLHRVTPNTLVETGNGHFVLDGA
FT                   PITDDAGFGTLTVGGVIQKSSNIGATKIAMTMRPEEMWNMYTSIGLGQAPKVGFPGAVA
FT                   GRLRPWKSWRRIEQATMSYGYGLSVSLFQLARAYTAIAHDGELMPVTIFKTDPNQPVAG
FT                   TQVFNPTTAREVRAMLETVVAPGGTSPDAAVPGYRVGGKSGTAYKHEGHGYTRKYRASF
FT                   VGMAPMPNPRVVIAVSVDEPTAGSHFGGQVSGPVFSAIAGDTMRALNVPPNMPIKQLVV
FT                   SDDSPESAAAKGPQKLATNGGAKHMIVSSTTRNSPGVVR"
FT   sig_peptide     620562..620699
FT                   /locus_tag="Bcen2424_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.804 at
FT                   residue 46"
FT   gene            622406..623953
FT                   /locus_tag="Bcen2424_0554"
FT   CDS_pept        622406..623953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0554"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: bcn:Bcen_0072
FT                   UDP-N-acetylmuramyl-tripeptide synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07308"
FT                   /protein_id="ABK07308.1"
FT                   /translation="MSAARSSHPAHQQIAAALAWLRQHVAPTAQLHADTRSLEAGDVFV
FT                   AYAVDGADNRAFMADAVARGAAAVLYQPEGLAHAPAAPAVPVALAVPALDQLAGEIASG
FT                   WYGDPSDSLLAVGVTGTNGKTSCTQWIATALTALHQPCAVIGTLGTGMPGQLVPTGFTT
FT                   PDAPQLQRSLAQLRDAGAQAVAMEVSSHALHQGRVNGTAFDIAVFTNLTQDHLDYHGTF
FT                   DAYEAAKAKLFAWRGLRAAVINRDDAAGRRLLEKLAGRVRTIAYGIGDAPAPDADRELV
FT                   ALDVRATATGTAFRLRSSWGDANVEVGTLGTFNVSNLLAVLGALLAADVPFDAALAEIE
FT                   RLESVNGRMQRLGGRLQNDEPLVVIDYAHTPDALEKTLDALRPIAAARGGRLVCMFGCG
FT                   GDRDATKRPLMGAIAERLADEVVVTSDNPRSEDPQHIIDQVVAGMTAPDRARRIEDRAS
FT                   AILQAVRGAAREDVVVLAGKGHEATQEIMGKKRTFSDQDHARLALAARATHGKGGAE"
FT   gene            623950..625356
FT                   /locus_tag="Bcen2424_0555"
FT   CDS_pept        623950..625356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0555"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: bcn:Bcen_0073
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07309"
FT                   /protein_id="ABK07309.1"
FT                   /translation="MTMLSLGEAARLIPGATVHGDAGVTFNRVSTDSRTVGAGDLFVAL
FT                   KGERFDAHDFLGDVAARGAAAALVAHAPAGIAMPMIEGGETRAALGALAHGWRMRFPLP
FT                   LVAVTGSNGKTTVKEMIASIFAAAVGADARLATAGNLNNDVGLPLTLLRLSAAHRLAVI
FT                   EIGMNHPGETEVLARLTAPTVALVNNAQREHQEFMATVDAVALEHAAVIHALPPDGVAV
FT                   FPADDAYAGIWRVAATGNRILDFALHDAERQNDAQVVGRMHGGELAIDTPAGAVTVRLR
FT                   ALGEHNARNALAATAAALGAGVALSAIRQGLEAFEPVKGRLQVKQASVGSLGGATVVDD
FT                   TYNANPDSMRAAIDVLAAHPAPRVLVIGDMGEVGDEGPAFHREIGAYARERGIDALFAL
FT                   GDASRDACTAYGDTARHFDDVGALVSALLAAGYGAQATVLVKGSRYMKMERVVDALTNQ
FT                   PAAGTVPAAH"
FT   gene            625373..626542
FT                   /locus_tag="Bcen2424_0556"
FT   CDS_pept        625373..626542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0556"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: bcn:Bcen_0074
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07310"
FT                   /db_xref="GOA:A0K483"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K483"
FT                   /protein_id="ABK07310.1"
FT                   /translation="MLLALAQWLQGDASFLRLFTYLTFRAVMATITALGIGLVCGPWVI
FT                   RKLTQMKVGQAVRKDGPQTHLVKSGTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLV
FT                   TFGFGVIGWVDDYRKVVHKDPRGMSSREKYFWQSVIGLFAAVYLAFSVSEANNVRVFDL
FT                   FMAWVRSGLSMGLPARADLMLPFLKSISYPLGVWGFIVLTYFVIVGASNAVNLTDGLDG
FT                   LVIMPVVLVGASLGVFAYVMGSAVYSKYLLFPHIPGAGELLIFCSAMGGAGLAFLWYNT
FT                   HPAQVFMGDVGALALGGALGTVAVIVRQEIVLFIMGGIFVAETLSVMLQVSWFKYTKKR
FT                   YGEGRRLLKMAPLHHHFELSGWKETQVVVRFWIITLMLCLFGLTTLKLR"
FT   gene            626571..628082
FT                   /locus_tag="Bcen2424_0557"
FT   CDS_pept        626571..628082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0557"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   bcn:Bcen_0075 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07311"
FT                   /db_xref="GOA:A0K484"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K484"
FT                   /protein_id="ABK07311.1"
FT                   /translation="MFGDRQRPMVLVLGLGESGLAIARWCARHGCRLRIADTREAPPNL
FT                   AALQAEGIDAEFVGGAFTPALLDGGVEIVGLSPGLSPLEPALAALVAAANERGVAVWGE
FT                   LEFFAQALRALGTSGYQPKVLAITGTNGKTTTTSLTGLLCQRSGKKVAVAGNISPAMLD
FT                   RLASAIDETALPDVWVLELSSFQLETARTFAPDAAAILNITQDHLDWHGSFDAYAQAKG
FT                   RIFGATTTRVLNRDDAAVMKFAPAVAAADAPRTVTFGLNEPTQDGDYGLSRDNGIAWLV
FT                   EAVDRDAPDEATTTRRRKRDAAHTPDIAQKRLMPADALRIRGLHNAANALAAFALARAI
FT                   DLPAAPLLHALREYRGEAHRVEVIATIDDVDYVDDSKGTNVGATVAALDGLAQKIVLIA
FT                   GGDGKGQDFAPLVAPVARWCRAVMLIGRDAPVIRDTLAETGVPLADHATLEAAVHAAAE
FT                   LAEPGDAVLLSPACASLDMFRNYAHRAEVFRAAVDAIAIDKGATP"
FT   gene            628079..629362
FT                   /locus_tag="Bcen2424_0558"
FT   CDS_pept        628079..629362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0558"
FT                   /product="cell division-specific peptidoglycan biosynthesis
FT                   regulator FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: bcn:Bcen_0076 cell division protein
FT                   FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07312"
FT                   /protein_id="ABK07312.1"
FT                   /translation="MSWSDRLVSRFNDRRDTGGNAAGGRVASATRAATGGLASVVNGVR
FT                   PSRSRMLDFDYSLLWVAIALLGLGVVMVYSASIAMPDSPKYASYHDYAFLMRHCVSLTV
FT                   AFIAAVLAFRVPVSTWDKYAPHLFLIALVGLVIVLIPHVGKGVNGARRWIPLGITNMQP
FT                   SEIMKLAVTIYAANYTVRKQEYMQSFAKGFLPMAFAVGLVGALLLLEPDMGAFMVVAAI
FT                   AMGVLFLGGVNGKLFGGLVATAVGTFTMLVWLSPWRRERIFAYLDPWDERYAQGKAYQL
FT                   THSLIAFGRGEWFGVGLGGSVEKLNYLPEAHTDFILAVIGEELGFIGVLVVILLFYWIV
FT                   RRAFEIGRQALALDRTFAGLMAKGIGIWFGAQTFINMGVNLGLLPTKGLTLPLVSYGGS
FT                   GILLNCVALAVLLRVDYENRVLMRGGKV"
FT   gene            629359..630462
FT                   /locus_tag="Bcen2424_0559"
FT   CDS_pept        629359..630462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0559"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: bcn:Bcen_0077
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07313"
FT                   /db_xref="GOA:A0K486"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K486"
FT                   /protein_id="ABK07313.1"
FT                   /translation="MTASQRTLMVMAGGTGGHVFPGLAVAHRMEAAGWRVVWLGNPAGM
FT                   EATLVPKHGIPMEYVRFGGLRGKGLKTKLTLPVNLLRACWQSLGALRRVRPDVVLGMGG
FT                   YITFPAGVMTALSGRPLVLHEQNSIAGLTNKVLAKLAKRVLVAFPGALPHAEWTGNPIR
FT                   AELAHTEPPHARYASRSGPLNVLVVGGSLGAAALNEVVPRALALLAPGERPRVVHQAGV
FT                   KHIEALKANYEAAGFAAGEDVRLVPFIDDMAAAYAAADLVICRSGAMTVSEIAAVGVAA
FT                   LFVPFPYAVDDHQTTNAAFLAEAGAAVLVQQRDLSAELLADWLRGQSRASLADMAERSR
FT                   ALAKPEATDEVARVCAKAAGANLETLQ"
FT   sig_peptide     629359..629439
FT                   /locus_tag="Bcen2424_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.687 at
FT                   residue 27"
FT   gene            630459..631856
FT                   /locus_tag="Bcen2424_0560"
FT   CDS_pept        630459..631856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0560"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: bcn:Bcen_0078
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07314"
FT                   /db_xref="GOA:A0K487"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K487"
FT                   /protein_id="ABK07314.1"
FT                   /translation="MKHIVKHIHFVGIGGAGMSGIAEVLVNLGYAVSGSDLSRNAVTDR
FT                   LEALGARIAIGHDAANIEGANAVVVSTAVRSDNPEVLAARHQGVPIVQRAVMLAELMRL
FT                   KQGIAIAGTHGKTTTTSLVASVLAAGGLDPTFVIGGRLISAGANARLGTGDFIVAEADE
FT                   SDASFLNLYPVIEVITNIDADHMDTYGHDFARLKQAFIEFTQRLPFYGSAVVCVDDPNV
FT                   RQIIPFISKPVVRYGLSPDAQVRAEDIDARDGRMHFTVIREGRAPLAVVLNMPGLHNVQ
FT                   NALAAIAIATDLGVSDDAIQLALAEFNGVGRRFQRYGEVPSADGGQYTLIDDYGHHPVE
FT                   MAATIAAARGAFPGRRLVLAFQPHRYTRTRDCFDDFVNVLSTVDALVLTEVYAAGEAAI
FT                   PTASGDALSRALRAVGKVDPVFVATVDDVPDALAKVAQNGDVVITMGAGSIGGVPAKLV
FT                   QHIQQKA"
FT   gene            631858..632799
FT                   /locus_tag="Bcen2424_0561"
FT   CDS_pept        631858..632799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0561"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: bcn:Bcen_0079 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine--D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07315"
FT                   /db_xref="GOA:A0K488"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K488"
FT                   /protein_id="ABK07315.1"
FT                   /translation="MSGIDPKRFGKVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAH
FT                   PFDPAERPLSALKDEGFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDK
FT                   FRTKLVWQQTGVPTPPFETVMRGDDLAARATDIVAKLGLPLFVKPASEGSSVAVLKVKT
FT                   ADALPAALAEAATHDKIVIVEKSIEGGGEYTACIAGDLDLPLIKIVPAGEFYDYHAKYV
FT                   ADDTQYLIPCGLPAEQETELKRIARRAFDVLGCTDWGRADFMLDAAGNAYFLEVNTAPG
FT                   MTDHSLPPKAARAVGIGYSELVVKVLSLTLND"
FT   gene            632819..633571
FT                   /locus_tag="Bcen2424_0562"
FT   CDS_pept        632819..633571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0562"
FT                   /product="Polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein, FtsQ-type;
FT                   KEGG: bcn:Bcen_0080 polypeptide-transport-associated,
FT                   FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07316"
FT                   /protein_id="ABK07316.1"
FT                   /translation="MWNNVRQLNLAASALYALLLLVLAAAGCYWLIQRPTFALREIRID
FT                   GDTEHINSPTVRAGVVGRLKGNFFTVDLDTARAAFEQMPWVRHASVRRVWPNALAVTLE
FT                   EYKPLGTWGSDQLVSVDGELFTANQGELEQELPAFDGPEGSAKEVVTRYRDFGKWFAPL
FT                   KAAPEEVTLSARYAWTVKLSNGMQVELGKERNSDTLHDRSQRLVAAWPAVTERWGNDIE
FT                   YADLRYPNGFAIRAAGMRFLTDTDKRKK"
FT   sig_peptide     632819..632893
FT                   /locus_tag="Bcen2424_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.491 at
FT                   residue 25"
FT   gene            633598..634830
FT                   /locus_tag="Bcen2424_0563"
FT   CDS_pept        633598..634830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0563"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   bcn:Bcen_0081 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07317"
FT                   /protein_id="ABK07317.1"
FT                   /translation="MSKDYKDLLVSLDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGL
FT                   KKGVVVNIEATVQSIQRALEEAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVT
FT                   QTDVARVIETAKAINIPTDQQVLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGA
FT                   VSAAQNIVKCVRRCGLEVNDLILQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAE
FT                   GAIRHTAVIPIAGDQITSDIAMALRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGE
FT                   RGPRTLSRQALAAVIEPRVEELFSLVQQVVRESGYEELLSSGVVITGGASMMPGMVELG
FT                   EDIFLKPVRIGAPEYAGGLSDVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQSGNAGQVF
FT                   SRMKEWFLSNF"
FT   gene            634943..636139
FT                   /locus_tag="Bcen2424_0564"
FT   CDS_pept        634943..636139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0564"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   bcn:Bcen_0082 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07318"
FT                   /protein_id="ABK07318.1"
FT                   /translation="MEFEMLETETNGTIIKVVGVGGAGGNAVQHMINRGVQGVDFIVMN
FT                   TDAQALSRSRASSVIQLGNTGLGAGAKPEMGRAAAEEARERIADALRGAHMVFITAGMG
FT                   GGTGTGAAPVVAQIAKEMGILTVGVVSKPFEFEGGKRMRVAEAGSQQLEDHVDSLIVVL
FT                   NDKLFDVMGDDAEMDKCFQCADDVLNNAVAGIAEIINVDGLVNVDFEDVKTVMGEQGKA
FT                   MMGTATVAGVDRARLAAEQAVASPLLEGVDLSGARGVLVNITSSRSLRLSETREVMNTI
FT                   KSYAAEDATVIFGAVYDDAMGDALRVTVVATGLGRAAKKQQSAPMTLLRTGTDNQPVSA
FT                   VSHGYAQPHHVSTADYGALDTPAVWRNSRETAASHVQALQEKGVDTYDIPAFLRKQAD"
FT   gene            636329..636835
FT                   /locus_tag="Bcen2424_0565"
FT   CDS_pept        636329..636835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0565"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bcn:Bcen_0083 redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07319"
FT                   /protein_id="ABK07319.1"
FT                   /translation="MIQVGDALPDAQLFEFIDDAREGCTLGPNAYSVRDQVAGKRVVIF
FT                   GLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWCVSVNDAFVMGAWGRDLHTAGKVRM
FT                   MADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVEAPGKFEVSDAASVL
FT                   ATLTS"
FT   gene            637076..637993
FT                   /locus_tag="Bcen2424_0566"
FT   CDS_pept        637076..637993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0566"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: bcn:Bcen_0084 UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07320"
FT                   /db_xref="GOA:A0K493"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K493"
FT                   /protein_id="ABK07320.1"
FT                   /translation="MLKQRTIKSIVKTVGIGVHSGRKIELTLRPAAPGTGIVFSRVDLP
FT                   TPVDIPASAMSIGDTRLASVLQKDGVRVSTVEHLMSACAGLGIDNLYVDVTAEEIPIMD
FT                   GSAATFVFLIQSAGIEEQNAPKRFIKVTKPVEIRDGDKFARLDPYFGFKLKFSIDFRHP
FT                   AVDKTGQELEVDFATTSYVREIARARTFGFAHEAEMLREIGLARGGSMDNAIVLDEYRI
FT                   LNNDGLRYDDEFVKHKMLDAIGDLYVIGHPLLASYTAYKSGHGLNNALLRELLAHEDAY
FT                   EIVTFDDPQAAPKGFAFDAQTAFA"
FT   gene            638112..639137
FT                   /locus_tag="Bcen2424_0567"
FT   CDS_pept        638112..639137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0567"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bcn:Bcen_5872
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07321"
FT                   /protein_id="ABK07321.1"
FT                   /translation="MDTVSLIGVDLGKHCFHLHGQDASGRMVFRKKLTRSQMFTLLGNF
FT                   PSCTVVMEACAGAHWIARRLQALGHEAKLISPQFVKPFRQGNKNDFADAQAICEAASRP
FT                   SMRFVSPHNEAQQIVSALHRVRGGLVRERTGTINQIHAFLLEFGISLPRGMAVIRRLPA
FT                   VLEAESLPPRLVSVIERLHAHCKYLDEQIHQLERELLTQLHEDERSERLLEIPGIGPMT
FT                   ASVLMSELGDARQYGSARQFAASVGLVPRQYSTGGKPTLLGISKRGDKELRRLLVQCAR
FT                   TIMQRIEHRTDALGVWIRGLLARRHSNVVACALANKLARIAWAILAKGTHYRSTEAVPA
FT                   V"
FT   gene            complement(639433..639909)
FT                   /locus_tag="Bcen2424_0568"
FT   CDS_pept        complement(639433..639909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07322"
FT                   /protein_id="ABK07322.1"
FT                   /translation="MNRFSKRFGPLAAYRPQPVSEVLGRTDAFAALRAGVEQIASLQRD
FT                   LGACLPDYLANHVEPGFIKDGTLTLFAAHNALAARLRQVEVRLLGDLQKRGWPVTTLRV
FT                   RVRPKDAPEPPHVKQARMTSAGAAALRDLADHLEPSPLQAALARMAARHGAKPR"
FT   gene            640166..642964
FT                   /locus_tag="Bcen2424_0569"
FT   CDS_pept        640166..642964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0569"
FT                   /product="protein translocase subunit secA"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; KEGG: bcn:Bcen_0087
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07323"
FT                   /db_xref="GOA:A0K496"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K496"
FT                   /protein_id="ABK07323.1"
FT                   /translation="MTTGFLQKIFGSRNQRLVKQYQKTVATINALETQIEKLTDDQLRG
FT                   KTDEFRQRVAAGESLDKLLPEAFAVCREASRRVLKMRHFDVQMIGGMVLHYGKIAEMRT
FT                   GEGKTLVATLPVYLNALAGRGVHVVTVNDYLAQRDAEWMARLYNFLGLSVGINLSGMEH
FT                   DQKQQAYAADITYGTNNEFGFDYLRDNMVYETDARVQRALNFAVVDEVDSILIDEARTP
FT                   LIISGQAEDHTELYVRMNALPPLLERQIGEEKADGTGVEKPGDYTLDEKARQVFLTESG
FT                   HEKAERLLAEWGLIGEGESLYAPQNITLMHHVYAALRAHTLFHKDQHYVVQNGEVVIVD
FT                   EFTGRLMAGRRWSDGLHQAVEAKEHVKIQSENQTLASITFQNYFRMYAKLAGMTGTADT
FT                   EAYEFNEIYGLETVVIPTNRPPKRIDKQDQIYKTAKERYDAVIRDIRDCYERGQPVLVG
FT                   TTSIENSELLSHLLKQAGLPHEVLNAKQHEREAAIVAEAGRPKRITIATNMAGRGTDIV
FT                   LGGNAEKQAAFIEADDAIPADEKARRIQKLHDEWETLHEEVKAAGGLHIIGTERHESRR
FT                   IDNQLRGRAGRQGDPGSSRFYLSLDDPLLRIFAGDRVRSIMDRLKMPEGEAIEAGIVTR
FT                   SIESAQRKVEARNFDIRKQLLEYDDVSNDQRKVIYQQRNELLEAHDITETITAMRHGVI
FT                   TEVVRQFVPEGSIEEQWDVPELEEALRNDWQLDLAIQEMVNESSSITAEEILDAVMTAA
FT                   DEQYEAKVAMVGRESFSAFERSVMLQTVDRLWREHLAALDHLRQGIHLRGYAQKNPKQE
FT                   YKREAFELFAAMLDAIKQEVTRIVMNVQIQSPEQLEEAAEQIEERGGHLENVEYQHADY
FT                   ADAGAPVANVTAAAAATATADMVGSAMTHSGPGGEMPKVGRNDPCPCGSGKKYKQCHGK
FT                   LS"
FT   gene            643109..644350
FT                   /locus_tag="Bcen2424_0570"
FT   CDS_pept        643109..644350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0570"
FT                   /product="glutamate N-acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /note="KEGG: bcn:Bcen_0088 arginine biosynthesis
FT                   bifunctional protein ArgJ; TIGRFAM: arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07324"
FT                   /protein_id="ABK07324.1"
FT                   /translation="MAVNFPSIDPAQLHPVAGVTLGWAEANIRKPNRKDVLVISVDEGA
FT                   TVAGVFTENRFCAAPVTVCREHLAKVRAGGAGIRALVVNTGNANAGTGEPGLVNARETC
FT                   TELARLAGIEPAQVLPFSTGVILEPLPIDRLKAGLPAALANRKAANWFDAAQAIMTTDT
FT                   LPKATSRQVTIEGHTVTLTGISKGAGMIKPNMATMLGFLAFDANVAQPVLDTLVKEVAD
FT                   RSFNCITIDGDTSTNDSFILIASGKSTLPAITSTDSPAYAALRDAVTEVAQVLSQLIVR
FT                   DGEGATKFMTVQVEGGKSVAECRQIAYAIGHSPLVKTAFYASDPNLGRILAAIGYAGVA
FT                   DLDVGKIDLYLDDVLVAKAGGRNPAYQEEDGQRVMKQSEITIRVLLGRGDAQATVWTCD
FT                   LSHDYVSINADYRS"
FT   gene            644370..645239
FT                   /locus_tag="Bcen2424_0571"
FT   CDS_pept        644370..645239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0571"
FT                   /product="protein of unknown function DUF815"
FT                   /note="PFAM: protein of unknown function DUF815; SMART: AAA
FT                   ATPase; KEGG: bcn:Bcen_0089 protein of unknown function
FT                   DUF815"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07325"
FT                   /protein_id="ABK07325.1"
FT                   /translation="MDKLEQFLTRAEALLGRLEGMLPPAPAAIDWNAAHAFRWRKRQGR
FT                   GYLQPVPAVSSITLGDLHNIDRQKALIDQNTRQFVQRKPANNVLLTGARGTGKSSLIKA
FT                   CLNAYANDGLRLIEVDKDDLHDLGDIVDLISQRPERFIVFCDDLSFEDGESGYKALKVA
FT                   LDGSIAAQSDNVLIYATSNRRHLLPEYMSDNESYKHLPDGEIHPGEVVEEKISLSERFG
FT                   LWVSFYPFKQDDYLDIVAHWLRHFGCPETEIETARGDALVWALERGSRSGRVAWQFARD
FT                   WSGRKEQA"
FT   gene            645236..645679
FT                   /locus_tag="Bcen2424_0572"
FT   CDS_pept        645236..645679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0572"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bcn:Bcen_0090 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07326"
FT                   /protein_id="ABK07326.1"
FT                   /translation="MSADLAQGAVRAPDGRKVTEVAVGVMVQPDGRYLLAQRLQGKPYE
FT                   GYWEFPGGKLEAGESVEDALARELHEELGIEVTASHRWHTLEHDYPHAYVRLYFCKVTG
FT                   WTGEPHSKEGQAFVWQQLPVEVAPLLPAALPVLELLEKEAASQ"
FT   gene            complement(645740..645940)
FT                   /locus_tag="Bcen2424_0573"
FT   CDS_pept        complement(645740..645940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0573"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   bcn:Bcen_0091 protein of unknown function DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07327"
FT                   /protein_id="ABK07327.1"
FT                   /translation="MTTVVKCPSCGAEVRWTPENKFRPFCSARCKQLDLGAWAAEKYRI
FT                   GGASDEGPSSEEDGTDNRRDS"
FT   gene            complement(645969..646724)
FT                   /locus_tag="Bcen2424_0574"
FT   CDS_pept        complement(645969..646724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0574"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="PFAM: protein of unknown function DUF1342; KEGG:
FT                   bcn:Bcen_0092 protein of unknown function DUF1342"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07328"
FT                   /db_xref="GOA:A0K4A1"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4A1"
FT                   /protein_id="ABK07328.1"
FT                   /translation="MILYEYPFNERIRTLLRLEDLFERFAFFLAQEDPREHHVALTTLF
FT                   EIAEVTGRADLKSDLMKELERQRQTLAPFRGNPGIEQNALEAVLGEIEQTLANLAQMQG
FT                   KTGQHLVDNEWLASIRSRAVIPGGTCKFDLPSYYAWQQWPAEQRRQDIAKWMLPMLPLR
FT                   DAAAIVLRLARESGQASKVMAMQGSYQQMLSGRSYQLMQVRVPPELRVIPEASANKYML
FT                   WVRFTMQDGDVRPRAVDIDVPFHLTLCNL"
FT   gene            complement(646834..647442)
FT                   /locus_tag="Bcen2424_0575"
FT   CDS_pept        complement(646834..647442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0575"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: bcn:Bcen_0093 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07329"
FT                   /protein_id="ABK07329.1"
FT                   /translation="MFSVGLTGGIGSGKTTVADLFGARGASLVDTDLIAHRITAPGGLA
FT                   MPAIEQAFGHGFVAADGSLDRAKMRTLIFSDDDARRRLEAITHPLIRAETDREAREARG
FT                   PYVMFVVPLLVESGTWKARSNRVLVVDCPVETQIARVMRRNGFTREQVEAIIARQATRE
FT                   ARLAAADDVIVNDAVTPDALAAQVDALHQRYVGFAAAAH"
FT   gene            complement(647444..648355)
FT                   /locus_tag="Bcen2424_0576"
FT   CDS_pept        complement(647444..648355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0576"
FT                   /product="type 4 prepilin peptidase 1, Aspartic peptidase,
FT                   MEROPS family A24A"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; peptidase
FT                   A24A domain protein; KEGG: bcn:Bcen_0094 prepilin
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07330"
FT                   /protein_id="ABK07330.1"
FT                   /translation="MTPVPLSTVSDSPEGTLLALAMLPPALQYAFAVVIGLCIGSFLNV
FT                   VVHRLPVMMQRAWQAEIAEATGAAGAPPDDGYPPRYDLWRPRSACPHCGHVLRAWENIP
FT                   LLSYLMLRGRCRRCGHAIGIRYPLVELACALLAAGSLAAFGPTVAAFAAFALCAALLAM
FT                   SAIDIRTGYLPDSMTLPLLWAGLVLNLGGTFTSLRSAVIGAMAGYLFLWSIYWLFKWLR
FT                   GIEGIGFGDLKLLAALGAWMGWAALPQVVLFAAVTGAVVGLVATWRGRMRFEEPIPFGP
FT                   FLAAGGVATLFFGTPFYAALGG"
FT   gene            complement(648400..649611)
FT                   /locus_tag="Bcen2424_0577"
FT   CDS_pept        complement(648400..649611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0577"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bcn:Bcen_0095 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07331"
FT                   /protein_id="ABK07331.1"
FT                   /translation="MSMRTPPRETRFAWRGRRRDGSPRRGTVIAFDAAAARATLAREGI
FT                   AVLSLDVRGPARPPAAAARDITRFTRQLASLLQAGLPLAPSLEMLARTRTRDGVPRIAA
FT                   GLAREIVGGRRFADALARYPSQFGTLYRQLIEVGEASGSLGIVLTRVAEHRERADAQWR
FT                   KLRAALAYPAAVILFALAISAALMVWVVPTFRQIFDGFGAALPAPTRALLALSSALSAW
FT                   GGVFLAGAAATGLAAQHALRRSAALRHVLARRLLRAPLAGSALERFAAARWCRSLATLL
FT                   GAGVPLADAFATLERTAGHPVFAHATAHIAARVLRGVRLADAMHSAGCFPDDVVQPIAV
FT                   AEETGALDTMLADIAALCERQLDARLDTLAALGEPLIVIVLGALVGGLVIAMYLPILQL
FT                   GNVV"
FT   gene            complement(649608..650894)
FT                   /locus_tag="Bcen2424_0578"
FT   CDS_pept        complement(649608..650894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0578"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase; KEGG: bcn:Bcen_0096 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07332"
FT                   /protein_id="ABK07332.1"
FT                   /translation="MPAHMHFPSPGAPLHTQSPPAHSDAPAAAPHALDAAQLDDAPAVR
FT                   LLTDTLHAARVRDASDIHVEPFEAGWRIRLRIDGVLHEHARPPLHLRDALVTRIKVLSR
FT                   MDIAERRLPQDGRLRIAIDGGTRGDYRVSSLPTLFGEKLVLRRLETLPPDLTLANLGFD
FT                   ARQAAAMEAAIRAPHGLVLVTGPTGSGKTLSLYCALQMLDRDAHNVCTVEDPAEIQLDG
FT                   INQVGVADKAGLTFATALRALLRQDPDVIMVGEIRDAETADVAIKAAQTGHLVLSTLHT
FT                   NDAPAAVARLLDIGVAPYNLAAALHLVTAQRLVRRLCVACRVHSDASAHALREAGCDPA
FT                   ALAAGWRPFVARGCSACHGIGYRGRIGLHQTMPVSPGLAERIVARASVGELAQCVAAEG
FT                   VRSLRDAAFARVLDGTTSIAEAVAATPAA"
FT   gene            complement(650966..652339)
FT                   /locus_tag="Bcen2424_0579"
FT   CDS_pept        complement(650966..652339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0579"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: bcn:Bcen_0097 protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07333"
FT                   /protein_id="ABK07333.1"
FT                   /translation="MYRARHIAVAGLCYISPIPVLHCPFQRVDQIPLWAQIGAVFLLLL
FT                   CSSFFSISETAMMALNRHRLKHLAGQGALGAKTTQGLLTRTDLLLSVILIGNNLFNTII
FT                   PVLTTSLALHTFGRNNLALSIATGVVAFLIIVFAEIAPKIVGATFPERIALPASLVIAP
FT                   LMRVFKPVVWFVNALANGVLWVLRINTKKGRDQRMSADELRAIVLESSSFMPTKHRSIL
FT                   LNLFDLENITVDDVMVPRRQIESLNFYAPLDDILHQLETCYHNRLVVYEGDIDKVLGVL
FT                   HVRKTLTGLHNQDFDRETLRALLAEPYYVPSGTPVVQQLQFFQETRQRTALVVNEYGEL
FT                   EGLVTPEDIIEELIGEFTTSMPRSERAGGWDENGECIVSASMPLRELNRWLHLKLPTDG
FT                   PKTLNGLVLEILEEIPEDDVCLKIGDVMLEVMRSDDQAVRTVKLFKPRGTRTGRTATR"
FT   gene            complement(652399..652475)
FT                   /locus_tag="Bcen2424_R0021"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(652399..652475)
FT                   /locus_tag="Bcen2424_R0021"
FT                   /product="tRNA-Pro"
FT   gene            complement(652624..653619)
FT                   /locus_tag="Bcen2424_0580"
FT   CDS_pept        complement(652624..653619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0580"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: bcn:Bcen_0098
FT                   trans-hexaprenyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07334"
FT                   /protein_id="ABK07334.1"
FT                   /translation="MSSSTASPTLSAAHLLAPITSDMEQVNRVIRQSLASDVLLINQIA
FT                   EYIIGAGGKRLRPALLLLVAGALGETSHQRHVLAAVVEFIHTATLLHDDVVDESELRRG
FT                   RQTANALFGNAASVLVGDYLYSRSFEMMVGVGKMRVMEILSEATTIISEGEVLQLLNMH
FT                   DADVDETRYMQVIRYKTAKLFEASARLGAVLAGADAPTEAAAAEYGRRIGTAFQIMDDW
FT                   LDYAGTAEAMGKNAGDDLREGKPTLPLIYLIERGTPEQSALAREAIEQGGTDRFDTIFE
FT                   AITRSGALDHTLECARQEAQAAAAAIAAFPDSIYKESLLGLCSYSTSRQS"
FT   gene            653830..654141
FT                   /locus_tag="Bcen2424_0581"
FT   CDS_pept        653830..654141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0581"
FT                   /product="LSU ribosomal protein L21P"
FT                   /note="PFAM: ribosomal protein L21; KEGG: bcn:Bcen_0099
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07335"
FT                   /db_xref="GOA:A0K4A8"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4A8"
FT                   /protein_id="ABK07335.1"
FT                   /translation="MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGEGE
FT                   SIKFGTPLVSGASVKATVVSHGRHAKVTIFKMRRRKHYQKHGGHRQNYTELRIDAINA"
FT   gene            654166..654429
FT                   /locus_tag="Bcen2424_0582"
FT   CDS_pept        654166..654429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0582"
FT                   /product="LSU ribosomal protein L27P"
FT                   /note="PFAM: ribosomal protein L27; KEGG: bcn:Bcen_0100
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07336"
FT                   /db_xref="GOA:A0K4A9"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4A9"
FT                   /protein_id="ABK07336.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKVYGGQAINAGGIIVRQRGTRM
FT                   HAGENVGMGKDHTLFALVDGHVKFATKGADKKHLVIVVPAAA"
FT   gene            654616..655728
FT                   /locus_tag="Bcen2424_0583"
FT   CDS_pept        654616..655728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0583"
FT                   /product="GTP1/OBG sub domain protein"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; GTP1/OBG
FT                   sub domain protein; KEGG: bcn:Bcen_0101 GTP1/OBG subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07337"
FT                   /db_xref="GOA:A0K4B0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4B0"
FT                   /protein_id="ABK07337.1"
FT                   /translation="MKFIDEARIEVIAGDGGDGSASMRREKFVPFGGPDGGDGGRGGSV
FT                   YAIADRNINTLIDYRYAKKHLARNGENGRGSDCYGKGGDDVTLRMPVGTIISDMDTGEL
FT                   IADLTEHDQQVMLAQGGAGGLGNLHFKSSTNRAPRQKTDGKPGERRMLKLELKVLADVG
FT                   LLGMPNAGKSTFISSVSNAKPKIADYPFTTLAPNLGVVRVGPSKSFVIADIPGLIEGAA
FT                   EGAGLGHQFLRHLQRTGVLLHLVDLAPFDESVDPVAEATAIVGELRKYDEALYEKPRWL
FT                   VLNKLDMVPEDEREARVADFLDRFGWDGPVFEISALTGQGCEALCYAIYDYLSEHSDAH
FT                   RAAEAEDLAADVRFRDAPPAKGGATPGDDA"
FT   gene            655818..656936
FT                   /locus_tag="Bcen2424_0584"
FT   CDS_pept        655818..656936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0584"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: bcn:Bcen_0102 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07338"
FT                   /db_xref="GOA:A0K4B1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4B1"
FT                   /protein_id="ABK07338.1"
FT                   /translation="MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQ
FT                   GKEVVLVSSGAIAEGMQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFTEHGIRTAQ
FT                   ILLTHADLADRERYLNARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANL
FT                   IEGDALIILTDQSGLFTADPRKDPNATLVGEANAGAPELEAMAGGAGSSLGRGGMLTKI
FT                   LAAKRAAHSGANTVIASGREADVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQVRG
FT                   HVVIDAGAVEKLTAGGKSLLPIGVIDVQGAFARGEVIACVGPDGREVARGLTNYSSAET
FT                   KLIHRKPSGEIETVLGYMLEPELIHRDNLVLV"
FT   gene            complement(657031..657639)
FT                   /locus_tag="Bcen2424_0585"
FT   CDS_pept        complement(657031..657639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07339"
FT                   /protein_id="ABK07339.1"
FT                   /translation="MTGRDLGVAPFFYEECILKAIALALASIAAMAALAGCANSKAPSN
FT                   KDDSEFVYLLDRQGTWKENAVDTLPPLPQTGDLLPFNVSQNTPLKFFVDAKSLEVGTDG
FT                   VVRYAVVITSPAGARNVNYEGIRCDTYEWRQYAGLNSDHNGWDRTVENDWRRIENGELN
FT                   AYHSALYQDYFCSNKMPQGSTRQILENIRFHRTAMTQLR"
FT   gene            complement(657653..658297)
FT                   /locus_tag="Bcen2424_0586"
FT   CDS_pept        complement(657653..658297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0586"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bcn:Bcen_0104 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07340"
FT                   /db_xref="GOA:A0K4B3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4B3"
FT                   /protein_id="ABK07340.1"
FT                   /translation="MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGET
FT                   PMQAMYRELHEETGLHPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRM
FT                   VGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRAE
FT                   KPRGPRVSRYPRVIGAQAQTLTIVDTSVVCSEIEVEASTLDEMPPHVIVGK"
FT   gene            658526..660262
FT                   /locus_tag="Bcen2424_0587"
FT   CDS_pept        658526..660262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0587"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; YbaK/prolyl-tRNA synthetase associated
FT                   region; KEGG: bcn:Bcen_0105 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07341"
FT                   /db_xref="GOA:A0K4B4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4B4"
FT                   /protein_id="ABK07341.1"
FT                   /translation="MKASRFFIGTLKEAPADAEIVSHKLMVRAGMIRRVAGGIYNYLPV
FT                   GLRSIRKVEAIVREEMNRAGAIELLMPAVQPAELWQESGRWEQYGPELLRFKDRKDNDF
FT                   VIGPTHEEVVTDIARNQIKSYRQMPVNFYQIQTKFRDEIRPRFGVMRGREFIMKDAYSF
FT                   DKDAAGLNESYRKMYDAYVRIFTRLGLEFRAVAADSGSIGGNFSHEFHVIADTGEDAIA
FT                   YCPTSEFAANVEAAEALPLIAERAAPAEAMEKVATPGKAKCEAVAELLSIPLERTIKSI
FT                   VLATDNEGAEPTIWLVMLRGDHDLNEIKVSKLPGLKNHRFATEQEIVEWFGTPPGYLGP
FT                   VGTKKPVKVIADRTVANMSDFVVGANEVDYHIAGVNWGRDLPEPEVADVRNVKKGDPSP
FT                   DGKGVIDICRGIEVGHVFQLGTKYSEAMGATFLDESGKPQPMLMGCYGVGITRILGAAI
FT                   EQNFDDKGIIWPESIAPFEVVLCPMGYDRSDMVRETADKLYAELVAAGIDVILDDRGER
FT                   PGVMFADWELIGVPHRLVIGERGLKEGKIEYQGRRDAEATLLPADTAAAAVAEKIRAAL
FT                   AH"
FT   gene            660284..660886
FT                   /locus_tag="Bcen2424_0588"
FT   CDS_pept        660284..660886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0588"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: bcn:Bcen_0106 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07342"
FT                   /protein_id="ABK07342.1"
FT                   /translation="MEYTFLSATVLLVLITDPLGNIPLFISAMRDVPRERRVKLILREV
FT                   GIAFVILLFFMLVGDRFLRMMSLTDLSLRLGGGIVLFLIALRMIFPHPDGALGSDPRAG
FT                   GEPFIVPLAIPALAGPSALATVMLMTSQAPGKMLEWVGALTVTMIVCAITLVLAERIQQ
FT                   WLGERTVAAFERLMGLVLVAISVEMLLAGIRAFVHQL"
FT   gene            complement(660969..661520)
FT                   /locus_tag="Bcen2424_0589"
FT   CDS_pept        complement(660969..661520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0589"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: bcn:Bcen_0107
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07343"
FT                   /protein_id="ABK07343.1"
FT                   /translation="MNREEALHIFDHSEEIVSADAVNASISKMADAIRAEIGDAFPLVL
FT                   SVMGGAAVFTGMLLPHLDFPLEFDYIHLTRYRNTTQGSPEMHWRVAPRESVKDRIVLVL
FT                   DDILDEGETMAAIRDRILDMGAQRFMSAVLCEKTLAKAKPLHPDFCGFSVPDRYVFGCG
FT                   MDAKGYWRNLPTIRALTANV"
FT   gene            complement(661615..662982)
FT                   /locus_tag="Bcen2424_0590"
FT   CDS_pept        complement(661615..662982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0590"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="KEGG: bcn:Bcen_0108 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54, G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07344"
FT                   /protein_id="ABK07344.1"
FT                   /translation="MLDNLTQRMARVVKTLRGEARLTEANTQEMLREVRLALLEADVSL
FT                   PVVREFIAKVKEKALGEEVISSLSPGQALVGVVQKELTAVIGGDYEGKAAELNLAVTPP
FT                   AVILMAGLQGAGKTTTVGKLAKLLREKYKKKVLTVSCDVYRPAAIMQLKTVTEQVGADF
FT                   FPSTPDQKPVDIALAAVDWAKRHYHDVLLVDTAGRLGIDEAMMQEIAALHGTLKPAETL
FT                   FVVDAMLGQDAVNTAKAFNDTLPLTGVVLTKLDGDSRGGAALSVRHVTGKPIKFVGVAE
FT                   KLDGLEVFHPDRMANRILGMGDILALVEEAQRGVDVQAAQKLADKVKKGGDFDLNDFRA
FT                   QISQMKNMGGLSSLMDKLPAQFQQAAAGADMGQAEKSIRRMEGIISSMTPAERAKPEII
FT                   KATRKRRIAAGAGVPVQEVNRMLNQYDQMRTMMKKLKGGNMQKMMRGLKGMMPGMR"
FT   gene            663073..663966
FT                   /locus_tag="Bcen2424_0591"
FT   CDS_pept        663073..663966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0591"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   bcn:Bcen_0109 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07345"
FT                   /protein_id="ABK07345.1"
FT                   /translation="MDIVLYALTAFLYGGLAVAGWRTHRQGATSLVASVPAVPVPASAA
FT                   SGMSGAGRALLFAALLAHGVLLHMTIFPNDAMVFGFAFALSAMFWLGAGIYWIESFFFP
FT                   LDSLRLLVLPLACGASLLPLVFGGVRVLPYAAAPLFKLHFLIANIAYGLFAIAALHAVL
FT                   MLMVERRLQSLRSGGRDGSTGWIASWLETLPPLLTLEKLLFRLIGAGFVLLTLTLASGI
FT                   LFSEQVDARALRLDHKTVFAILSWLMFGGLLVARKTSGWRGRGAARWVLVSFAALLLAY
FT                   VGSRFVFEVLLHRSVV"
FT   sig_peptide     663073..663132
FT                   /locus_tag="Bcen2424_0591"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.644 at
FT                   residue 20"
FT   gene            663980..664300
FT                   /locus_tag="Bcen2424_0592"
FT   CDS_pept        663980..664300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07346"
FT                   /protein_id="ABK07346.1"
FT                   /translation="MRQILLLILLFFAGSWLARKLRHAQEQAQARTGRGAGYDEAPGAG
FT                   ASAGAARPNGDARSLPEPMVRCAECGVHAPKGDAIAASGEYFCSAEHAQRHAARVNGRD
FT                   AR"
FT   sig_peptide     663980..664054
FT                   /locus_tag="Bcen2424_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.912 at
FT                   residue 25"
FT   gene            664297..664887
FT                   /locus_tag="Bcen2424_0593"
FT   CDS_pept        664297..664887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0593"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase, family 2;
FT                   KEGG: bcn:Bcen_0111 N-acetylmuramyl-L-alanine amidase,
FT                   negative regulator of AmpC, AmpD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07347"
FT                   /protein_id="ABK07347.1"
FT                   /translation="MSDAAVLSVDANGWVREARHAPSPNFEARPAGAVPTLVIVHNISL
FT                   PPGEFGGDAIEALFLNRLDCDAHPYYQSHLRGVRVSAHFLIRRGGELVQFVSCDERAWH
FT                   AGSSEFFGRARCNDFSIGIELEGADDVPFDDAQYAVLAALSRALAARYPVDAFAGHSDV
FT                   APGRKTDPGPHFDWQRFASDAGFSAEYFPFRQH"
FT   gene            665340..668345
FT                   /locus_tag="Bcen2424_0594"
FT   CDS_pept        665340..668345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0594"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: bcn:Bcen_0112 ribonucleoside-diphosphate
FT                   reductase, alpha subunit; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; ATP-cone domain
FT                   protein; Ribonucleotide reductase large subunit, N terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07348"
FT                   /protein_id="ABK07348.1"
FT                   /translation="MQTTDNATSQYESASSRPLGGTEQGAKALAPQATFADYKVIRRNG
FT                   SVVSFEPSKIAIAVTKAFLAVNGGQGAASARVREQVEQLTHNVVRALVRSRPNGGTFHI
FT                   EDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEEAAAAGGESATGINVVDNGV
FT                   TRPLDQNALRALIVSACDGLGAAVNPDPIVAETVKNLYDGVPMSQVYDSAILAARTMIE
FT                   KDPAYSQVTARILLHTIRREILGEEVVQAEMSTRYAEYFPQFLKRGVDAGLLDDKLLQF
FT                   DLKRLGEALDANRDLQFGYLGLQTLYDRYFLHVEGTRIEMPQAFFMRVAMGLSLNEIDR
FT                   ETRAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEALKENALLS
FT                   KFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLE
FT                   SWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPSTCPDLHD
FT                   KFGADFEKAYTAYEDKVARGEIKLFKKIPAAQLWRKMLGMLFETGHPWITFKDPCNVRS
FT                   PQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQADGSYALDHDKLKRTI
FT                   SVAMRMLDNVIDINYYAVPKARNSNLKHRPVGMGIMGFQDCLHLLRTPYASQEAVEFAD
FT                   RSMEAVCYYAYHASTELAEERGRYSSYRGSLWDRGILPQDTLKLLAEARGGYVEVDTSE
FT                   SLDWTALRARIATHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTV
FT                   VNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPTWLVEAA
FT                   SRRQKWIDQAQSLNIYMGGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTVAHG
FT                   ALNAVPTGGAGSGGSSSGGAQGAAGGFGAAGGAASSGAVNAAAALAPVEADGPVCTMRP
FT                   GDPGFDECEACQ"
FT   gene            668434..668727
FT                   /pseudo
FT                   /locus_tag="Bcen2424_0595"
FT   gene            668774..669922
FT                   /locus_tag="Bcen2424_0596"
FT   CDS_pept        668774..669922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0596"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: bcn:Bcen_0113
FT                   ribonucleoside-diphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07349"
FT                   /protein_id="ABK07349.1"
FT                   /translation="MRTSAGMAVGMQAATPAAHQVRDIFEGDLAVPPQASAVPAGGTEA
FT                   RVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL
FT                   TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY
FT                   IVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVF
FT                   ACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPH
FT                   LWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLD
FT                   PLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE"
FT   gene            670005..670331
FT                   /locus_tag="Bcen2424_0597"
FT   CDS_pept        670005..670331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07350"
FT                   /protein_id="ABK07350.1"
FT                   /translation="MQSMPGALTAQRYDRHFANPSVGWANFPPEKADGRVAVRLIKRLG
FT                   VAARGAPATDLIWRARPSGHARHTVFISVSARYLRTPMNSPLRSARPEQRPREAGFDEG
FT                   CSLN"
FT   gene            670360..671007
FT                   /locus_tag="Bcen2424_0598"
FT   CDS_pept        670360..671007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07351"
FT                   /protein_id="ABK07351.1"
FT                   /translation="MATAKKKPAAKKVAAKKTVAKKAAAPAKKAAVKKVAAKKVAVKKV
FT                   AAKKAAPAKKAAAKKVAAKKVATKKVAAKKVAAKKVAVKKVAAKKAAPAKKAAAKKVAA
FT                   KKVAVKKVAAKKAAPAKKAAAKKAAPAKKAAAKKAAPAKKAAAKKAAPAKKAAPAKKAA
FT                   APAKKAAAPKKAVVKKAAPATTASTASVAPASGVKTALNPAAAWPFPTGSRP"
FT   gene            complement(671235..671708)
FT                   /locus_tag="Bcen2424_0599"
FT   CDS_pept        complement(671235..671708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0599"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: bcn:Bcen_0116 17
FT                   kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07352"
FT                   /protein_id="ABK07352.1"
FT                   /translation="MLTKKTLTLAAMLTATLTLAGCFTAPGSADVYSVGQAQREQTVRM
FT                   GTVESVRAVRIQSDGGGSAIGTLGGGALGAVAGSAIGGGKGSILTAIAGGLVGAVAGNA
FT                   VGENLSTANGVEITVRLDNGDLRSITQAASGEAFRAGERVRLLSSGGVTRVTH"
FT   sig_peptide     complement(671619..671708)
FT                   /locus_tag="Bcen2424_0599"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.908 at
FT                   residue 30"
FT   gene            complement(671728..672666)
FT                   /locus_tag="Bcen2424_0600"
FT   CDS_pept        complement(671728..672666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0600"
FT                   /product="Adenosine kinase"
FT                   /EC_number="2.7.1.20"
FT                   /note="PFAM: PfkB domain protein; KEGG: bcn:Bcen_0117
FT                   adenosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07353"
FT                   /protein_id="ABK07353.1"
FT                   /translation="MATLICGSIAYDSIMTFEGRFREHILPDQVHLINLSFLVPTMRRE
FT                   FGGCAGNIGYALHLLGGDARIMGTMGALDAQPYLDRLDQLGLRRDHVRVLPDTYTAQAM
FT                   ITTDLDNNQIAAFHPGAMMQSHLNHAGDAPDIKLAIVGPDGFDGMVQHVEELAKAGVPF
FT                   VFDPGQGLPLFDGATLRRSIELATYVAVNDYEAKLVSDKTGWSEDEIASRVDALVITRG
FT                   EHGAIIRHKQGAEQIPVVPAERIADPTGCGDAFRGGLLYGIEHGLDWATTGRLASLMGS
FT                   LKIAHQGPQTYVLTRAEIDARFETAFGYSLK"
FT   gene            complement(672752..673255)
FT                   /locus_tag="Bcen2424_0601"
FT   CDS_pept        complement(672752..673255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0601"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /note="PFAM: Redoxin domain protein; KEGG: bcn:Bcen_0118
FT                   redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07354"
FT                   /protein_id="ABK07354.1"
FT                   /translation="MSKVTLGGNPIDLAGTFPAVGAQAADFKLVGKDLADLSLASFAGK
FT                   RKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVIVVSADLPFAATRFCTTEGLANVVT
FT                   ASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAELVGEIKDEPNYDAAL
FT                   AALK"
FT   gene            complement(673327..674727)
FT                   /locus_tag="Bcen2424_0602"
FT   CDS_pept        complement(673327..674727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0602"
FT                   /product="MJ0042 family finger-like protein"
FT                   /note="TIGRFAM: MJ0042 family finger-like protein; KEGG:
FT                   bcn:Bcen_0119 zinc finger/thioredoxin putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07355"
FT                   /protein_id="ABK07355.1"
FT                   /translation="MLLATRCPHCETVFRLQQEQLSLHQGLVRCGHCHEVFNAAESLVP
FT                   EYAQQPEPALTEPAAAPDSSDTHQQAAPARLFATDTPPELPTGTDYKPEGWDMWAPWLD
FT                   AGVDPSLQHSVETVRTEPLIPLALPSTEAGVVHLSGTPAPFASSPAELDSSTAVEQPAE
FT                   LHSPQAQHAPHETEETAPSPAPLERDPREPRFVAHLPSETETAAEPAEPVVPTHFAAPD
FT                   DERAPREPRFAFTPAPAVTEAETASEPGTFARHDTAPPAAAADEPVAQPAVPPVVQPAV
FT                   PFPAALSDDDRPHFAVTRETRAPQRRGMLGGFFGGLVAAALVGLLAAQLAWWQRETLMI
FT                   YWPVTQGWFRQACAPLGCTVTPPRAIDGLRLDATDLRQLDGPRELELKVPLTNRYRVAL
FT                   AYPSVELTLLDDTNHVTVRRVLAPRDYVRPGTPIDAGLPPGTTQTMVVRLETNGTPASN
FT                   FRVQIFYP"
FT   gene            complement(674773..675675)
FT                   /locus_tag="Bcen2424_0603"
FT   CDS_pept        complement(674773..675675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0603"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: bcn:Bcen_0120 ribosomal
FT                   protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07356"
FT                   /db_xref="GOA:A0K4C9"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4C9"
FT                   /protein_id="ABK07356.1"
FT                   /translation="MSYRELVVELAREHAEALSDALLDLGALSVSVEDADADTPDEQPL
FT                   FGEPGLVPDRTAWQHSRVVALLSADHEPAVLLAAAANEIGLAETPKFVVREVEEQDWVR
FT                   LTQSQFEPIPIGERIWVVPSWHDAPDPDALVLELDPGLAFGTGSHPTTRLCMEWLEQSV
FT                   KPGQSVLDYGCGSGILAILAKKCGANPVIGIDIDPQAVESARQNSERNRAEVTYGLPDA
FT                   CPDGEFDIVVANILSNPLKLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDIS
FT                   VWREHEGWVCLAGTRRESH"
FT   gene            complement(675678..677045)
FT                   /locus_tag="Bcen2424_0604"
FT   CDS_pept        complement(675678..677045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0604"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: bcn:Bcen_0121
FT                   acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07357"
FT                   /protein_id="ABK07357.1"
FT                   /translation="MFEKILIANRGEIALRIQRACRELGVKTVVVYSEADKEAKYVRLA
FT                   DEAVCIGPAPSNLSYLNMPALISAAEVTDAEAIHPGYGFLSENADFAERVEQSGFTFIG
FT                   PRPETIRMMGDKVTAKQTMIKTGVPCVPGSEGALPDDPKEIVKIARTIGYPVIIKAAGG
FT                   GGGRGMRVVHTEAALVNAVNMTREEAGRAFGNPQVYMEKFLENPRHIEIQVLSDAYKNA
FT                   IWLGERDCSMQRRHQKVIEEAPAPGIPRRLIDRIGDRCADACKKMGYLGAGTFEFLYEN
FT                   GEFYFIEMNTRVQVEHPVSELITGVDIVQEQIRIAAGEKLTLRQRDIQFRGHAIECRIN
FT                   AEDPFKFTPSPGRITSWHTPGGPGVRVDSHAYNGYFVPPNYDSMIGKLITYGATREQAI
FT                   SRMRIALSEMVVEGIQTNIPLHRELMIDAKFVEGGTSIHYLENRLAQKQQVAPEEA"
FT   gene            complement(677133..677606)
FT                   /locus_tag="Bcen2424_0605"
FT   CDS_pept        complement(677133..677606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0605"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: bcn:Bcen_0122 acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07358"
FT                   /protein_id="ABK07358.1"
FT                   /translation="MDLRKLKTLIDLVSESGISELEVTEGEGKVRIVKNAPPVYVQPTA
FT                   GYAPQVSAPAPSAALPTDGAAAPAAGAAAAPAAPQGHVVTSPMVGTFYRAPSPGADPFV
FT                   QAGDTVKEGQTICIIEAMKLLNEIESDKAGVIKEILVENGQAVEYGQPLFVIG"
FT   gene            complement(677673..678125)
FT                   /locus_tag="Bcen2424_0606"
FT   CDS_pept        complement(677673..678125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0606"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: bcn:Bcen_0123 3-dehydroquinate dehydratase,
FT                   type II; TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07359"
FT                   /protein_id="ABK07359.1"
FT                   /translation="MTRLLVLHGPNLNLLGTREPEVYGRVTLAQIDQALAARARETGAD
FT                   LSSFQSNHEGALVDRIQAAREEQTDFILINPAAYTHTSVAIRDAIAGVGIPFVEVHLSN
FT                   VHRREAFRHHSYFSDQAEGVICGLGWKGYLYALEYALDKLQGASRG"
FT   gene            complement(678320..678868)
FT                   /locus_tag="Bcen2424_0607"
FT   CDS_pept        complement(678320..678868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0607"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: bcn:Bcen_0124
FT                   redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07360"
FT                   /protein_id="ABK07360.1"
FT                   /translation="MMKRMLALAVVAAAAVAGGIAAGHWFRGTADDGVAVAAPAAHGNP
FT                   VDQLWASSLTGVDGKPATLAAFKGQKVVVNFWASWCGPCVEEMPELVALSHQYKQKGIR
FT                   FVGIGVDSEQNVKNFLQKVKVDYPVFISGYAGADLARNFGNTAGALPFTVVIDETGKIR
FT                   ETKLGQIQPAELKKTLDAL"
FT   sig_peptide     complement(678797..678868)
FT                   /locus_tag="Bcen2424_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.720 at
FT                   residue 24"
FT   gene            679084..679512
FT                   /locus_tag="Bcen2424_0608"
FT   CDS_pept        679084..679512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0608"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase, IS605 OrfB; KEGG: bcn:Bcen_0125 transposase,
FT                   IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07361"
FT                   /protein_id="ABK07361.1"
FT                   /translation="MANARVDFQHKLALDLVRRFDYIAVGNVSAVKLARTRMAKSVYDA
FT                   SWSSFRNKLRYKAIAHGALFEEVDESGSTQFCSACGSKDSTTRPKGIAGLRIREWVCSD
FT                   CGVEHDRDTNAALNILRCGRASPGVGILCLLGGGGRQR"
FT   gene            complement(679514..680158)
FT                   /locus_tag="Bcen2424_0609"
FT   CDS_pept        complement(679514..680158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07362"
FT                   /protein_id="ABK07362.1"
FT                   /translation="MSRKPLVDPRRVREEIAQSAARLIAEDGLDYAGAKRKAARQLLGD
FT                   SRVAGEWLPDNDQIEEELREYLSLFQSDTQPDELRRLREIALDWMRRLAEFHPYVTGAV
FT                   LNGTANAHSDIHLQAFTDNPKDVAIYLLNQNVQYDVSETRHFAGRGDVETLSFLWRPRR
FT                   DVDAIGIHLALYASDDLRGAVKADARGRVARADAAALRALVEAGQAPSEPE"
FT   gene            680405..681790
FT                   /locus_tag="Bcen2424_0610"
FT   CDS_pept        680405..681790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0610"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; cytoplasmic
FT                   peptidoglycan synthetases domain protein; Mur ligase,
FT                   middle domain protein; KEGG: bcn:Bcen_0127
FT                   UDP-N-acetylmuramate"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07363"
FT                   /protein_id="ABK07363.1"
FT                   /translation="MHIHILGICGTFMGGLAVLAREAGHTVTGCDAGVYPPMSTQLEAQ
FT                   GITLIEGYGAEQVDLKPDLFVIGNVVTRGNPLMEAILDRGLPYVSGPQWLGEHVLAGKW
FT                   VLAVAGTHGKTTTSSMLAWLLEDAGLNPGFLIGGVPLNFGVSARLTDSSFFVIEADEYD
FT                   TAFFDKRSKFVHYRLRTAVLNNLEFDHADIFPDLAAIETQFHHLVRTVPGVGRIVTNGR
FT                   SDALERVLARGCWSEVERFGVDGGWQALPAEDGVPVDERFAVYSHAGRVGEVAWQVQGD
FT                   HNRMNALAAIAAARHVGVPPAQAAESLASFRNVKRRMEVRGSVDGVTVYDDFAHHPTAI
FT                   DTTIAGLRARIGRQNARILAVLEPRSNTMKLGVMKSQLPASLADADLVFGYGAPTGRDA
FT                   LGWNLAEALAPLGDRARAFDDLHLLVKAVVEAARPGDHVLVMSNGGFGGVHQKLLDALG
FT                   SRP"
FT   sig_peptide     680405..680467
FT                   /locus_tag="Bcen2424_0610"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.939 at
FT                   residue 21"
FT   gene            681787..682356
FT                   /locus_tag="Bcen2424_0611"
FT   CDS_pept        681787..682356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0611"
FT                   /product="protein of unknown function UPF0227"
FT                   /note="PFAM: protein of unknown function UPF0227; KEGG:
FT                   bcn:Bcen_0128 protein of unknown function UPF0227"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07364"
FT                   /protein_id="ABK07364.1"
FT                   /translation="MILYLHGFRSSPESQKSRLLAARMAELGRTGEWRCPSLSVSPLEA
FT                   IAVAEAEVAGARDVTVIGSSLGGYYATWLAEKHGWKAVLLNPAIVPQRDLEQYLGEQSL
FT                   WHGGGTIVVERRHLHELDALRVPAITRADRYYLFAATGDEVLDYREMLAHYPRAKTRVI
FT                   DGSDHGISEFADYVDDVLAFCDGKTS"
FT   gene            682437..684521
FT                   /locus_tag="Bcen2424_0612"
FT   CDS_pept        682437..684521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0612"
FT                   /product="ribonuclease II"
FT                   /note="PFAM: ribonuclease II; KEGG: bcn:Bcen_0129
FT                   ribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07365"
FT                   /protein_id="ABK07365.1"
FT                   /translation="MNVFFEESGSFKAGSVLSRQGDAFQVELPGGRRAKVRAKDVLIEF
FT                   DKPAAGELMQEADTAAQQIDLDFLWECAPADEFAYTALAAEYFGATYGPVERAALVLRL
FT                   HGSPVYFRRKGRGQYQRAPEEQLKMALASLERKRQQALVQAQYEEELKAGKLPEAFAGK
FT                   VLGLLTRPDKNSIEYKAMEAAAGARGVSPARLMLDCGGIESPRALHEARFLAEFFPHGT
FT                   GFPPVTVGPLPDDLPRANVEAFSIDDVTTTEIDDAFSVEHLSDGRVRIGVHIAAPALGI
FT                   VRGDPVDAIARARLSTVYMPGDKITMLPDDVVDVFTLKEGDYRPALSLYIIVNRETQDI
FT                   VANETRAELVFVKNNLRHNTLDELVTEETLAAGTGDYPHKDDIAVLWPLAQALFEKRQV
FT                   ARAGYGLKREVQRNTDYNFYVEGEHVTITPRRRGSPLDLIVSELAILANSTWGAFLHDH
FT                   TVPGIYRSQRGFGAPGPKRTRMQTTAAPHEGLGVAQYAWSTSPLRRYVDLVNQWQLLAC
FT                   VQHGVTAKLAAPFKPKDAELYAVVQGFDDTYTAYADYQRRMEYFWCLRWLKQEQKKQVV
FT                   ASVVKGDLVRLEEIPLLLHVPGLGVHARGTRVLLDVMSLDELTIEASVRLLNVLDAPTV
FT                   TSGDAADEEDDAEGGDDTLVDAEDASAQAEAEALAESGDATAEGGEAASGNDGETGRAS
FT                   "
FT   gene            684518..685384
FT                   /locus_tag="Bcen2424_0613"
FT   CDS_pept        684518..685384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0613"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: bcn:Bcen_0130 shikimate 5-dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07366"
FT                   /protein_id="ABK07366.1"
FT                   /translation="MNAVASTSGADRYVVFGNPVAHSKSPFIHAQFAAQTGEPIEYTHR
FT                   LAPVDGFEAAVRAFVAEGGRGANVTVPFKLDAHALADTLSPRAAAAGAVNTLRIDADGR
FT                   IHGDNTDGVGLVRDIEANLGVSLAGARILLLGAGGAARGVVLPLLDRAPLSIAIVNRTA
FT                   SKAEALVGQFMQAAHDAGCTLAGGGPGVVRAEPYDVVINATAGSLDAALPECDAAAFGA
FT                   GTLAYDMMYGAQPTVFMQHAASLGARTADGLGMLVEQAAESFFIWRGVRPDGAPVLAAL
FT                   RQALAAS"
FT   gene            685399..686136
FT                   /locus_tag="Bcen2424_0614"
FT   CDS_pept        685399..686136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0614"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase, family 51;
FT                   KEGG: bcn:Bcen_0131 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07367"
FT                   /db_xref="GOA:A0K4E0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4E0"
FT                   /protein_id="ABK07367.1"
FT                   /translation="MVAVSGTQRTRTVSLARWAVYAGSVFAGAWLATQLFYLAQIALWL
FT                   FVNPGSTAFMRTDAWWLSRDTPPAQIRHQWVPYDQISRNLKRALIASEDSTFATNNGYD
FT                   VDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSREKSYIRKGQELIITWMLETVLDK
FT                   ERIFEIYLNSVEWGRGVYGAEAAARYYYKIPASRLGAWQSARLAVMLPKPRWFDAHRGS
FT                   AYQAQRAAVIARRMGAAELPQSE"
FT   gene            686560..688170
FT                   /locus_tag="Bcen2424_0615"
FT   CDS_pept        686560..688170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0615"
FT                   /product="peptidase S10, serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10, serine carboxypeptidase; KEGG:
FT                   bcn:Bcen_0132 peptidase S10, serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07368"
FT                   /protein_id="ABK07368.1"
FT                   /translation="MPASKAKLLLGVVCSSLILTACNDDVTSSSAASAANSADPAGQVD
FT                   RAYNDPNSYSSSANASLDASAAVEKAAVTHHQITLNGKTIRYTATAGHLVARNPQTGAP
FT                   EASFFYVAYTADNQPAAKRPVTFLYNGGPGSASVWLHLGSFGPRRIQTGDPNANTSTFP
FT                   FVDNQETLLDTTDLVFVDAIGTGFSEAVAPNTNQTFWGVDQDAGAFRDFVTRYLSVNQR
FT                   SASPKYLFGESYGTPRTDVLANLLETAGVKLDGIVLQSSILNYNTNCDMASDYVGNSNN
FT                   GASPVSCAGFVPSYGTVGAYYQLDNPNPSNLPQYADQMRLLTAGSYAPAVNAYLASHTP
FT                   PPPNLVTTMANSTGVKQALWNADFNVVPTFFDNSFQLSLVPGTLIGRYDARVNVPVSSP
FT                   LAADGDPSSSFITKPFTDTIGSYLPNELKYTAQSAYSVSSNAINTWDWTHDGLAMPDTI
FT                   PDLAAALTLNPQLKVLSLNGYHDIATPFYQTELDLARLGTQPNLTIKDYQGGHMVYLDD
FT                   TSRPQEKADLVTFYSAAAH"
FT   sig_peptide     686560..686631
FT                   /locus_tag="Bcen2424_0615"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.514 at
FT                   residue 24"
FT   gene            688250..688651
FT                   /locus_tag="Bcen2424_0616"
FT   CDS_pept        688250..688651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07369"
FT                   /protein_id="ABK07369.1"
FT                   /translation="MKNRFIVVAAALACVGAAASLSAFAQASDAAAPARARQAQLGDPY
FT                   VPPAARHATAGTQTTGAALHAQVVRKLARQFSAADTQNTGAITESQARAAGLGYVANHF
FT                   RQIDASGNGRVSFADVQRYMQARSSTSQQ"
FT   sig_peptide     688250..688327
FT                   /locus_tag="Bcen2424_0616"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.771 at
FT                   residue 26"
FT   gene            689001..689900
FT                   /locus_tag="Bcen2424_0617"
FT   CDS_pept        689001..689900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0617"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: bcn:Bcen_0134
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07370"
FT                   /protein_id="ABK07370.1"
FT                   /translation="MTKMPDSLALDARRAMPADTSLTDSIGATSTPLDLAAQQAGTQTL
FT                   LRGLAILEAIANGARDMRAIGAALGTTRSTTHRLVSSLVQARYLRQVQGGYLLGPKLIE
FT                   LGTIALEQMPLTAVARPHLEALAEATLDTIHLGVRDGDDVLYIDKIPGTRGLEMRSRVG
FT                   HRMPLASTGIGKAMMLDLDPDLWRSLFEAARRALAGVNFKPDNRPETSAFLQRMAHYAA
FT                   GGYTFDLEENEASIRCVAAPIRDASGAIVAAVSVASTIPYMPHDRMDELIPLVQREARA
FT                   ISAELGWSPPQGTRRIKR"
FT   gene            689897..690922
FT                   /locus_tag="Bcen2424_0618"
FT   CDS_pept        689897..690922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0618"
FT                   /product="2-keto-3-deoxygalactonate kinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   bcn:Bcen_0135 2-keto-3-deoxy-galactonokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07371"
FT                   /protein_id="ABK07371.1"
FT                   /translation="MTTSTRPAPDASSASPSLIALDWGTTSLRAYLYDAHGVPIDTRSR
FT                   PAGVMHVPGGGARAFDAVFEEACGDWLDRTPGLPVLAAGMVGSAQGWREAPYVAVPAGA
FT                   DALVAGLITVTTARGATVSIVPGVIATGELPDVMRGEETQIVGALASDPTLGADRSGVL
FT                   IGLPGTHAKWAWVKDGLIERFQTFMTGELFAVLRDHTILGRTMRTGASPDRDAFVRGVS
FT                   VARGARHTGLLATIFSTRTLGLTDRLAPDAQGDYLSGLLIGHELNALDAMLAERGIALA
FT                   DQPLLLIGDDGLCSRYVDALRVFGHAHARVATHATELGLWRIASRAGLVRADGEPVCAD
FT                   Q"
FT   gene            690945..691622
FT                   /locus_tag="Bcen2424_0619"
FT   CDS_pept        690945..691622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0619"
FT                   /product="2-keto-3-deoxy-phosphogalactonate aldolase"
FT                   /EC_number="4.1.2.21"
FT                   /note="PFAM: KDPG and KHG aldolase; KEGG: bcn:Bcen_0136
FT                   KDPG and KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07372"
FT                   /protein_id="ABK07372.1"
FT                   /translation="MPSDLTLPAPYTPHAALMRAFDACPLIAIMRGITPAEAADHGRAL
FT                   YEAGFRIVEVPLNSPDPFDSIAALRRALPDDMIVGAGTVLRAEYVDRVQDAGGALIVMP
FT                   HSDAAVIRRARERGLASAPGVATPTEAFAALTNGADVLKMFPAEQLGVTVVKAWRAVID
FT                   RAVPLIPVGGISLDNMQPFLDAGANGFGLGSALYRPGQSADTTAAHARAFQAGLRVARG
FT                   GAA"
FT   gene            691619..692401
FT                   /locus_tag="Bcen2424_0620"
FT   CDS_pept        691619..692401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0620"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_0137
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07373"
FT                   /protein_id="ABK07373.1"
FT                   /translation="MMGRLAGKVAMVTGAGRGIGAAIARAFVREGAAVALVDLDFPQAQ
FT                   HTAAAIAHECDGARVLPLQADVAQQQAVREALARTEATFGPLDVLVNNAGINVFADPLT
FT                   MTDDDWRRCFAVDLDGVWHGCRAALEGMLERGRGSIVNIASTHAFRIIPGCFPYPVAKH
FT                   GVLGLTRALGIEYAARNVRVNAIAPGYIETQLTRDWWDAQPDPAAARAETLALQPMKRI
FT                   GKPEEVAMTAVFLASDEAPFINATCITVDGGRAALYHD"
FT   gene            692513..693508
FT                   /locus_tag="Bcen2424_0621"
FT   CDS_pept        692513..693508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0621"
FT                   /product="L-arabinose-binding protein"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator; KEGG: bcn:Bcen_0138 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07374"
FT                   /protein_id="ABK07374.1"
FT                   /translation="MKRRTFVTLAAAAAVVMGSPVAHAADPVKIGFLVKQPEEPWFQDE
FT                   WKFAEIAAKQKGFTLVKIGAPSGEKVMSAIDNLSAQKAQGFIICTPDVKLGPGIVAKAK
FT                   SHNLKMMTVDDRLVDGAGKPIESVPHMGISAYNIGKQVGDGIAAEIKKRGWDMKDVGAI
FT                   DITYEQLPTAHDRTSGATDALVAAGFPKANVIAAPQAKTDTENAFNAANIALTKNPQFK
FT                   HWVAYGLNDEAVLGAVRAAEGRGFKADNMIGIGIGGSDSALNEFKKPQPTGFYGTVIIS
FT                   PKRHGEETSDLMYTWITQGKAPPPLTLTTGMLATRDNVAKVREEMGLASK"
FT   sig_peptide     692513..692587
FT                   /locus_tag="Bcen2424_0621"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            693576..695087
FT                   /locus_tag="Bcen2424_0622"
FT   CDS_pept        693576..695087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0622"
FT                   /product="L-arabinose ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_0139 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07375"
FT                   /db_xref="GOA:A0K4E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017917"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4E8"
FT                   /protein_id="ABK07375.1"
FT                   /translation="MSAALRFDNIGKVFPGVRALDGISFDVHAGEVHGLMGENGAGKST
FT                   LLKILGGEYQPDAGSVLVDGRPVQFANAAASIAAGIAVIHQELQYVPDLTVAENLLLGR
FT                   LPNAFGWVKKREAKRYVRERLAEMGVDLDPDARLGRLSIAQRQMVEICKALMRNARVIA
FT                   LDEPTSSLSHRETEVLFKLVDDLRAQGRALIYISHRMDEIYRLCDACTIFRDGRKIASH
FT                   DALADVPRERLVAEMVGREIADIYHYAPRTLGDVRFSAEGVDGPALREPASFSVRAGEI
FT                   VGFFGLVGAGRSELMRLVYGADRRRAGALTLDGKRIDVKRTGDAIRHGIVLCPEDRKEE
FT                   GIIAIASVAENINISCRRHSLRAGLFINGKTESETADRFIQRLKIKTPNRRQKIRFLSG
FT                   GNQQKAILSRWLAEPDLKVVILDEPTRGIDVGAKHEIYDVIYRLAERGCAIVMVSSELP
FT                   EVLGVSDRIVVMREGRIAGELPRADANEHAVLNLALPQTSAVEAA"
FT   gene            695165..696181
FT                   /locus_tag="Bcen2424_0623"
FT   CDS_pept        695165..696181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0623"
FT                   /product="L-arabinose ABC transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_0140 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07376"
FT                   /protein_id="ABK07376.1"
FT                   /translation="MQVNENLASAAGKPSADALVPQQSDRQKWWQHLTEYSLIAIFAVM
FT                   FITMSLTVDHFFSIDNMLGLALSISQIGMVACTMMFCLASRDFDLSIGSTVAFSGVLCA
FT                   MVLNATDNTFVAIVAAVAAGAAIGFVNGAVIAYLRINALITTLATMEIVRGLGFIVSKG
FT                   QAVGVSSDTFIALGGLSMFGVSLPIWVTLLCFIGFGVLLNQTVYGRNTLAIGGNPEASR
FT                   LAGINVERTRVYIFLIQGAVTALAGVILASRITSGQPNAAQGFELNVISACVLGGVSLM
FT                   GGRATISGVVIGVLIMGTVENVMNLLNIDAFYQYLVRGAILLAAVLLDQLKNRGVRD"
FT   gene            696210..697025
FT                   /locus_tag="Bcen2424_0624"
FT   CDS_pept        696210..697025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0624"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   Insect alcohol dehydrogenase family; KEGG: bcn:Bcen_0141
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07377"
FT                   /protein_id="ABK07377.1"
FT                   /translation="MTIDTSAPDSQATHAASDARFARYPSLEDRAVLITGGATGIGASF
FT                   VEHFAEQGARVAFVDLDAAAGAALAERLAHVRHAPLFLSCDLTDIDALRHAIDAIRARI
FT                   GAIAVLVNNAANDARHAIGDVTPASFDAGIAVNLRHQFFAAQAVIDDMKRQGGGAIINL
FT                   GSISWMLKNGGYPVYVMAKAAVQGLTRGLARDLGPFGIRVNSLVPGWVMTDKQRRLWLD
FT                   DAGRAAIKAGQCLDAELLPADLARMALFLAADDSRMITAQDVIVDGGWA"
FT   gene            697075..698136
FT                   /locus_tag="Bcen2424_0625"
FT   CDS_pept        697075..698136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0625"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: bcn:Bcen_0142 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07378"
FT                   /protein_id="ABK07378.1"
FT                   /translation="MTATSSRASSSTSQSRRARLAAAAQPVSPGPQTAVFAQGVGAAHA
FT                   AAVTLSNASLRLDVLPHLGGGIARFDWRGENGALVPVFRRCEHPETATDPNELACYPLL
FT                   PYSNRIGDGRFECDGRKVAVPRNRRDEPLPIHGDGWLARWQVDDATDTSLQLSLDRTAG
FT                   APYAFRAIQSFELDDATLSIALTIENAGRTRLPFGLGVHPFLVRDAVTELAAAAGGLWL
FT                   SGADFLPVRHVSVPPAWQFGVAYPLPATLVNHAFTGWGGHATVSWPRRRLLLTVAADAD
FT                   AYVLYTPPGEDFFCFEPVDHPINAVNLPGGAAAHGMTLLAPGERLTRRFAFTVERADAR
FT                   SNATTREGARRRG"
FT   sig_peptide     697075..697212
FT                   /locus_tag="Bcen2424_0625"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.683) with cleavage site probability 0.329 at
FT                   residue 46"
FT   gene            698176..699003
FT                   /locus_tag="Bcen2424_0626"
FT   CDS_pept        698176..699003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0626"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; KEGG: bcn:Bcen_0143
FT                   orotidine 5'-phosphate decarboxylase subfamily 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07379"
FT                   /protein_id="ABK07379.1"
FT                   /translation="MSSPLTFIESLRAAWQRTNSLLCVGLDPEPSRFPVQFDGQPDAIF
FT                   EFCRQIVDATAPYASAFKPQIAYFAAHRAEDQLERLIAHIHLQHPGLPVILDAKRGDIG
FT                   STAEQYAREAFERYRADAVTVNPYMGYDSVEPYFEHEGKGVIVLCRTSNPGGSDLQFLD
FT                   TNGRPLYQVVADLAANKWNARNGQLGLVVGATFPKEIEIVRGIVGDMPLLIPGIGAQGG
FT                   DVQATVNAGRTADGTGMMINSSRAILYASKGEDFAEAAALAAQKTRDTINAHR"
FT   gene            699230..700288
FT                   /locus_tag="Bcen2424_0627"
FT   CDS_pept        699230..700288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07380"
FT                   /protein_id="ABK07380.1"
FT                   /translation="MPQLSRRLLSAFAASLCMTFAHAADLSHWPADSAKALNAMIAAHA
FT                   NRGDYAVFDADNTTYRYDLEESLLPYLENHGVLTRDSLDPSLKLIPFKDSADYKESLTS
FT                   YYYRLCEIDDLVCYPWIAQAFAGQSLADLKRHIDAMLADGKPIPIRYWQGDKVVDGTVN
FT                   PPRFFRGMQELYNALRENGIEVYVMTAAHEELARLVLADPKYGYNVKPQNVIGVTTLLR
FT                   NPATGALTTSRLQIKAGKYDEAANRNLVITPFLMNPMTWYEGKLGSIVGWIDQWKKPVL
FT                   VAGDTPTSDGYMLLNATDVARGGVRVWVNKKDKQMAQIRAWSDESAAKQKALGLPVTAD
FT                   KNWIVVKPDAIQ"
FT   sig_peptide     699230..699301
FT                   /locus_tag="Bcen2424_0627"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(700327..700827)
FT                   /locus_tag="Bcen2424_0628"
FT   CDS_pept        complement(700327..700827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0628"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: bcn:Bcen_0145
FT                   CinA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07381"
FT                   /protein_id="ABK07381.1"
FT                   /translation="MPTDSVVHQLAIRAGNKLRDEHLTLATAESCTGGMIATAITDISG
FT                   SSQWFERGFVTYSNQAKIEMIGVPADLIDKHGAVSEPVARAMAEGALRNSRAQVALSVT
FT                   GIAGPGGGSEKKPVGTVSFAWSNRLHTDVETRVFKGDREQIRTQAAAHALRGLLKLLDE
FT                   REG"
FT   gene            complement(700873..701409)
FT                   /locus_tag="Bcen2424_0629"
FT   CDS_pept        complement(700873..701409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0629"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   bcn:Bcen_0146 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07382"
FT                   /protein_id="ABK07382.1"
FT                   /translation="MQTDPTPAHAAAEPGAAPTRVTARFMLSHPAHLVSLGFGSGLAPI
FT                   MPGTFGSLFGWLTFVVLNRYLTVPEWWALIAVGFAAGTWVTGFTAKKAGVADPGAVVWD
FT                   EIVAIWLVMLFVTPATFVGQLWAFVAFRFFDMLKPPPIRYFDRRLKGALGIMVDDLVAA
FT                   FMTLLVIALWRSVVG"
FT   gene            complement(701399..702397)
FT                   /locus_tag="Bcen2424_0630"
FT   CDS_pept        complement(701399..702397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0630"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: bcn:Bcen_0147 thiamine-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07383"
FT                   /protein_id="ABK07383.1"
FT                   /translation="MPAALSEFSLIERFFTRRAAQGARASTLGIGDDCALIAPRSGKLL
FT                   AISTDMLVEGRHFFPDVAPDALGHKTLAVNLSDLAAMGAEPRAFTLACALPRADAAWLE
FT                   AFSNGLFALAERYGCELIGGDTTSGPLNLCVTVFGEVAPDAALRRDAARDGDDVWVSGM
FT                   LGDARAGLGVARGEWTAGADEAAAFRRALERPEPRVALGLALAGIAHAALDLSDGLAGD
FT                   LQHILTRSNVRAEIDADAVPRSAALATLPADVQRRCTLAGGDDYELCFTAPAAARAAVE
FT                   AAGAAAGVPVTRIGTIRALSAPSAHPAIAWRDAAGAPLALTLHGFDHFHAD"
FT   gene            702517..704874
FT                   /locus_tag="Bcen2424_0631"
FT   CDS_pept        702517..704874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0631"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   enzyme domain protein; malic enzyme, NAD-binding; KEGG:
FT                   bcn:Bcen_0148 malate dehydrogenase (oxaloacetate
FT                   decarboxylating) (NADP+)., phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07384"
FT                   /protein_id="ABK07384.1"
FT                   /translation="MIGATMPSNSYSNPPVSRHMSTQASSKAKLREAALDYHEFPTPGK
FT                   IAIAPTKQMINQRDLALAYSPGVAYACEEIVENPLNAARFTARSNLVGVVTNGTAVLGL
FT                   GNIGPLASKPVMEGKAVLFKKFAGIDVFDIELNESDPHKLVDVIAALEPTFGGINLEDI
FT                   KAPDCFIVEREARKRMKIPVFHDDQHGTAIVVAAAVTNGLKVVNKDIKKVKLVASGAGA
FT                   AALACLDLLVDIGLPLENITVTDLAGVVYKGRTELMDPDKERFARETDARTLAEVIDGA
FT                   DIFLGLSAAGVLKQEMVKGMAERPLILALANPTPEILPELALEVRPDAVLATGRTDYPN
FT                   QVNNVLCFPFIFRGALDVGATTITREMEIAAVNAIAELAQHEQSDIVATAYGIQDLSFG
FT                   PEYLIPKPFDPRLIVKIAPAVAQAAMDGGVATRPIEDMEAYRVHLQQFVYHSGTTMKPI
FT                   FQIARAAPEEKKRVVFAEGEEERVLRAVQIIVDEKLAKPILIGRPSVIEHRIQRYGLRL
FT                   TPGTDFTVVNTEHDERYRDFWQTYHKMMARKGISEQLARVEMRRRTTLIGSMLVKKGEA
FT                   DGMICGTISTTHRHLHFIDQVIGKRPGCSVYAAMNGLVLPGRQIFLVDTHVNVDPTPEE
FT                   LAEITIMAAEEVRRFGIEPKVALLSHSNFGTSNAPSAKKMRDTLAILQETAPELKVDGE
FT                   MHGDVALDAALRKEILPESTLEGDANLLILPNIDAANIAYNLLKTAAGNNIAIGPILLG
FT                   AAEPVHVLTESATVRRIVNMAALLVADVNAAR"
FT   gene            705250..705681
FT                   /locus_tag="Bcen2424_0632"
FT   CDS_pept        705250..705681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0632"
FT                   /product="guanine-specific ribonuclease N1 and T1"
FT                   /note="PFAM: guanine-specific ribonuclease N1 and T1; KEGG:
FT                   bcn:Bcen_0149 guanine-specific ribonuclease N1 and T1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07385"
FT                   /protein_id="ABK07385.1"
FT                   /translation="MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYAREAVPADVA
FT                   ASGLDTIPTASLPREAVTTLGLIGAGGPYPYEKDGVVFGNRERILPKAKRGYYHEYTVP
FT                   TPRARNRGARRIVCGGPLRRIDNCYYTGDHYNSFKRIVE"
FT   sig_peptide     705250..705360
FT                   /locus_tag="Bcen2424_0632"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.694 at
FT                   residue 37"
FT   gene            705698..706261
FT                   /locus_tag="Bcen2424_0633"
FT   CDS_pept        705698..706261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07386"
FT                   /protein_id="ABK07386.1"
FT                   /translation="MSDSIYAHDTAAAELFAAGDGNLFQRVIQLHAAAQAGGTPEQQEA
FT                   EPGLSSNEEPMSLFTTVRPNLVQSIRAFRVQDLADEAGRLGQHFLYAYCGAAQSKQEVM
FT                   ETIATSFLFPKHFGKNYDALYDCLTDLVAKAGAQPGFVIVLEGLPIAQKFDKEGRETLL
FT                   DVFREAAEFWAERKVAFRVFYSFA"
FT   gene            706470..707213
FT                   /locus_tag="Bcen2424_0634"
FT   CDS_pept        706470..707213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0634"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07387"
FT                   /protein_id="ABK07387.1"
FT                   /translation="MTTTRFAARARARHPLVCTLTLCALSFGIPPTAQAAVLTPEQTTD
FT                   LYLGAFVNGDVSKAELFNEATRTHFDGKGVLDVAAVAKFADKVSEVIVASILNKVPATV
FT                   RTTVSEPATAAIESFQHALARSECKATGSTRKPNESVEGESIATVEFACRVVEAEPGLR
FT                   ALQEKIEEPRSEDDNARAAYLATFLKGLVPVFDHAPTSRPMTGRIDLHGADGKGWIADS
FT                   PAQVLRPVVNALMSQMREANGDAGE"
FT   sig_peptide     706470..706577
FT                   /locus_tag="Bcen2424_0634"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            complement(707527..708315)
FT                   /locus_tag="Bcen2424_0635"
FT   CDS_pept        complement(707527..708315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0635"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   bcn:Bcen_0152 protein of unknown function DUF558"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07388"
FT                   /protein_id="ABK07388.1"
FT                   /translation="MTETATRMNEATTTAAVPRFFVDAALRADATLALPADVARHVQVL
FT                   RLQPGDVLALFDGTGGQYRARLVEVDKRSALVQVDTFEPAEAEPPYRVTLAQGIAGGDK
FT                   MDWVIEKAVELGVAAVVPLSTARGVVKLSGERADKRVAHWRGVVRASCEQCGRNRVPDV
FT                   APVAGFNAWLDALPAAPADGELRLLLSPRASSPFASLPDAPPAAAVTLLIGPEGGLSPD
FT                   EEHAARARGFTALSLGPRVLRTETAGAAVLAALAARWGGW"
FT   gene            complement(708312..708728)
FT                   /locus_tag="Bcen2424_0636"
FT   CDS_pept        complement(708312..708728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0636"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bcn:Bcen_0153
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07389"
FT                   /protein_id="ABK07389.1"
FT                   /translation="MTDPRPANVPWLTPYLAVRNARAAIDFFQAAFGFTLRDVHDEDGV
FT                   IMHVEMAYRGQLIVMFAPEGAFGSPALTPKRANATAPQSFYLYVDDVDATWQRALDAGA
FT                   KSLSAPQDQFWGDRFAQIEDLDGYRWALGCRLDA"
FT   gene            complement(708817..709674)
FT                   /locus_tag="Bcen2424_0637"
FT   CDS_pept        complement(708817..709674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0637"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="PFAM: Spermine synthase; KEGG: bcn:Bcen_0154
FT                   spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07390"
FT                   /protein_id="ABK07390.1"
FT                   /translation="MSTTLLFHPTPDATYGFPNARRLAHVASPHQQIEVWETPQLGRLF
FT                   TLDGRPMTSVGDEFVYHECMTHPAALAHPAPRKALVLGGGDGGAARQLLKHACIERIVI
FT                   AELDDEVVGMARRYLDDVHQGALDDPRVEVVIGDAAHFVDSTIEHFDLVVFDLTPPDSP
FT                   AAGLYTRAFYARLKRILTRCGAISMHLGSPVFHAARIAALLDDLRASFAVVDPLSAHVP
FT                   LYGSQWLMAIASDTLDAAALFAHDVDARLAARRVDGLRYYDARLHASLFALPRALRDTL
FT                   GVRR"
FT   gene            709890..711962
FT                   /locus_tag="Bcen2424_0638"
FT   CDS_pept        709890..711962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0638"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase, central region; KEGG: bcn:Bcen_0155
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07391"
FT                   /protein_id="ABK07391.1"
FT                   /translation="MPPCPRFLDSFSGLDMTTSSPASTTLMANAIRALAMDAVQQANSG
FT                   HPGMPMGMAEIGVALWSRHLKHNPTNPHWADRDRFVLSNGHGSMLLYSLLHLTGYDLPI
FT                   EELKNFRQLHSKTPGHPEYGITPGVETTTGPLGQGLANAVGMALGEALMADEFNRDGAK
FT                   IVDHHTYVFLGDGCLMEGISHEACSLAGTLKLNKLIALYDDNGISIDGDVVNWFHDDTP
FT                   KRFEAYGWNVIPNVNGHDVDAVDAAIAKAKLSDKPTLICCKTVIGKGAATKAGGHDVHG
FT                   AALGAEEIAKTREALGWKWEPFVIPQEVYAAWDAKEAGKRAESEWDATFAAYRAKFPAE
FT                   AAEFERRMANKLPADWAEKAAAIIAGANERAETVATRKASQQAIEGLAAALPELLGGSA
FT                   DLTGSNLTNWKASKAVRANPEGAGVLLGNHINYGVREFGMSAAINGLALHGGHKPFGGT
FT                   FLTFSDYSRNALRVAALMKVPSIFVFTHDSIGLGEDGPTHQSIEHVSSLRLIPNHDVWR
FT                   PADTVETAVAWTHAVAADRPSSLIFSRQNLAFNPRTDAQIANIEKGGYVLKDWDEEIVA
FT                   RKIILIATGSEVELAMKAVEPLAQQGIAARVVSMPSTNVFDRQDAEYRERVLPHGVRRV
FT                   AIEAGVTSFWHKYVGLEGGVVGIDTFGESAPAGVLFKYFGFTVEHVVETAKAVLA"
FT   gene            712054..713064
FT                   /locus_tag="Bcen2424_0639"
FT   CDS_pept        712054..713064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0639"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: bcn:Bcen_0156 glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07392"
FT                   /protein_id="ABK07392.1"
FT                   /translation="MTIRVAINGYGRIGRNTLRAFYENGKKHDLEIVAINDLGDAKTNA
FT                   HLTQYDTAHGKFPGEVSVDGDYLVVNGDKIRVLANRNPAELPWGELGVDVVMECTGFFT
FT                   TKEKASAHLKGGAKKVIISAPGGKDVDATIVYGVNHDVLKAEHTVISNASCTTNCLAPL
FT                   VKPLNDKIGLETGLMTTIHAYTNDQVLTDVYHEDLRRARSATHSQIPTKTGAASAVGLV
FT                   LPELNGKLDGYAIRVPTINVSIVDLSFIAKRDTTVEEVNAIMKEASEGALKGILGYNDA
FT                   PLVSIDFNHNPASSTFDATLTKVSGRLVKVSSWYDNEWGFSNRMLDTAIAFANAK"
FT   gene            complement(713142..714032)
FT                   /locus_tag="Bcen2424_0640"
FT   CDS_pept        complement(713142..714032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0640"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_0157 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07393"
FT                   /protein_id="ABK07393.1"
FT                   /translation="MELKQLRAFVTLAEELHFGRAAQRLCIVQPALSMQIKALEAELGA
FT                   RLFERDRHKVELSDTGRVFLPEARATLQQAARAEQLARLSSRGEIGTLRIAFVSSVLPT
FT                   LLPAVLRTMRERYPLIVLELKDMPTPDQIAALRDRRIDFGMIRLPAAYAGIDTRVVLEE
FT                   GFVVALPLDHPLAAYDTIAPAALRDHPAFVLARRYAPGFHDDMLLALSRAGTTLEIAQE
FT                   FGEFTTMLALVAAGMGIGLIPAQAANALPPNVLARPLDLAGHRSGIGLAWTDLDSPLKR
FT                   AFVDAVEHVMAHAGQ"
FT   gene            714186..714959
FT                   /locus_tag="Bcen2424_0641"
FT   CDS_pept        714186..714959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0641"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_0158
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07394"
FT                   /protein_id="ABK07394.1"
FT                   /translation="MTHALDRFRLDGRRALITGSGRGIGLTLARGLAEAGAAIVINDRN
FT                   EEKAATLARQFRDEGFAADHAVFDVAEHAQVRAAIDDFETRVGAIDILVNNAGIQRRAP
FT                   LDAFDPDDWHALMRVNLDGVFNVAQAVARHMIARRHGKIINVCSVQSELARPTIAPYAA
FT                   TKGAVRMLTKGMCADWARHGIQANGLAPGYFETELNRALVDDAAFSDWLCKRTPAGRWG
FT                   QVDELCGAAIFLASAASDFVNGQTLFVDGGLTSAV"
FT   gene            714973..716031
FT                   /locus_tag="Bcen2424_0642"
FT   CDS_pept        714973..716031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0642"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bur:Bcep18194_A3728 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07395"
FT                   /protein_id="ABK07395.1"
FT                   /translation="MRLRCMCVVIHGPNDLRVEEQDAGEIGPGQVRVDVAMGGICGSDL
FT                   HYFRHGGFGAIRLQQPMVLGHEVAGTVAEVAPDVTSVKVGDRVAVNPSRPCGACRYCLE
FT                   GLPNQCLDMRFYGSAMRMPHVQGAFRNALVCDAVQCVKVADHVPLSLAALAEPFAVGLH
FT                   AVSRAGPLIGKRVLVSGCGPIGVLAVAAARVHGAAEIVATDVVEAPLEVASALGADRTI
FT                   NAAADAGWVERYGADKGTFDVMIECSGNARALRDGLDVMRPRGVVVQLGLGGDVSLPQN
FT                   VVVAKELSICGSFRFHAEFALAVQLINAGRVDLRPAVTRVFPMRDANLAFELAGDRQRA
FT                   MKVLIDFANEAA"
FT   gene            complement(716165..717322)
FT                   /locus_tag="Bcen2424_0643"
FT   CDS_pept        complement(716165..717322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0643"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_0160 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07396"
FT                   /protein_id="ABK07396.1"
FT                   /translation="MTLLFACACGIVIGNIYYAQPLLAAIAHSFGRAPTELGYLVTLTQ
FT                   LGYAASLLLIVPLGDAVNRHTLIVRLLMLNVVALVAVTFSTNFTMFVVANVAVGFVTCS
FT                   TQLLVPFAASLADARSRGRAVGTVMSGLLLGILLARVAAGAIADGFGWRAVYGIAAAMV
FT                   LALTVVLAVKLPKDRRDARVDYPALMTSLVALVRAQPLIALRSTYGALVFACFSLLWTG
FT                   LTFLLSQPPYSYSEGQIGLFGIVGAVGALAATSAGRFVDRGHGNAATGLFAAAVLGSFA
FT                   LIATGAHSLAALIAGILLLDVGVQGMHISNQSVIYALAGHARSRVTTIYLTSYFIGGAL
FT                   GSFAASVAYGLDGWRGVCIAGAALSGVLIALWLASQRVGSRQVTQ"
FT   sig_peptide     complement(717248..717322)
FT                   /locus_tag="Bcen2424_0643"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.520 at
FT                   residue 25"
FT   gene            717678..718568
FT                   /locus_tag="Bcen2424_0644"
FT   CDS_pept        717678..718568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0644"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_0161 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07397"
FT                   /protein_id="ABK07397.1"
FT                   /translation="MLLRHIRYFLAVAEQRSFTRAADALHVSQPTLSQQIRQLEDTLGV
FT                   QLFDRSGRTVQLTEFGEVYARHARAALHALDIGQRALHDVAELGSGSLRLAMMPTFAAY
FT                   LSGSLIDAFHADHPNVALTIDAMPQERIEALLADDRLDAGFAFMPPRAPDIEALPLWDE
FT                   PLALVTGRTHRLARRRRALTPAELGGEPLVLLSRAFATRERIDRYFVEHGARPLVAIET
FT                   NTVTSVLELVRRGRLATVLPDAVARESGDLCALEIDPPLPTRTAALLTRKGAYRSVAAR
FT                   AFIERVLAYRDPSER"
FT   gene            complement(718611..719303)
FT                   /locus_tag="Bcen2424_0645"
FT   CDS_pept        complement(718611..719303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0645"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bcn:Bcen_0162 GntR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07398"
FT                   /protein_id="ABK07398.1"
FT                   /translation="MKNVPHTVTDAAIATIRDRIEAGVYPVGSLLPAQRQLSEELEISR
FT                   ASLREALSTLEALGMLRIRAGKGVYVESAQASAAHPWQFAEQSSPPDTYQMRYALEGFA
FT                   ARMAAHVVSDEDIAWFEDNLADLHVALTESALDEASRLDFDFHMRIIHLAGNAAIESIL
FT                   RSSADIMKESQRMPFYRRELLLSTWHEHRAIVDALIARDAAAAGTAIETHITNAAQRAG
FT                   VFFPTPGA"
FT   gene            719544..720863
FT                   /locus_tag="Bcen2424_0646"
FT   CDS_pept        719544..720863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0646"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bcn:Bcen_0163 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07399"
FT                   /protein_id="ABK07399.1"
FT                   /translation="MSKFLNSLFGRVVVALILGVALGAFFPHFAESLRPLGDGFLKLIK
FT                   MVIGPIVFCVVVSGMANAGDLKKVGRVGLKAVVYFEVMTTLALGIGLVLAWVTRPGVGM
FT                   NIDLRSLDAASLSTYAKNAESLKDTAGYLMKIIPETAIDAFAKGDILQILVFAVLFGSA
FT                   LSLLGDKAQRVNSLIEELSHVFFKIIGFIIKLAPLGVLGAIAFTTGKYGVASLKQLGYL
FT                   VAVFYLSCFVFVTVVLGAVMRLAGFSVFKLIRYLREELSIVLGTASSDAVLPQVMSKLE
FT                   YMGIKDSTVGLVIPTGYSFNLDGFSIYLTLAVLFIAQATNTPLSTHDLIVVLLVSLVTS
FT                   KGAHGIPGSAIVILAATLSAIPAIPVLGLVLILPVDWFVGIARALTNLIGNCVATVVVA
FT                   VWENDIDRARAKRVLNRELRYVADAPGGTAPVAGDQAHAL"
FT   sig_peptide     719544..719642
FT                   /locus_tag="Bcen2424_0646"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.501 at
FT                   residue 33"
FT   gene            720968..721975
FT                   /locus_tag="Bcen2424_0647"
FT   CDS_pept        720968..721975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0647"
FT                   /product="Allantoicase"
FT                   /EC_number="3.5.3.4"
FT                   /note="PFAM: allantoicase repeat-containing protein; KEGG:
FT                   bcn:Bcen_0164 allantoicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07400"
FT                   /protein_id="ABK07400.1"
FT                   /translation="MAAPILDPNAPAFTRRYMNLADPRLGAQALFASDEFFAPKERMLN
FT                   PEPAVFIPGKYDDHGKWMDGWETRRKRTTGHDFCVVRLARPGVIVGVDLDTSHFTGNFP
FT                   PAASIEACAADGDTPPDDAEWRTIVPATTLQGNSHHYVSVDDARPVTHLRVNLYPDGGL
FT                   ARLRVYGQPQRDWRHVPAGELVDLAAIENGGYLVAANNQHFGPASQMLMPGRGVNMGDG
FT                   WETRRRREPGNDWAIVALARPGIIRRVEVDTAFFKGNFPDRCSLQAAHVTGGTDDSLVT
FT                   QAMFWAELLGEQKLQMDHVHTFDQLAALGPVTHVRFNIFPDGGVSRLRLWGEPA"
FT   gene            721990..722523
FT                   /locus_tag="Bcen2424_0648"
FT   CDS_pept        721990..722523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0648"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /EC_number="3.5.3.19"
FT                   /note="PFAM: Ureidoglycolate hydrolase; KEGG: bcn:Bcen_0165
FT                   ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07401"
FT                   /protein_id="ABK07401.1"
FT                   /translation="MSGTPILRVERLTREAFAPFGDVIALEGARHFPINGGTTERFHDL
FT                   ATIDVCADGGRPLVSVFRAQPRALPVAVTLMERHPHGSQAFIPLAAVSRYAIVVAPAGE
FT                   FRPDAMRAFLAEGWQGVNYAKGVWHHPLLALDAVSDFVIVDRGGPQPNCDEIPLERAWA
FT                   LDFEPACAGAEGLS"
FT   gene            complement(722617..723045)
FT                   /locus_tag="Bcen2424_0649"
FT   CDS_pept        complement(722617..723045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0649"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: bcn:Bcen_0166
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07402"
FT                   /protein_id="ABK07402.1"
FT                   /translation="MTNPTDLKNIGLKATLPRLKILEIFQQSPVRHLTAEDVYRNLLNE
FT                   QLDIGLATVYRVLTQFEQAGLLSRSNFESGKAVFELNEGSHHDHLVCLDCGRVEEFFDA
FT                   EIESRQQAIAKERGFRLQEHSLAMYGSCTTENCPHRKH"
FT   gene            723187..723993
FT                   /locus_tag="Bcen2424_0650"
FT   CDS_pept        723187..723993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0650"
FT                   /product="SmpA/OmlA domain protein"
FT                   /note="PFAM: SmpA/OmlA domain protein; KEGG: bcn:Bcen_0167
FT                   SmpA/OmlA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07403"
FT                   /protein_id="ABK07403.1"
FT                   /translation="MRSAIIAAAAVVALAGCSSYDSVTQRIAQSITPYRITVVQGNFVS
FT                   QEKAAQLQAGMTREQVRALLGTPLLADMFHADRWDYLFYFKRGSTSIVQQRDLVVNFSG
FT                   DRVASWTGADNLPSELDLLADIDGDRGGKKAKAAAAAKKASEAAAAASAASAAQAAAAA
FT                   SPATVPASGAVVDQDANAQAARAANRATNQVSGQGSGSRRFTPAAQASGGAPVPGGQPP
FT                   GAAPAIQPQFQFHRPPQPNVSNEASPPVGPQGSDNLQNQPLTAPAQ"
FT   sig_peptide     723187..723255
FT                   /locus_tag="Bcen2424_0650"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.570 at
FT                   residue 23"
FT   gene            724059..724856
FT                   /locus_tag="Bcen2424_0651"
FT   CDS_pept        724059..724856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0651"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: oxidoreductase domain protein;
FT                   dihydrodipicolinate reductase; homoserine dehydrogenase,
FT                   NAD-binding; KEGG: bcn:Bcen_0168 dihydrodipicolinate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07404"
FT                   /db_xref="GOA:A0K4H7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4H7"
FT                   /protein_id="ABK07404.1"
FT                   /translation="MKIAIAGASGRMGRMLIEAVLNDADAQLVGALDRAGSPFLGQDAG
FT                   AFLGKDTGVKLTDDLDAVFAQAEYLIDFTRPEGTMAHIEAALRHDVKLVIGTTGFTAEQ
FT                   KADLQAAAARIGIVFAANMSVGVNVTLKLLEFAAQHFSHGYDIEIIEAHHRHKVDAPSG
FT                   TALMMGEAVAGALGRSLDDCAVYGRHGVTGERDPSSIGFAAVRGGDIVGDHTVLFAGIG
FT                   ERIEITHKSSSRVSYAQGALRAVRFLSARGAGLFDMQDVLGLR"
FT   gene            724875..725543
FT                   /locus_tag="Bcen2424_0652"
FT   CDS_pept        724875..725543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0652"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   bcn:Bcen_0169 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07405"
FT                   /protein_id="ABK07405.1"
FT                   /translation="MAIPTGVVHYLESGDAITHAVSYVLLAMSVASWCFLFMKAWLLVR
FT                   AKRQGPRALAAFWRAPSLDAGIAALAGADRERVFVPLAEAARDAADDHDPTALAARVER
FT                   SERVLRALRHAMLRSQRRLEFGQVLLASIGSTAPFVGLLGTVWGIYHALGSIAASGQAQ
FT                   IENVAGPVGEALIMTAFGLVVAIPAVLAYNILGRLVRQLAEELDGFARDLHVFVCAQGV
FT                   "
FT   gene            725568..726023
FT                   /locus_tag="Bcen2424_0653"
FT   CDS_pept        725568..726023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0653"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   bcn:Bcen_0170 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07406"
FT                   /protein_id="ABK07406.1"
FT                   /translation="MAFGGLEHHKTSAPMAEINMTPLIDVMLVLLVIFIITAPLMTHAI
FT                   RLDLPKVAAGVARDTPQSVTLSIDDAGKLYWDDAPVALDALPARFKAAAAGAAPPELRL
FT                   RASRATRYDVIAQVMGAAQAAGLTRIGFVTDVPPAGAAAPAAAGAKP"
FT   gene            726316..728910
FT                   /locus_tag="Bcen2424_0654"
FT   CDS_pept        726316..728910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0654"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: bcn:Bcen_0171
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07407"
FT                   /db_xref="GOA:A0K4I0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4I0"
FT                   /protein_id="ABK07407.1"
FT                   /translation="MHERYVPADVEAAAQGDWRAADAYKTKEDSQKPKFYCVSMLPYPS
FT                   GKLHMGHVRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAMANGVPPAKWTYDN
FT                   IDYMKGQMQSMGLAIDWSREIATCKPDYYKWNQWLFLKMLEKGIAYKKTGTVNWDPVDQ
FT                   TVLANEQVIDGRGWRSGALVEKREIPMYYLRITQYADELLNDLDGLGWPERVKIMQQNW
FT                   IGKSFGVNFGFPYELDGEQKLLRVFTTRADTIMGVTFCAIAAEHPLATRLAQDKPELLA
FT                   FIEECKRGGVAEADVATMEKKGVATGFSVKHPLTGEPVEVWIGNYVLMSYGEGAVMGVP
FT                   GHDERDFAFAKKYDLPIRQVIASEGQTYSLDAWQEWYGDKETAVCVNSGKYDGLRYAEA
FT                   VDAVAADLKAGGFGDKQVTWRLRDWGVSRQRYWGTPIPIIHCPSCGDVPVPEQDLPVVL
FT                   PEDLVPDGSGNPLAKSEAFLNCTCPKCGAAAKRETDTMDTFVDSSWYFSRYTAPDAETM
FT                   VDARTDYWMPMDQYIGGIEHAILHLLYSRFWTKVMRDLGLVKFGEPAKNLLTQGMVLNE
FT                   TYYREDAAGKKTWYNPLDVTVTHDDKGRPVGATLNADGQPVVLGGIEKMSKSKNNGVDP
FT                   QLLIDQYGADTARLFTMFAAPPEQQLEWSGAGVEGASRFLRRVWSFGYGNREALAARAG
FT                   FDAATLGDADKALRREIYSVLKQADFDYQRLQYNTVVSAAMKMLNAIDGAKGATPAVLR
FT                   ETYGVLLRVLYPVVPHVTFELWKTLGYADEFGALLDAPWPKVDEAALEQAEIELVLQVN
FT                   GKVRGALKVAKDASRDAIEAAAVADEAFAKFSDGKPAKKIVVVPGRLVNIVV"
FT   gene            728970..729500
FT                   /locus_tag="Bcen2424_0655"
FT   CDS_pept        728970..729500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0655"
FT                   /product="Rare lipoprotein B"
FT                   /note="PFAM: Rare lipoprotein B; KEGG: bcn:Bcen_0172 rare
FT                   lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07408"
FT                   /protein_id="ABK07408.1"
FT                   /translation="MLVGSTVVLSACGFQLRGQQDYAFKHLFVAGAPAPVEARLTRLVQ
FT                   AGSDTKIVKSADDADAVLRMWESRGQNTLTLNKYGSAQEYALFYTLNYTLTSKDGTVLI
FT                   PPSAIALNRAMTYSDQYTNAKAQEADILYGDMQNDAVDQLMRRLAIVHSLTPAPEDVVP
FT                   GVAPRAPLPPPPL"
FT   gene            729519..730613
FT                   /locus_tag="Bcen2424_0656"
FT   CDS_pept        729519..730613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0656"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bcn:Bcen_0173 DNA polymerase III, delta
FT                   subunit; TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III, delta"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07409"
FT                   /protein_id="ABK07409.1"
FT                   /translation="MQLRLDALEPHLAKGLAGLYTVYGDEPLLAQEACDRIRAAARAAG
FT                   FTERSVHTVERGFDWSVLLGATQAMSLFGERQLIELRIPSGKPGKEGADALKTLAATPN
FT                   PDALMLVTLPRLDAATQKSAWFTALQNGGVALKIDPVDRAQLPNWIGQRLSMQGQRVAP
FT                   GDDGRRALQFIAERVEGNLLAAHQEIQKLGLLYPQGALSFEQVHDAVLNVARYDVFKLN
FT                   EAMLAGDAARLARMIDGLKGEGEAIVLVMWAVVEELRTLLRIKRGTTAGKPLATLLREN
FT                   RVWGPRERLIAPALNRVSEAVLEKALAFAAKLDRQVKGLSAVTPGRRTQDEPPPDPWDG
FT                   LFQLAMTVAGARGERPPTAGRVRR"
FT   gene            730748..732055
FT                   /locus_tag="Bcen2424_0657"
FT   CDS_pept        730748..732055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0657"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; PFAM:
FT                   aldehyde dehydrogenase; KEGG: bcn:Bcen_0174 gamma-glutamyl
FT                   phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07410"
FT                   /db_xref="GOA:A0K4I3"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4I3"
FT                   /protein_id="ABK07410.1"
FT                   /translation="MPPRAARFSSHTMDIDQYMTDLGRRARHASRAMARASTAAKNAAL
FT                   DAVARAIERDAQALKDANARDVARAREKGLDAAFIDRLTLSDKALNTMVEGLRQVASLA
FT                   DPIGEIGNLKFRPSGIQVGQMRVPLGVIGIIYESRPNVTIDAAALCLKSGNATILRGGS
FT                   EALESNAALAKLIGEGLEAAGLPQDAVQVVATADRAAVGKLITMTEYVDVIVPRGGKSL
FT                   IERLINEARVPMIKHLDGICHVYVDDRADLAKALTVCDNAKTHRYGTCNTMETLLVASG
FT                   IAAKLLPPLGKLYRDKQVELRVDAAARAVLADAGVGPLVDVTEEDWHTEYLAPVLAIKV
FT                   VDGLDAAIEHINHYGSHHTDAIVTEDHDRAMRFLREVDSASVMVNASTRFADGFEFGLG
FT                   AEIGISNDKLHARGPVGLEGLTSLKYVVLGHGEGRQ"
FT   gene            732079..732501
FT                   /locus_tag="Bcen2424_0658"
FT   CDS_pept        732079..732501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0658"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   bcn:Bcen_0175 conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07411"
FT                   /protein_id="ABK07411.1"
FT                   /translation="MAMLWVKTFHVVLIAAWFAGLFYLPRIYVNLAMETDPAAVRRLLL
FT                   MARKLFRFMTMIAVPALACGLWLWLVIGIGQGQGWIHAKVTVVVLLIVYHAYCGHLLRV
FT                   FERGENRRTDKWYRVFNELPVLGMLAAVALVVIKPF"
FT   gene            complement(732595..733443)
FT                   /locus_tag="Bcen2424_0659"
FT   CDS_pept        complement(732595..733443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0659"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: bcn:Bcen_0176 transcriptional regulator, RpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07412"
FT                   /protein_id="ABK07412.1"
FT                   /translation="MLPRIEAIRAELRPSERKLADYILAAPREVLDLAMTELSMRAGVS
FT                   QPTIARFCQALGCSGFREFKIRLAQSVAPGVSSVYRDVEPNEPAPGIIGKVFDRTIGAL
FT                   IEVRNSLSAGSVADAIALLSNASRIEFYGAGGSGIAAQDIQHKFFRLGVPSVAYSDPHT
FT                   FSMSSALLGPHDVVVAISNTGRTRDIVDAARSALACGAKVVAITQSHSPLAKLATVSLA
FT                   SNVAEETDVFSPMTSRMSHLAIGDILAVGVALSRGPALMERVGRAKEAITRRRIDDPTK
FT                   E"
FT   gene            733738..735594
FT                   /locus_tag="Bcen2424_0660"
FT   CDS_pept        733738..735594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0660"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="KEGG: bcn:Bcen_0177 6-phosphogluconate dehydratase;
FT                   TIGRFAM: 6-phosphogluconate dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07413"
FT                   /protein_id="ABK07413.1"
FT                   /translation="MTSLHPTLAKVTERVIVRSQSTRSAYLQRIDGAQGKFPARGALSC
FT                   ANLAHGFAGLEGNDKFAIKAIREPNIGIVSSYNEMLSAHAPYKDFPEIIKAAARENGGV
FT                   AQFAGGVPAMCDGVTQGNPGMELSLFSREAIAMGTAIALTHNMFDAALCLGICDKIVPG
FT                   LLIGALQFGHLPTIFVPAGPMTSGLSNDDKAKIRQQFATGQVGRDALLEAESAAYHGHG
FT                   TCTFYGTANSNQMLMELMGLHLPGSAFVHPHTPLRTALTAEAARRVLDLTVERGHYTPI
FT                   GHVIDEKAIVNGIVALLATGGSTNHTLHLVAIARAAGILIDWNDFDELSAVVPLLAKIY
FT                   PNGKADVNHFHAAGGVAFLVRNLLEGGLLHEDVTTVAGKGLAHYTKEPKLIDGKLTWVD
FT                   GAAESHDTKVLRGIRDPFQPDGGLRLMQGRLGRGVIKISAVAPEHRKVTAPAIVFDSQE
FT                   AVQEAFDRGELKRDFVAVVRFQGARANGMPELHRLTPLLGVLQDQGFHVALVTDGRMSG
FT                   ASGKVPAVIHVSPEALLAGPIGKVKTGDMLVIDAEAGVLDIEVDDAEWHARPVAQPRHQ
FT                   AENEVGFGRELFGVFRAAAAPAEQGASVFGTLVGETAAHVTA"
FT   gene            735614..736240
FT                   /locus_tag="Bcen2424_0661"
FT   CDS_pept        735614..736240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0661"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="KEGG: bcn:Bcen_0178
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07414"
FT                   /protein_id="ABK07414.1"
FT                   /translation="MKTIAEIVKLGPVIPVLAFDSVEQGENVSRALHAGGVKVLEITLR
FT                   TPAGLEAIQRASQLADDIVVGVGTITKPEHCAQAKRAGAKFGVSPGLTKELHLASLDAG
FT                   LPLLPGVMTPSDIIQALEFGYDIVKFFPAQQAGGVPMLQAFHGPFPALKFCPTGGITVD
FT                   TAPNFLKLPNVVCVGGSWLTPKAALAAQDWAEVTRLAQAASQLPR"
FT   gene            736458..737819
FT                   /locus_tag="Bcen2424_0662"
FT   CDS_pept        736458..737819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0662"
FT                   /product="gluconate permease GntT"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: bcn:Bcen_0179
FT                   gluconate transporter; TC 2.A.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07415"
FT                   /protein_id="ABK07415.1"
FT                   /translation="MGAVQGSMLLVFTLIAIAALILMIARYKIYPFLVLIIVSLGLGLV
FT                   VGMPMDKIVKSFETGTGGTLGHIAIVVGLGTMLGKMMAESGGAERIATTLIDWFGEKNI
FT                   HWAMMFVAIIVGLPVFFEVGFVLLIPIAFNVAKRTGKSLLVVGLPMVAGLSVVHGLIPP
FT                   HPAALLAVQQYGADIGKTIAFGLVVGVPTAIIAGPLFALMISKFVKLPENNPLASQFVD
FT                   SRTDGGKRELPSFGITLFTILLPVVLMLVGSWADLVFTPKSLPNNLLRFAGNSDVALLI
FT                   AVLVSFWTFGAKQGFNRDQIQKFCGECLAPIAGITLIVGAGGGFGGVLRDSGISQQIVE
FT                   TAKHAHLSPLLLGWFVAALMRLATGSATVAMTTACGIVAPIAAASGASVRPELLVLATG
FT                   SGSLIFSHVNDGGFWLIKEYFGMTVGQTFKTWSLLETIISVLGLSFTLLLSVVL"
FT   gene            737833..738336
FT                   /locus_tag="Bcen2424_0663"
FT   CDS_pept        737833..738336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0663"
FT                   /product="gluconate kinase, SKI family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: bcn:Bcen_0180 carbohydrate kinase,
FT                   thermoresistant glucokinase; TIGRFAM: carbohydrate kinase,
FT                   thermoresistant glucokinase family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07416"
FT                   /protein_id="ABK07416.1"
FT                   /translation="MILIAMGVSGAGKSLIGEMLAERLSCSYTDGDAFHSAANKEKMHH
FT                   GIPLTDEDRWPWLRTIRAAIEEKQRAGETAVFTCSSLKRSYRDVLRGTDTDVRFVYLKG
FT                   SFEVLQERLKSRTGHFFDPSLLKSQLDTLEEPGPDEAIEVSIELTPEQIVDQVMLKIGL
FT                   AQQH"
FT   gene            complement(738408..739055)
FT                   /locus_tag="Bcen2424_0664"
FT   CDS_pept        complement(738408..739055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0664"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; Tetracyclin
FT                   repressor domain protein; KEGG: bcn:Bcen_0181
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07417"
FT                   /protein_id="ABK07417.1"
FT                   /translation="MKDKPAQGPRGLDKDAIVAAALALLEDVGEAAFSVRKLAQSVGCD
FT                   PMSVLYHFKSKEGLSRAIANALSRSLVPVDPSLPWRERLRDLARQYRTLALRYPAAFAL
FT                   LQRHMSTGPADLAHIEAVHRALTDAGIPRAALPSVCVGWYASVIGLAAAEAGGLTRAAN
FT                   DVELAEMHALADAAHPLVKSAAPLYAQLDPAVVHDTMLDVLLDGIAQRARTA"
FT   gene            739348..740775
FT                   /locus_tag="Bcen2424_0665"
FT   CDS_pept        739348..740775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0665"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_0182 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07418"
FT                   /protein_id="ABK07418.1"
FT                   /translation="MTSNNKPLIQGEARFAQTQLNIEKDNWNWCDPVRYDGERPANWYE
FT                   ASLSRHENSAPLAQDAVCDVLVIGAGLLGASAALHLAEAGVDTILVDKHHVGSAASGRN
FT                   GGQLTSGLARWEAADMIENLSHDDAKRLWRFASAESMDLIDGIGARYALDLDRKRGHVT
FT                   AAVHPGHMSALLDGADARRHLGDAGVTLVGRHQLHDEYVRSGLYHGAAIDAIGGQIHPL
FT                   ALVRGLVHGFRLNGGALFEGTEVLELDETPAGVVATTPGGTITARKGVVLALHNTTFRL
FT                   LDGGAATTVPFFTYVSVTAPLDVDVDVATLLPAGMPVYDTQFQIDYYRPVRGNRLLFGG
FT                   QGTGSCWAQPDVNAYLLTRLNTVFPQHDGRFALDYCWSGVSDFTLNGATDSRKTDGRVP
FT                   MYMVQGWSGHGVAQTVRIGKAICDDFVGRNDDFSMLTGIDHRAIPLGRQLSPIAIPAAK
FT                   AAMSVMSALNPGRMISF"
FT   gene            complement(740852..742240)
FT                   /locus_tag="Bcen2424_0666"
FT   CDS_pept        complement(740852..742240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0666"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="KEGG: bcn:Bcen_0183 adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: fumarate lyase;
FT                   Adenylosuccinate lyase C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07419"
FT                   /protein_id="ABK07419.1"
FT                   /translation="MSDTRPDTLFALTALSPIDGRYASKTEALRDWLSEAAFMRHRVTV
FT                   EVHWLIALSRAGFAEVPRFSEASEQFLLQLAERFTAHDAARIKEIERVTNHDVKAVEYW
FT                   LKESVKGQAELEKASEFIHFACTSEDINNTSHGMMLAGAREHVILPALRTVYQRLVALA
FT                   HAHAEQPMLSRTHGQPASPTTLGKELANVAARLARAITRIEKVEILGKMNGAVGNFNAH
FT                   LSAYPEFDWEAFSRDVIENRLKLTFNPYTIQIEPHDYMAELFDAVARANTILLDLDRDV
FT                   WGYISVGYFKQKTKAGEIGSSTMPHKVNPIDFENSEGNLGLANATLRHLADKLPVSRWQ
FT                   RDLTDSTVLRNMGVALGYSLLAYDSLIRGLDKLEVNPQRLNEDLDNCWEVLAEPVQTVM
FT                   RRYGIENPYEQLKELTRGKGITREALQEFVGTLAIPQDAKNRLLAMTPASYIGKAVELA
FT                   KRIA"
FT   gene            742506..743471
FT                   /locus_tag="Bcen2424_0667"
FT   CDS_pept        742506..743471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0667"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_0184 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07420"
FT                   /protein_id="ABK07420.1"
FT                   /translation="MELKWLEDFVSLAETRSFSRSAELRHVSQPAFSRRIQALEAWLAT
FT                   ELIDRSVYPTRLTQAGQIFYEQALTMLSQAHEARTLLRGHVGAPVPTIEFAVPHTLSLT
FT                   YFPRWLERIEAKMGQVHTRLRALNVHDAVLSLVEGGCDLVMGYHHPSHPVALDPARYDM
FT                   LILGSEPISPFSAPGRAGRPRHTLPGAADARVPYLSYTPNAYLGRMTEVIIANAPTRLF
FT                   LDRVYETDMAEGLKAMALAGHGVAFLPHSAVDDAVAGGRLIRLDRSARGGAHPFTLTME
FT                   IRLYCDKLALQGDDPRQKLVRALWDVVRDELRDTTGDAAA"
FT   gene            743758..745044
FT                   /locus_tag="Bcen2424_0668"
FT   CDS_pept        743758..745044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0668"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal;
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation region; KEGG:
FT                   bcn:Bcen_0185 Glu/Leu/Phe/Val dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07421"
FT                   /protein_id="ABK07421.1"
FT                   /translation="MSSQQQSIPSYLHADDLGPWGNYLQQVDRVAPYLGSLSRWLETLK
FT                   RPKRILIVDCPIELDNGTVAHFEGYRVQHNVSRGPGKGGVRYHQDVTLSEVMALSAWMS
FT                   VKNAAVNVPYGGAKGGIRVDPRKLSRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNE
FT                   QVMAWMMDTYSMNQGQTSTGVVTGKPIALGGSLGRKEATGRGVFVVGSEAAKKKGLEIE
FT                   GARIAVQGFGNVGGIAAKLFQEAGAKVIAVQDHTGTIYQPAGLDSNKLLDHVARTGGVA
FT                   GFEGAEPMPNDEFWTVETDILIPAALENQITEKNAAKIRTKIVVEGANGPTTTAADDIL
FT                   SANGVLVIPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINHRLERVMREAFAGVWAVAE
FT                   EHKVTVRTAAFIVACKRILMAREMRGLYP"
FT   gene            745306..746199
FT                   /locus_tag="Bcen2424_0669"
FT   CDS_pept        745306..746199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0669"
FT                   /product="L-aspartate-binding protein / L-glutamate-binding
FT                   protein"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_0186 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07422"
FT                   /protein_id="ABK07422.1"
FT                   /translation="MKYHKAVLMAAALCAFASGAYAQETGTLKKIKDTGVIALGHRESS
FT                   IPFSYYDQNQQVVGYSREFQLKIVDAVKKKLNLPNLQVKNIPVTSQNRIPLVQNGTVDI
FT                   ECGSTTNNLERQQQAAFSDTIFVIGTRLMTKKDSGVKDFADLKGKTVVTTAGTTSERLL
FT                   RKMNNDKQLGMNIISAKDHGDSFNTLESGRAVAFMMDDALLAGERAKAKQPGEWVIVGT
FT                   PQSEEAYGCMMRKGDADFKKVVDDAISQVEKSGEAAKIYAKWFENPIPPKGLNLNFPLS
FT                   DSMKKLYANPNDKALD"
FT   sig_peptide     745306..745374
FT                   /locus_tag="Bcen2424_0669"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            746284..747024
FT                   /locus_tag="Bcen2424_0670"
FT   CDS_pept        746284..747024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0670"
FT                   /product="L-aspartate ABC transporter membrane protein /
FT                   L-glutamate ABC transporter membrane protein"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_0187 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07423"
FT                   /protein_id="ABK07423.1"
FT                   /translation="MSYHWNWGIFLSPVSTGEPTTYFGWLMSGFWVTIEVSLVAWVIAL
FT                   IVGSLFGVLRTVPNKWLAAIGTVYVSIFRNIPLIVQFFVWYLVIPELLPASIGTWIKQL
FT                   PPGTQFFTASIVCLGLFTGARVCEQVRSGINALPKGQRAAGLAMGFTQWQTYRYVLLPV
FT                   AYRIIVPPLTSEFLNIFKNSAVASTIGLLDLSAQARQLVDYTAQTYESFIAVTLAYVLI
FT                   NLVVMAFMRWIEGRTRLPGYIGGK"
FT   gene            747021..747701
FT                   /locus_tag="Bcen2424_0671"
FT   CDS_pept        747021..747701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0671"
FT                   /product="L-aspartate ABC transporter membrane protein /
FT                   L-glutamate ABC transporter membrane protein"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_0188 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07424"
FT                   /protein_id="ABK07424.1"
FT                   /translation="MMHQFDWSSIPGALPTLWSGAVVTFKITLIAIVIGIVWGTLLALL
FT                   RLSGVKPLAWFAKAYVTVFRSIPLVMVLLWFFLIVPQLLQGVLGLSPTIDIRLASAMVA
FT                   FSLFEAAYYSEIIRAGIQAVPRGQVNAAFALGMNYAQAMRLVILPQAFRAMVPLLLTQA
FT                   IVLFQDTSLVYVISLADFFRTAANVGDRDGTTVEMVLFAGACYFVICSLASALVKGLQK
FT                   KVTR"
FT   gene            747698..748423
FT                   /locus_tag="Bcen2424_0672"
FT   CDS_pept        747698..748423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0672"
FT                   /product="L-glutamate ABC transporter ATP-binding protein /
FT                   L-aspartate ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_0189 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07425"
FT                   /protein_id="ABK07425.1"
FT                   /translation="MISIKNVSKWYGQFQVLTECTTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPFQQGEILVNGQSVGDKKTNLSKLRSKVGMVFQHFELFPHLSITENLTLAQVK
FT                   VLGRGKDEANEKGMKLLDRVGLKAHAHKFPGQLSGGQQQRVAIARALSMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELAQEGMTMMVVTHEMGFAKKVAHRVIFMDKGAIVEDDRKDD
FT                   FFSNPKSDRAKDFLAKILH"
FT   gene            complement(748506..753794)
FT                   /locus_tag="Bcen2424_0673"
FT   CDS_pept        complement(748506..753794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0673"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; PFAM: Pertactin; Autotransporter beta- domain
FT                   protein; KEGG: bcn:Bcen_0190 outer membrane autotransporter
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07426"
FT                   /protein_id="ABK07426.1"
FT                   /translation="MNHSFRSIWSEAAGCWVAVAETTRTRGKRSGGASGSSQRTARKAT
FT                   HHAARRSPLRVAALGAALAALSAGTVHASTCGNGAAVANGGTCALGSFSPTVNNDLVGA
FT                   TTVSGGDRVGLTGAWTGATGDMGYTPMPLGNTSIISGNPNQPLVTLGGKTQSVGTPDSI
FT                   TGGRTSVATYDSSAFVSSTAGSTVVQVYHDVNDNQYVNTRIGTVANSGGTLDVSIGNPA
FT                   NAPAATGNVMTIAAKQSDLAYADGTGSAPSVINWNSRNQIWFITGDYLASGGPVGSIEL
FT                   DVPTYAGTFTAFDGSTWTVTDAASLAAYNDFLVRSVRNGALGSQTAYDTAFGQAVTLSP
FT                   QTFEYANDVSPGDKNALPRNYPSAMHGTGANATLHIGKDGQIDFRGSNTIDESAAVVAE
FT                   NGAHFVNDGRLSGDFTLVRLLSGASGVNNGTISSGYTVGDNVNTGGATPSDNFGLNTYV
FT                   EGSGVYANGAGTTFVNNGVMNVGAWNLTRNRLDLQNYAVAATDGARASNAGTINVGVNA
FT                   TTLDSQVIGGLVAGGSFTNEAGGTIYLGRAAQYDPSSPEAANDVALSAHGYGILLGASG
FT                   TASNLGTIVIGTQTQNGAALASIGSTSGTLTNAGAIVVNGAAPGTPLANVGMLAADTAA
FT                   TVTNTGTITLNGVNGIGIMVVGTGTNATAATSTGTIDVAGGLDPASGTRNYGVWAEGPL
FT                   AKATLDGALNLTGTGAIGVHARSGATIDVGANAVPAFMSGTHQIGFYAYGAGSKINVAA
FT                   QHLSVDTDDSTLFRVAGGAAYTGASAAGALTTDVNGQRARGVLATDAGTTLSTGNAIYD
FT                   VNGANGIAIAVEGGAKGTIDPGTTINLNAAGATAGIVDGQAHDLAGAAAGAPVATTLTN
FT                   HAAVTSSTAGVTGFIAQNLGTLENRSTVLLTGAGSTGVVAGTLGTVNNASTIRVSNGTG
FT                   ALVQGASATLANAGSIEADDGVAGVRLTGAGASVALSGAGTVIANGSADGVLIDSTVTG
FT                   GGIAAGATSIAVGGSGSGIHNLGANATIALSGTQVATTGNGAAGLASTGAGARIATDAA
FT                   TVVRTAGADALGLSVSGADSTLAANGTTVATTGANAHAIVMDGGATALLSGAKISASGA
FT                   AADGIVAQNGGRIADTGSSLASVAGNGATANSGGVLALTGTALTGATAGVLTSDTLANG
FT                   ATSSVLVDGGSVTSSTGPAFAARGGTADIAVRNGTVVTAGNGTLLNLANGSNVTFSASA
FT                   VNLAGDIVSDASSTGNVFLANGTTLTGKIDPVALSVDGTSTWRMTGSSVLSSLNNAGLV
FT                   AFAAPTGSPTLTGSYKTLTTGGYVGNGGTLALNTYLGADTSPTDRLIVNGGTASGTTGL
FT                   KIANTAGTGAQTTGDGIPVVVTANGGTTAASAFHLAGPVQAGAYEYRLYRGGQGDANGW
FT                   YLRSQLDQTDPGDPIHPSGGDGGNNGNGNANGNGGTLAYRPGVSGYAMTPLLNVDYGFS
FT                   TLGRLHERVGDIYNVEKQQPGNRDGVWGRIGGQSLDANAGRFSADERTFFAQFGKDWTL
FT                   DQAPDGAGRTHAGVTASIGVSNASFSDMARAGSPDLSTSTGSVEMHAQSVGGYWTRYLP
FT                   DGTYFDSVGQVTHYGNRYRDSYGNEASQNGFGVALSQEVGKPFAIGALPVAVEPQAQLM
FT                   YQYLKLNGFNDNVSAVSGTTTNALRGRVGVRIFRPNLQSDAGGGAATPYFTADVLHDFL
FT                   SPGQTVVGGTPFATHLGRTWYELGVGVTAGFGKSGELYANAKIARNIGGDYRRGIVGQV
FT                   GYRYSW"
FT   gene            complement(754380..755294)
FT                   /locus_tag="Bcen2424_0674"
FT   CDS_pept        complement(754380..755294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0674"
FT                   /product="glutamine amidotransferase, class-II"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   bcn:Bcen_0191 glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07427"
FT                   /protein_id="ABK07427.1"
FT                   /translation="MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFEDKA
FT                   CRLFIDHQASATSPIAEMVKRYPIKSKNTIAHIRKATQGHILLENSHPFMRELWGRHWI
FT                   FAHNGDLQDYAPDMDGSVYHPVGTTDSEQAFCVLMQGLREAFPGAQPPLPELFERVGEL
FT                   TRGITDHGVFNFLMSNGQALFAHCSTRLHYLVRRWPFSTAHLVDEDLSIDFAKYTTPED
FT                   RVAVIATQPLTDNEVWTAFEPGELIMFQCGDVAARMQIPVPERVLEKLRNPSLDASASA
FT                   PRAVVREALATAADGDSDDAIDF"
FT   gene            755470..756564
FT                   /locus_tag="Bcen2424_0675"
FT   CDS_pept        755470..756564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0675"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: bcn:Bcen_0192 dihydroorotase, homodimeric
FT                   type; TIGRFAM: dihydroorotase, homodimeric type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07428"
FT                   /protein_id="ABK07428.1"
FT                   /translation="MASPFLTTPPMTASNASSPATLSLARPDDWHLHLRDGDMLAAVLP
FT                   HTARQFGRAIVMPNLKPPVTTTAQAQAYRERILAALPAGMTFEPLMTLYLTDNTPPDEI
FT                   RRARESGFVHGVKLYPAGATTNSDHGVTDLAKCAKTLEAMQDTGMPLLVHGEVTDASID
FT                   LFDREKVFIDRVMTPLRRDFPGLKVVFEHITTKDAADYVRDADAAPGLLGATITAHHLL
FT                   YNRNALFVGGIRPHYYCLPVLKRETHRVALVEAATSGNPRFFLGTDSAPHARDAKETAC
FT                   GCAGCYTALHALELYAEAFDTAGALDKLEGFASFFGADFYGLPRSAETVTLRREPWELP
FT                   REILAGDTPVVPLRGGETIGWKLA"
FT   gene            756561..757451
FT                   /locus_tag="Bcen2424_0676"
FT   CDS_pept        756561..757451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0676"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07429"
FT                   /protein_id="ABK07429.1"
FT                   /translation="MNGAPPREPGLAAGRAAADFARIDWSAPWLAPYAEPGRAWQAAAR
FT                   AGEAALLDALNGALGGVSRGGDRVTGRGRPLRFVPQAELPTGVAYETHIAGTGHVPTRH
FT                   TLHDFFNALVWFAYPRIKAALNARQAAAIDAAGGVGPVRGALRDALTLFDENAALFVTA
FT                   DRALADALRGFDWPRLLMAARDAWGTRCEARLVGHALLEQLVAPYKSCTAHAWIVEVSA
FT                   DYFSWPDARRSAHVDARIAAELATRALTSRDFAPLPVLGVPGWCAANADAAFYDDPAVF
FT                   RRGRRSRAADGGAQC"
FT   gene            757513..757859
FT                   /gene="rnpB"
FT                   /locus_tag="Bcen2424_R0022"
FT   misc_RNA        757513..757859
FT                   /gene="rnpB"
FT                   /locus_tag="Bcen2424_R0022"
FT                   /product="RNaseP RNA"
FT   gene            complement(757943..758365)
FT                   /locus_tag="Bcen2424_0677"
FT   CDS_pept        complement(757943..758365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0677"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcn:Bcen_0194
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07430"
FT                   /protein_id="ABK07430.1"
FT                   /translation="MECKVSWMGQDGMAFSAETGSGHLVTMDGAPEGGGHNLAPRPMEM
FT                   VLLGTGGCTAYDVVLILKKSRQEVSGCSVTLKAERASEDPKVFTKVHFHFTVTGRNLNP
FT                   ATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAA"
FT   gene            complement(758818..759123)
FT                   /locus_tag="Bcen2424_0678"
FT   CDS_pept        complement(758818..759123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07431"
FT                   /protein_id="ABK07431.1"
FT                   /translation="MMKQRLTPFLAAALLAVAAPAVAARSGCEAKLDALDARIAEARTA
FT                   HAEDRIARLRAVRERVRHFCARGHGHASAARAPAPDADSRGTPSDATSQPAARQPT"
FT   sig_peptide     complement(759052..759123)
FT                   /locus_tag="Bcen2424_0678"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 24"
FT   gene            759333..759863
FT                   /locus_tag="Bcen2424_0679"
FT   CDS_pept        759333..759863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0679"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="PFAM: ribosomal protein L13; KEGG: bcn:Bcen_0196
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07432"
FT                   /protein_id="ABK07432.1"
FT                   /translation="MPTEKEQGEPAPRLEAHTDKQEEHIGQSNFFGSIMKTFSAKAHEV
FT                   TREWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIIINASKLKVTGNKTL
FT                   DKKYYRHSGYPGGIYETTFGKMQERFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEAT
FT                   HPHSAQQPKALEI"
FT   gene            759874..760266
FT                   /locus_tag="Bcen2424_0680"
FT   CDS_pept        759874..760266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0680"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9; KEGG: bcn:Bcen_0197
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07433"
FT                   /db_xref="GOA:A0K4K6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4K6"
FT                   /protein_id="ABK07433.1"
FT                   /translation="MIGNWNYGTGRRKSAVARVFIKAGKGDIIVNGKPIADYFSRETSL
FT                   MIVRQPLELTNHGQTFDIKVNVNGGGETGQAGAVRHGITRALIDYDATLKPSLSSAGFV
FT                   TRDAREVERKKVGLRKARRAKQFSKR"
FT   gene            760495..760866
FT                   /locus_tag="Bcen2424_0681"
FT   CDS_pept        760495..760866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0681"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   bcn:Bcen_0198 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07434"
FT                   /db_xref="GOA:A0K4K7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4K7"
FT                   /protein_id="ABK07434.1"
FT                   /translation="MNAVTETAATTTDMPLPFVFTDAAADKVKQLIDEEGNPDLKLRVF
FT                   VQGGGCSGFQYGFTFDEEVNEDDTVMNKNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQF
FT                   VIKNPNATTTCGCGSSFSV"
FT   gene            complement(760974..762122)
FT                   /locus_tag="Bcen2424_0682"
FT   CDS_pept        complement(760974..762122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0682"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   bcn:Bcen_0199 protein of unknown function UPF0075"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07435"
FT                   /db_xref="GOA:A0K4K8"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4K8"
FT                   /protein_id="ABK07435.1"
FT                   /translation="MPQRQPQPAHPVDGIYFGLMSGTSMDGVDGVAVRFEAGRAPVVLA
FT                   EAFVGFAQSLRDALFALQQPGDNEIDRESLAANALVARYAVCCHELQRTAGLSRDEIRA
FT                   IGVHGQTVRHRPERGYTRQLNNPALLAELTQVDVIADFRSRDVAAGGHGAPLAPAFHAT
FT                   VFGAPGETRVVCNLGGISNITILPGADGDVRGFDCGPANALIDAWATRHLGKPYDDGGK
FT                   FAARGTVQASLLGALLDEPYFTAPPPKSTGRDLFNPAWLDARLAAFPQVAPEDVQATLT
FT                   ALTAVSVAREIAQHAPGCKAVFVCGGGARNPVLLDALRHALREAGVPATVDTTAALGVP
FT                   PQQVEALAFAWLAYRFTARQPGNLATVTGAAGNRVLGALYPR"
FT   gene            762265..763506
FT                   /locus_tag="Bcen2424_0683"
FT   CDS_pept        762265..763506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0683"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; RNA-binding S4 domain
FT                   protein; KEGG: bcn:Bcen_0200 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07436"
FT                   /protein_id="ABK07436.1"
FT                   /translation="MSTEPSSKPVFPITDEVRHALAVTKRGVDELLIEEEFAQKLARSA
FT                   ATGTPLRIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNA
FT                   TRPPLTREQIESNAKTYFEQAALVLDREKTEIRYNSEWSMPLGADGMIKLASRYTVARI
FT                   LEREDFTKRFQGGVPISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQY
FT                   GQEQQCILTMPLLEGLDGVEKMSKSKGNYVGISEKPTDMFGKLMSISDTLMWRYFELLS
FT                   FRSLDEIAGFKREAEGGRNPRDFKVLLAQEIVARFHSQADAERALEDFNHRAKGGVPDD
FT                   IPSVTLAGAPLAIGQLLKQAGLVPSTSEALRNIDQGGVKIDGATVSDKGLKVEAGEFVV
FT                   QVGKRRFARVTLTA"
FT   gene            763503..763961
FT                   /locus_tag="Bcen2424_0684"
FT   CDS_pept        763503..763961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0684"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   bcn:Bcen_0201 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07437"
FT                   /db_xref="GOA:A0K4L0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4L0"
FT                   /protein_id="ABK07437.1"
FT                   /translation="MIALIQRVTRADVRVGGRTTGEIGAGLLALVCAERGDTEAAADKL
FT                   LAKLLGYRVFSDAAGKMNLPVSNIDGEGRAGGLLLVSQFTLAADTNSGLRPSFTPAAPP
FT                   DEGARLFDYFVAAARARHPIVETGEFGADMQVSLVNDGPVTFWLQVRP"
FT   gene            763985..764650
FT                   /locus_tag="Bcen2424_0685"
FT   CDS_pept        763985..764650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0685"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bcn:Bcen_0202
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07438"
FT                   /protein_id="ABK07438.1"
FT                   /translation="MATTQILFIRHGETAWNRIKRIQGHIDIPLADTGLAQAQRLAARL
FT                   AREARDGARIDAVYSSDLMRAQQTAQPFADALGLPLLLREGLRERSYGAFQGHDSTEIE
FT                   ALFPDAYAAWQTRDPGFAPEGGESQREFYHRVLHALEPIVAAHPGGRIACVAHGGVLDC
FT                   VYRFANGIELSAPRTYQLLNTSINVVDYVDGRAQVVRWADVSHLEAASDDDDGYRKVL"
FT   gene            complement(764713..765849)
FT                   /locus_tag="Bcen2424_0686"
FT   CDS_pept        complement(764713..765849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0686"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07439"
FT                   /protein_id="ABK07439.1"
FT                   /translation="MPAMPRLPIRFALAASLSTVVALAACGGDDVTAVARTDAQPPSGG
FT                   TTTTPAPTPPATTPPQPGKWKAARAGDLIDVTLGDLHPTQGAIGYDQIYYKLGRYELQP
FT                   DKKFDDFCADEGLGGVASSGYTARSSLREPASYTCATTDANARDRSVLNPVVIGPNGDA
FT                   LYLTDGHHGLSTYYETPDGGPALHVHVVVKDNLSDYSGDAFWQQMQSRGYLRLKNGEGQ
FT                   PITTAQLPSGLGLKLGMTNDRYRSLVYFTRDIGYSKPAQATDYLEFYWADWLRAQPCTF
FT                   ALANYDLTRGGTTDPDPAKADTGYLNAVWNASTRMVAATDPVIDGKTGADLGRADAING
FT                   GKKYNKGEFDKLRQPITADKPGKIAYALDYKTRHALPQ"
FT   sig_peptide     complement(765766..765849)
FT                   /locus_tag="Bcen2424_0686"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.731 at
FT                   residue 28"
FT   gene            complement(765995..766948)
FT                   /locus_tag="Bcen2424_0687"
FT   CDS_pept        complement(765995..766948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07440"
FT                   /protein_id="ABK07440.1"
FT                   /translation="MTTPPSRHPTAPAPGPRWAEPIRKRLVAGITHLTAGGGGPSIDLS
FT                   SPPGDPGLFGPDAVCWRVHADFTSMMTGGIAALLLQALHPLALAGVWDHSSFRTDIFGR
FT                   LRRTATFITGTTFGSRADALALIERVKAIHAHISGSAPDGRPYRADDPALLTWVHVAEV
FT                   SSFLAAHLRYVNPALSGELQDRYYAETALIAELLGAHEVPRSRAEVAAYLARMLPELEA
FT                   GPRTFDVMSILLNVPVARPALRPAASLVMHAGIDLLPPWAQRMLGVSTFAPLRRAVVRP
FT                   GIRAVAPVLRWALVNGASKRARRRATAAPSDGTPPA"
FT   gene            complement(766972..768042)
FT                   /locus_tag="Bcen2424_0688"
FT   CDS_pept        complement(766972..768042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0688"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: bcn:Bcen_0205 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07441"
FT                   /db_xref="GOA:A0K4L4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4L4"
FT                   /protein_id="ABK07441.1"
FT                   /translation="MIETDKLATEQRIIAATPASSHEEVFERALRPRQLDDYVGQEKVR
FT                   GQLEIFIEAAKRRSEPLDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSGPVLERAGDL
FT                   AALLTNLEANDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDLQPFT
FT                   LVGATTRAGMLTNPLRDRFGIVARLEFYDAEQLSRIVRRSASLLNAQIDPNGALEIAKR
FT                   ARGTPRIANRLLRRVRDFAEVKADGQITAAVADAALAMLDVDPVGFDLMDRKLLEAILY
FT                   KFDGGPVGIDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRVATLLTYRHFGLSVP
FT                   DARRTERDEWDTPDGK"
FT   gene            complement(768151..768732)
FT                   /locus_tag="Bcen2424_0689"
FT   CDS_pept        complement(768151..768732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_0689"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: bcn:Bcen_0206 Holliday junction DNA helicase
FT                   RuvA; TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   DNA recombination protein, RuvA; helix-hairpin-helix motif;
FT                   RuvA domain protein; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABK07442"
FT                   /db_xref="GOA:A0K4L5"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0K4L5"
FT                   /protein_id="ABK07442.1"
FT                   /translation="MIGRIAGILLEKNPPHLLVDCNGVGYEIDVPMSTFYNLPQTGERV
FT                   VLLTQQIVREDAHLLYGFLTPQERTTFRELLKITGIGARMALAVLSGMSVQELAQAVTM
FT                   QDAARLTRLPGIGKKTAERLLLELKGKLGADLGALAGAASASDHATDILNALLALGYSE
FT                   KEGLAAIKNVPAGTGVSEGIKLALKALSKA"
FT   gene            complement(768933..769475)
FT                   /locus_tag="Bcen2424_0690"
FT   CDS_pept