(data stored in ACNUC1104 zone)

EMBL: CP000459

ID   CP000459; SV 1; circular; genomic DNA; STD; PRO; 2998664 BP.
XX
AC   CP000459; AAHL01000000-AAHL01000333;
XX
PR   Project:PRJNA13918;
XX
DT   26-OCT-2006 (Rel. 89, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 7)
XX
DE   Burkholderia cenocepacia HI2424 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Burkholderia cenocepacia HI2424
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-2998664
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., LiPuma J.J., Gonzalez C.F.,
RA   Konstantinidis K., Tiedje J.M., Richardson P.;
RT   "Complete sequence of Chromosome 2 of Burkholderia cenocepacia HI2424";
RL   Unpublished.
XX
RN   [2]
RP   1-2998664
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., LiPuma J.J., Gonzalez C.F.,
RA   Konstantinidis K., Tiedje J.M., Richardson P.;
RT   ;
RL   Submitted (30-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; cbab346f53e7f135c3bedb7e54eafc00.
DR   BioSample; SAMN00113327.
DR   EnsemblGenomes-Gn; Bcen2424_R0074.
DR   EnsemblGenomes-Gn; Bcen2424_R0075.
DR   EnsemblGenomes-Gn; Bcen2424_R0076.
DR   EnsemblGenomes-Gn; Bcen2424_R0077.
DR   EnsemblGenomes-Gn; Bcen2424_R0078.
DR   EnsemblGenomes-Gn; Bcen2424_R0079.
DR   EnsemblGenomes-Gn; Bcen2424_R0080.
DR   EnsemblGenomes-Gn; Bcen2424_R0081.
DR   EnsemblGenomes-Gn; EBG00001021779.
DR   EnsemblGenomes-Gn; EBG00001021780.
DR   EnsemblGenomes-Gn; EBG00001021781.
DR   EnsemblGenomes-Gn; EBG00001021782.
DR   EnsemblGenomes-Gn; EBG00001021783.
DR   EnsemblGenomes-Gn; EBG00001021784.
DR   EnsemblGenomes-Gn; EBG00001021785.
DR   EnsemblGenomes-Gn; EBG00001021786.
DR   EnsemblGenomes-Gn; EBG00001021787.
DR   EnsemblGenomes-Gn; EBG00001021788.
DR   EnsemblGenomes-Gn; EBG00001021789.
DR   EnsemblGenomes-Gn; EBG00001021790.
DR   EnsemblGenomes-Gn; EBG00001021791.
DR   EnsemblGenomes-Tr; Bcen2424_R0074-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0075-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0076-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0077-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0078-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0079-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0080-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0081-1.
DR   EnsemblGenomes-Tr; EBT00001624196.
DR   EnsemblGenomes-Tr; EBT00001624197.
DR   EnsemblGenomes-Tr; EBT00001624198.
DR   EnsemblGenomes-Tr; EBT00001624199.
DR   EnsemblGenomes-Tr; EBT00001624200.
DR   EnsemblGenomes-Tr; EBT00001624201.
DR   EnsemblGenomes-Tr; EBT00001624202.
DR   EnsemblGenomes-Tr; EBT00001624203.
DR   EnsemblGenomes-Tr; EBT00001624204.
DR   EnsemblGenomes-Tr; EBT00001624205.
DR   EnsemblGenomes-Tr; EBT00001624206.
DR   EnsemblGenomes-Tr; EBT00001624207.
DR   EnsemblGenomes-Tr; EBT00001624208.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC2809737; 20107499.
DR   EuropePMC; PMC4359114; 25768110.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000459.
DR   SILVA-SSU; CP000459.
DR   StrainInfo; 844880; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635681
CC   Source DNA and bacteria available from James M. Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2998664
FT                   /organism="Burkholderia cenocepacia HI2424"
FT                   /chromosome="2"
FT                   /strain="HI2424"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:331272"
FT   gene            complement(220..417)
FT                   /locus_tag="Bcen2424_3167"
FT   CDS_pept        complement(220..417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09914"
FT                   /protein_id="ABK09914.1"
FT                   /translation="MFTCRNQSCGTQWEQSDVVIKDEGQGLLFRCPLCGARNYLERFED
FT                   DEGNVVYEQMEGRPYLGDLS"
FT   gene            complement(717..2360)
FT                   /locus_tag="Bcen2424_3168"
FT   CDS_pept        complement(717..2360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3168"
FT                   /product="malate--quinone oxidoreductase"
FT                   /EC_number="1.1.5.4"
FT                   /note="KEGG: bcn:Bcen_4992 malate dehydrogenase (acceptor);
FT                   TIGRFAM: malate--quinone oxidoreductase; PFAM: FAD
FT                   dependent oxidoreductase; Malate:quinone-oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09915"
FT                   /db_xref="GOA:A0AWY9"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AWY9"
FT                   /protein_id="ABK09915.1"
FT                   /translation="MIKTLRVILSALALCVATSSAHAADTKKVDVLLVGGGIMSSTLGV
FT                   WLHELQPNWSMTMVERLDGVALESSNGWNNAGTGHSALAELNYTPEKADGKVDISKAIE
FT                   INESFQISRQFWAWQVKQGVLKNPHSFINSTPHMSFVWGDDNVRFLKKRYEALQASPLF
FT                   RGMQYSEDYDQIKQWVPLMMEGRDRNQKVAATWTPIGTDVNFGEITRQFVGYLKTQPNF
FT                   TLSLSSEVREITRNADGTWHVSWVKLHSDEPPQSVDAKFVFIGAGGGALHLLQASGIPE
FT                   AKDYGAFPVGGSFLVTDNPEVVKQHLAKAYGKASVGSPPMSVPHLDTRIIDGKKIILFG
FT                   PFATFSTKFLKNGSYFDLAKSTNLHNVAPMMRVGVDEFPLVQYLAGQLMLTDDDRFNAL
FT                   KEYFPNAKKEDWRLWQAGQRVQIIKRDPVKGGVLKLGTEIVASQDGSIAGLLGASPGAS
FT                   TAAPIMLNLMQKVFKDKVATPEWQQKIRQIVPSYGTKLNDSPAKVVEEWTYTSDVLQLS
FT                   PPPKIDLGAPSQATGNAPARPAKASADMAL"
FT   sig_peptide     complement(2289..2360)
FT                   /locus_tag="Bcen2424_3168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(2898..3218)
FT                   /locus_tag="Bcen2424_3169"
FT   CDS_pept        complement(2898..3218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09916"
FT                   /protein_id="ABK09916.1"
FT                   /translation="MERYPMKRYFPTASFAAAIACAFALSACAAQSSAPAAASAPADNA
FT                   APVAPPLVGGDRDAHGCIGSAGYAWCERTQQCERPWELAKARGVANSAQAYEQFCRNGG
FT                   TK"
FT   sig_peptide     complement(3129..3218)
FT                   /locus_tag="Bcen2424_3169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.607 at
FT                   residue 30"
FT   gene            3383..3538
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3170"
FT   gene            complement(3573..4538)
FT                   /locus_tag="Bcen2424_3171"
FT   CDS_pept        complement(3573..4538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3171"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bcn:Bcen_4989 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09917"
FT                   /protein_id="ABK09917.1"
FT                   /translation="MHSRETRRAVYSRGLPARDTRRALCLQHRNPVMFLDQLHPERWTF
FT                   LWNALSTLSLKLSAALALLVAGWWLSKRVGNWLNRLLSNKERVDDTLRPILCDVAVWGI
FT                   RIVAIVGALSQLGIETASIVAVLGAAGLAIGLALQGTMQNIAAGIMLLLLRPFKVGDYI
FT                   DGGSGVAGTVEEVGLFMTRLTKPDGICEYVPNSALWGSSIRNYTRNPTRRLDLEVEVSV
FT                   HDDIDRALAALHALAVADPDVLQDPAPDVMVMRFDDSTAVANMRVWTHTDKFWTMRWRL
FT                   ARQVRKTLADADCALPIRTRELHIVHDAARRADDTRVRVS"
FT   gene            4723..6096
FT                   /locus_tag="Bcen2424_3172"
FT   CDS_pept        4723..6096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3172"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: bcn:Bcen_4988 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09918"
FT                   /protein_id="ABK09918.1"
FT                   /translation="MRSDLRFRVAREQGRPASRGVHRFPMGRAFLRGIVAAACVAGAQG
FT                   AAAQAFHDAAPAAPATAETTDLGDVPFFNSARTTWGGLRASSAAPLDVAYASHAWNVSA
FT                   GTGRDDPVVRFGACVAYRVLCDTARGAVERGYAARFDYGLASALPATGAQPAFAHGPVD
FT                   LASAEPFTLAQPDRGTRAGAIVGSLHASLARADLPAGVAAQIAHMLAGRIDPTQRGAQG
FT                   DTFRVAFEPDHGATRPGRVRVTALDVRFRGQRVAAVWFAAQAGSPGAYYEFDGMPLAGA
FT                   RFAMPVAATRISSLFGARVHPVSGARHVHSGVDLAAPAGRAVHASERGVVTFIGTEPRG
FT                   YGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVTRGQRVGAVGSTGTATGPHLHFEVRR
FT                   HARLVDPIELVHAARAAKLKGAQRVAFNRVARDARIQLASATWAQPVAMSTRSASHAG"
FT   gene            6422..7519
FT                   /locus_tag="Bcen2424_3173"
FT   CDS_pept        6422..7519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3173"
FT                   /product="Catalase domain protein"
FT                   /note="PFAM: Catalase domain protein; KEGG: bcn:Bcen_4987
FT                   catalase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09919"
FT                   /protein_id="ABK09919.1"
FT                   /translation="MARHARRHNGMKTIYVKTGFQVDTHVGGAGGALTSTLAWTAGWIG
FT                   SRTTSVSLVSETPQPFPPGFRRAHGKGVCFVGTFRPDRAAVPLSTARVFTQADIPVVGR
FT                   LSIGTGSPYAADNSTTTLSMALLLTTDDKQQWRMAMNNQPYFATHEPEGFLAMQQATAP
FT                   DPATGQPDPARVSAFLKAYPEAEKFMKWAAQEPAPGSFAGATFYSVNAFYLVAADGHRQ
FT                   PVRWMMRPHDPFMPMSDAQRQKADHDFLFEGVRERLARKPLHWDYVLQLAQPGDPVDDA
FT                   SQPWPADRKQLVAGTLEMTRVVEQAEGACRDINFDPSIVPAGVAVSNDPILNARSGAYA
FT                   HSFNRREREIGYGKATEAVGKQGVK"
FT   gene            7516..8082
FT                   /locus_tag="Bcen2424_3174"
FT   CDS_pept        7516..8082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3174"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: bcn:Bcen_4986
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09920"
FT                   /protein_id="ABK09920.1"
FT                   /translation="MNTHKLASGGAPHHFNALARGLHWLMAAMILAMLFIGAGMMTSLH
FT                   HRIWLIDLHRPLGIAILVLALLRVANRVRSRPPALPASLPYWQVLAAKASHWALYVLML
FT                   ALPLIGWALLSAGGFPIVLFKGVNLPAIVPASPTLFAWLRDAHGLLARLLFVVVLALLS
FT                   AALVHAWIYRDGVFSSMARGGRQRG"
FT   gene            8624..11905
FT                   /locus_tag="Bcen2424_3175"
FT   CDS_pept        8624..11905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3175"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; autotransporter-associated beta strand repeat
FT                   protein; PFAM: Autotransporter beta- domain protein; KEGG:
FT                   bcn:Bcen_4985 outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09921"
FT                   /protein_id="ABK09921.1"
FT                   /translation="MAILTGAVPVSAYAVCSATAPGSGTTVTCTGANAPSVVATAGSTG
FT                   VTINLDSTVTGSYVLTSAPTPFSVDTSSTITNNGSLSMSGNGTGVANRGAVLLGVNNGN
FT                   TLTNAATGVISTSGTYNDGMAANGNNNTLVNNGTITTTGNNAYGMTAAWGQSNPGASGN
FT                   QIVNTGTVTTSGNNARAASLLGGNGTITNSGTLTSNGRDAPAVYMQGNNDTLVNSGTIQ
FT                   TTGTATSGGSVDAVVSNTLGSSFTATITNQAGGRIVSNNGIGVRSTNGATTITNAGLIQ
FT                   GGGGTAIQGGNGNVTLILQTGSQIVGTANGGAGTNTVTLQGTGTASNAFTNFQRLTMAG
FT                   TDWTWGGTGTFSTALVQSGTLNLTGTLGTTTASVVATVNAGATLQANASNLPLSVTDNG
FT                   LVRFQQDSAGTYTGTIAGAGAVEKTGAGTLTLTPSAAGGNTYSGGTTITQGTLSVAADN
FT                   ALGASSGRLTFNGGTLQFGSAFNLASSRAISTTSNNSAIDTQGFNTTIMQDITGSGGLT
FT                   KLGDGTLTLNGVHSTYSGGTNVAAGTLIVGDLDAAAGLRGGGPLTIAPGATLGGYGSVT
FT                   GNVTNNGTISVANALPSLASSLPGDFRIFGTLTNAGVVELRGRVVGNGLAVSGNYVGQN
FT                   GAVNMNTTLAGDGAPSDTLLIGGVPAVATASGKTTLNVTNVGGAGALTKSDGIRLVYAV
FT                   NFANTGNAFTLAGGTVSAGAYSYYLVKGGVTALTGEDWYLRSTVPPRPDQPTQQPPFSV
FT                   ADGTPESIVEAVKNAAPDAKPEPVYRPEVPLYSEVPAVARQLGLLQIDTFHDRQGEQGL
FT                   LAENGSVPVSWSRVWGGYSNIKQNGDVTPSYDGTVWGMQVGQDLYADNRPSGHRNHYGF
FT                   FLGFSRAIGDVNGFALAQPDLGVGSLQVNAYNLGGYWTHIGPGGWYTDAVVMGSVLTVR
FT                   THSNNNVSGSTDGNAVTGSVEAGVPISLGYGLTLEPQAQLLWQWLSLARFNDGVSDVTW
FT                   NNGNTFLGRIGARLQYAFDANGVSWKPYLRVNVLRSFGSDDRTTFGGSTTIGTQVGQTA
FT                   GQIGAGLVAQLTKRGSVYATVSYLTNLGGEHQRTITGNAGVRWAW"
FT   gene            complement(12063..12797)
FT                   /locus_tag="Bcen2424_3176"
FT   CDS_pept        complement(12063..12797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3176"
FT                   /product="Fucose-binding lectin II"
FT                   /note="PFAM: Fucose-binding lectin II; KEGG: bcn:Bcen_4984
FT                   fucose-binding lectin II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09922"
FT                   /protein_id="ABK09922.1"
FT                   /translation="MSQPFTHDDLYALLQLAGNDATAVQANGDQAVLDRMRQFMTAQLV
FT                   EKLPQYDVFVDIATIPYSFDVGSWQNKVKTDAAGEVVACTVTWAGAPGVLPGAAAKFGV
FT                   GAVVNYFSKATPQPVQPAPVPTGGGERDGVFNLPPNIAFGVTALVNSSAPQTIEVFVDD
FT                   NPKPAATFQGAGTQDANLNTQIVNSGKGKVRVVVTANGKPSKIGSRQVDIFKKTYFGLV
FT                   GSEDGGDGDYNDGIAILNWPLG"
FT   gene            complement(12960..13778)
FT                   /locus_tag="Bcen2424_3177"
FT   CDS_pept        complement(12960..13778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3177"
FT                   /product="Fucose-binding lectin II"
FT                   /note="PFAM: Fucose-binding lectin II; KEGG: bcn:Bcen_4983
FT                   fucose-binding lectin II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09923"
FT                   /protein_id="ABK09923.1"
FT                   /translation="MPLLSASIVSAPVATSEAYVDIPGLYIDIAKAGIRDGKLQVILNV
FT                   PTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFV
FT                   KGQWKSVRGSAMHIDSYASLSAIGETAAPSSSQGGGNQGAETGGTGAGNIGGGERDGTF
FT                   NLPPHIKFGVTALTHAANDQTIDIYIDDDPKPAATFKGAGAQDQNLGTKVLDSGNGRVR
FT                   VIVMANGKPSRLGSRQVDIFKKSYFGIVGSEDGADDDYNDGIVFLNWPLG"
FT   gene            complement(13893..14282)
FT                   /locus_tag="Bcen2424_3178"
FT   CDS_pept        complement(13893..14282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3178"
FT                   /product="Fucose-binding lectin II"
FT                   /note="PFAM: Fucose-binding lectin II; KEGG: bcn:Bcen_4982
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09924"
FT                   /protein_id="ABK09924.1"
FT                   /translation="MADSQTSSNRAGEFSIPPNTDFRAIFFANAAEQQHIKLFIGDSQE
FT                   PAAYHKLTTRDGPREATLNSGNGKIRFEVSVNGKPSATDARLAPINGKKSDGSPFTVNF
FT                   GIVVSEDGHDSDYNDGIVVLQWPIG"
FT   gene            15239..16951
FT                   /locus_tag="Bcen2424_3179"
FT   CDS_pept        15239..16951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3179"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="KEGG: bcn:Bcen_4981 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09925"
FT                   /protein_id="ABK09925.1"
FT                   /translation="MMLKNPATKYRPFTPVNLPDRTWPSRTITQAPIWMSTDLRDGNQA
FT                   LFEPMDATRKMRMFKTLVAIGFKQIEVAFPSASETDFNFVRELIEGGHIPDDVTIEVLT
FT                   QARDDLIERTFASLRGAKRAIVHLYNATAPEFRKIVFTLDRDGVKQLAVNAARTIKRCA
FT                   DAATDTQFTLQYSPETFTATELDFAKEVCDAVFDVWQPTPERKSIVNLPATVEIGTPNY
FT                   YADQIEWMHRNLARRDSLILSVHPHNDRGTAVAAAELAVMAGADRIEGCLFGNGERTGN
FT                   VDLVTLALNLYTQGVDPGLDFSQINEVARTSEECTQLPVHPRHPYVGDLVFTAFSGSHQ
FT                   DAIKKGFAVQRADTVWEVPYLPIDPNDLGRTYDSIIRVNSQSGKGGIAYLLEQGYGVAL
FT                   PRRMQVDFSAAVQRLTDESGHEVTSAQIWALFQQEYVESDTPLRYVSHELTERDGRETI
FT                   VLTADVHGERRVLRGEGNGPLDALMHALHTPLRIQHYEERALSQGADAKAIAIAELAGT
FT                   GVRGSAFGVGVDANLTTASIRAVISGVNRAYARADEVVQATFFAGQPAVQAVA"
FT   gene            complement(17023..17736)
FT                   /locus_tag="Bcen2424_3180"
FT   CDS_pept        complement(17023..17736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3180"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; Autoinducer-binding
FT                   domain protein; KEGG: bcn:Bcen_4980 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09926"
FT                   /protein_id="ABK09926.1"
FT                   /translation="MDLTILHDCFDALQRAPTAEAAFPPIAAAAAALGFRYCVYGLRRT
FT                   LPLARPDLQIVGNHPREWEHRYVKFGYVTIDPIIKRVASQPRPVVWNAFDEPGDTAFWH
FT                   DAACFGMRYGWSHGGYDRAGNLGVLTLVRDTTPLDADEISRLRAPCASLAHAAHAYLMP
FT                   RLADPIAPVGTGLTLREREVLAWTADGKTAYEIGMIFGIAERTVKFHLQNAVVKLDAMN
FT                   KTHAATKAAMLGLLP"
FT   gene            17933..18748
FT                   /locus_tag="Bcen2424_3181"
FT   CDS_pept        17933..18748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3181"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   KEGG: bcn:Bcen_4979 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09927"
FT                   /protein_id="ABK09927.1"
FT                   /translation="MTSVQDVPLLARAGARAFAFGGIRAIEPPCASAPARALAHEYAPH
FT                   AHQAGQLLFTTRGVLVLDVEGQRWITPPLRAIWIPARTVHAMRVADDVQLCSLYLGDAL
FT                   SARLPATLCAMTVSPLLRELATRVSHPFDCSVDHDPLARLFADELSELAQTPLTLPLPR
FT                   DRRLLKLCERLQREPHCELPLDTLARDAALSARHLARLFRSETGMSVAAWRQQLRLSMS
FT                   LALLASGMPVTQAAHQVGYRSPTTYAATFKRAFGVTPSQYLAAAEAAAR"
FT   gene            complement(18772..20118)
FT                   /locus_tag="Bcen2424_3182"
FT   CDS_pept        complement(18772..20118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3182"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bcn:Bcen_4978 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09928"
FT                   /protein_id="ABK09928.1"
FT                   /translation="MSYSESRFWHPRQHPLAASRSPIRITRGEGCYLYDDTGRPYLDAV
FT                   ASLFNVYVGHGRREIKEAIVRQLDELEYHPVFAGFSHPRAEELSARLIDMLQPEDMSRV
FT                   IFGSGGSDAVEAALMIARQYWKVSGQPERTKFIALRQAYHGSHFGGSSVTGNTVYRRNY
FT                   EPALAGCFHVETPWIYRNPFTHDPEELGRLCASLVEREILFQGPDTVAAFIAEPVQATG
FT                   GIIVPPANYWPLVREVCDRHGVLLIADEVVTGFGRTGAAFGSRGWGVAPDIMCLAKGVS
FT                   SGYLPLGATVVNRRIENAFASNPGGIGTLMHGYTYSGHPIVCAAALANLQIIVDEDLAG
FT                   NAAREGAYLLERLQPLVDRYPVVGDVRGKGLLVGIDLVKDKATRESIEPSDGYAAALAD
FT                   AARDAGVLIRSLGNRLAIAPPLVIGREDVDRIVHAVEHAFETVPRWTAR"
FT   gene            complement(20175..21536)
FT                   /locus_tag="Bcen2424_3183"
FT   CDS_pept        complement(20175..21536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3183"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   bcn:Bcen_4977 condensation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09929"
FT                   /protein_id="ABK09929.1"
FT                   /translation="MIDSTLQLPLSAPQRDFWEAALAYPVPSTHIYAAEYFEIRGALDT
FT                   DAFERALRQVIREAQTLHTTRIVLDGDTPVRVLDAALADDWALERVDLAGTKDAHAVAL
FT                   AGMRAHCTGAIELARGPFFRHTLYRIAPDHYYWYHGYAHILVDGYSGSLIATRAAELYS
FT                   AFAAGAKAPPARFASLAELQLDEDAYRASEQFAHDRRYWLERFADQPRTVTLAGPARFP
FT                   ERDDGPDLRETRIASASESARIEAVAKGLFTSTVPRLVTALTAAYLYLNTGAHDIVLSV
FT                   AAMARTSARERRTPTQCANMLPLRLHVEPGHTLDDLCRQANREMTALRQHQRYRMGDLH
FT                   RELTSLDNGQGVFGPEINIMAFDYDLRFGDCVTTSHNLSVGTTDDLMVNLTDRRNGEPL
FT                   RFDFDASPQYYSRDALNAHVGQFLTFMRVALDEPFATLGALESRLDFQPAALAG"
FT   gene            21934..22716
FT                   /locus_tag="Bcen2424_3184"
FT   CDS_pept        21934..22716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09930"
FT                   /protein_id="ABK09930.1"
FT                   /translation="MNQLEGLERKIGEQHERLAHHPVFGSIRTIDELRVFMEWHVFAVW
FT                   DFMSLVKRLQQDLTTVAVPWVAPRNANASRLINEIVLGEESDETPNGHMSHYDLYLHAM
FT                   RDVGASTSRIEEMVSLVRSGFSVSAALKAVDAPEPVIRFVEATMAACTSGATHQVLGNF
FT                   FYGRENVIPDMFRTLLDEWKIERSSIPLLVYYLDRHIEVDSGEHGPAARAMIREAADGD
FT                   AAKLEEALQAGLDAIDERMRLWDGLLAHLGQTRNVVPA"
FT   gene            22713..23102
FT                   /locus_tag="Bcen2424_3185"
FT   CDS_pept        22713..23102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3185"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: bcn:Bcen_4975 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09931"
FT                   /protein_id="ABK09931.1"
FT                   /translation="MNARGLSERIVDFAALEWEHPAAFDDGIDQVVLVDTLDEHAKRGI
FT                   RTRIVRFDPGAGTSVPFLHDYHEEVHLIDGDQSLVDVATREYRATYREGSYFVRPAGTP
FT                   HGPFRSDAGCLLLEIHYYGSPEDTR"
FT   gene            23099..24025
FT                   /locus_tag="Bcen2424_3186"
FT   CDS_pept        23099..24025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09932"
FT                   /protein_id="ABK09932.1"
FT                   /translation="MTTAVTYVSHVDRWEARATVRSRPRRIVEDDELRYYPLERQPLCA
FT                   HPAIVDAGDAVRDFVLLQSFYKYIQDVIIFETEIVNATALRIARGRFAHPFPFACRQDA
FT                   MTVVIDEDYHAYVAMDYLRQVEEATGIAPLPPNSEIELSRAIPRAVERVGAQYRDGMEL
FT                   LCVAISENTVTAEVAAFSRDATLKRSVKGVMADHLADEGRHSAFWINLVKLYWSEIDEP
FT                   ARLALGEGLPCFLREYLSADLQLQFDRRLIDALDLPAAERARIADDMVGAYPITSQHPM
FT                   IVNIRQFFRMSGLLDHAPTRAALSDYL"
FT   gene            24035..27601
FT                   /locus_tag="Bcen2424_3187"
FT   CDS_pept        24035..27601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3187"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain; thioester
FT                   reductase domain; PFAM: AMP-dependent synthetase and
FT                   ligase; NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   phosphopantetheine-binding; Male sterility C-terminal
FT                   domain; KEGG: bcn:Bcen_4973 amino acid adenylation"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09933"
FT                   /protein_id="ABK09933.1"
FT                   /translation="MKAIIIAIGGQTRLAARLAAELEATGHTVCIADGRDGPLRDAADA
FT                   LLLPAPAPEPLRNAAEWSIVCGVPDPAVHCAHARPLHCEIVADAFPPREVRVAWLTDAA
FT                   PGDTRVLADATLAFGAALNGADLADEIAACAVDLMHEVASGIARELSDPNDAPRATPPG
FT                   PSDIVLDLERLAGWHASNDTAAAWPCEPSLPELVSRAAAAAPDACALVAADGQLTYREL
FT                   VTRARQVAARIAARPAAPRVVAVRLDKGVALYPAIVGVLGAGATCVPLDPAFPPERART
FT                   ILRESGAQALVVGGAVEPALLDGFDLDVIDCGAHAEADAHASPDALAGQWPLERDADRD
FT                   ARCAVAIYTSGSTGVPKGVMLSHRNIVQFCHWYRAHVSLDASSRVLQFSTVAFDASLLD
FT                   MFPTWLAGATLVAPSEAQRRELDALATLVADARITHAFLPPALLAALPDCDWPALAHLV
FT                   TGGDVCDPDTIARWSANRRLHNIYGPTECTVLATTGELRAGDSNRRIGRPIANARCHVL
FT                   AADGRPALTGEEGELCIAGAGVGLGYLGRPDLSAERFVADPYGAPGATMYRTGDIASWE
FT                   PDGTLRYVGRRDTQLKIRGFRVEPGEIETAALAAGLYRQCAVVPDERKRIRLFAAKPVD
FT                   AAATPDALRAVLAATLPDYMVPYDITALDVLPATPNGKIDRAALARLPVSRAGSDTRDA
FT                   PRGALELRLAAMWATLLELAPDEIGRDASFFELGGHSLLVSRLMLAVKRELGGNAALAR
FT                   FMERPTIAALAALLTDESGERGANVPARVHDDRRLPDDVRLPAGQPAGDGSGAVLLTGA
FT                   NGFLGCFILSELISRTNQIVYCVVRGDDDASARRRLDEAAFVNGLGHLCGHPRVRVLRG
FT                   DLGAPRLGLSDAVWQTLAAEVGAIHHNGAHVNHVYDYPYLHAENVGSTLELLRLCCSGR
FT                   RKALHFVSTLSAASATGPTGRLIEAAPSEAGPAFVNNGYNLTKWVSEHLVAEAAARGID
FT                   TTILRPGNITGHSRTGLCQPGRNRILLLLKGAVQLGCAPLASEGGLFDLSPVDYLARAI
FT                   VACTLDGARTERVFHLHNPRPLDWAGYLRALARRGYPLRFEAPGVWRERLLSIDESNAL
FT                   FDVVAFYLDDRQDDIGDMAVIDHARTEATLRRLGVTYPDKDDALLDAHFGYLAECGFMP
FT                   PPPEPAPRANDARRDAEPEPAW"
FT   gene            27657..28145
FT                   /locus_tag="Bcen2424_3188"
FT   CDS_pept        27657..28145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09934"
FT                   /protein_id="ABK09934.1"
FT                   /translation="MLQRTATQPRPSTLVYAPQTPILSGSADLDVPARDAWRVVGDFAG
FT                   FSRFITGLDHTDMIGEGVRSLRIKHFADGNVVVEQLNSHDDEAMVMTWSLIHTSFDIGN
FT                   LWALMRVEPRGDQACTVTWDIAGEPSHGGAARQPEFDAFVTGFLDMAMTNLRALFKPQ"
FT   gene            complement(28174..29160)
FT                   /locus_tag="Bcen2424_3189"
FT   CDS_pept        complement(28174..29160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3189"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4971 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09935"
FT                   /protein_id="ABK09935.1"
FT                   /translation="MDLIQSMQAFVTLADAGTFTETGKRLGITTAHVSRLVASLEHRLG
FT                   IRLLNRTTRSMCLTEAGERYLARARDITLAVDASEREARDARVHPHGRLRAHCSASIAN
FT                   HFVIPLIGQFQARYPDVSVDLTLAPHLPKLVRDSYDVAVIAMPSLPSSEQVAIDVGRIR
FT                   SVLCASPAYLDAHGMPDSPGALVHHRCVQLVAPAYHERIWTLWNGAEAQTVDVDPSMTA
FT                   DVAASLAIAVREGAGIGLLPDFVAAADLRSGALVRVLPDYQAEEIGVFLVYASRQHLDA
FT                   KTRAWVDFMKAALRDAFAQARDDACAPPAGKKSHAPGKAGAWAGAAA"
FT   gene            complement(29280..30113)
FT                   /locus_tag="Bcen2424_3190"
FT   CDS_pept        complement(29280..30113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3190"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   Cupin 2, conserved barrel domain protein; KEGG:
FT                   bcn:Bcen_4970 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09936"
FT                   /protein_id="ABK09936.1"
FT                   /translation="MRSISRVKRIRRREKDNPDQLENFFIALERQARDKQIAVVASDSP
FT                   AGMAYPPHSHRQGQLIHAISGVMIVHADAGSWVVPTGRAVWVPGGTQHEIRSAGDVQMR
FT                   TVFVGPEVRPSLPTECRVIEVGTLLRELIVTACDLPADYDLSHRAGRVLALILDEIEIA
FT                   PSLSLHVPMPRHPALVALCTRLINDPSSVVTLQAWARDAHMNERTLARAFKRETGMTHG
FT                   AWCRHARLLLSLPRLAAGTPILELALEHGYDSPSAFAAMFRKALGVAPSEYFRRR"
FT   gene            30170..31663
FT                   /locus_tag="Bcen2424_3191"
FT   CDS_pept        30170..31663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3191"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_4969 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09937"
FT                   /protein_id="ABK09937.1"
FT                   /translation="MRVPSIPSASPVSPAVETRLPRVRRATCAAVLLASAALAACSVGE
FT                   PYRPPVSDATRTGPFDAVADVPAAAAGEPPQRWWRLYDDPVLDGLVRDALAQNRDLAAA
FT                   VARVERARAVFDEAGAARLPDTTAGFGVDYGKHAPDQIVAAAKDTDARTRWGFAPSFSL
FT                   SWEVDLWGRVRHLVDAAQADADAVQAASDAMRVVVAAETTAAYAQVCAYGERIDVAEQS
FT                   VGIADRLAALTAKQRAHGLVSDLEVARSRAFADDTRADLPALVGSRRAALYELAVLTGR
FT                   APGALPDAAAHCRTAPMLARPFPVGDGASLLRRRPDLRESERQLAAANARIGVATAELY
FT                   PSISLGGSVNWLSTGGDPSTLGDKYAIAWGVGPLITWRFPNMAVSRARLAQARADDTLA
FT                   RAQFDAQVLRALKETEQALARYGAAWRRRAALETARAEHARAYRLAELNYEAGALDFLG
FT                   VLDAQRSLVAVDSALAESTQQVSLDQVAVFKALGGGWQP"
FT   sig_peptide     30170..30292
FT                   /locus_tag="Bcen2424_3191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.347 at
FT                   residue 41"
FT   gene            31723..32847
FT                   /locus_tag="Bcen2424_3192"
FT   CDS_pept        31723..32847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3192"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_4968 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09938"
FT                   /protein_id="ABK09938.1"
FT                   /translation="MSTTAVPEKAKTARFSRRQLIAAGVVLAVIALAVFGWHWWTVGRF
FT                   IESTDDAYVRADVVTVSSRVSGYVTQVAVDDNQPVKRGDVLVRLDDRDYRAKVDDAQAA
FT                   VAAADATLQAEQAAAAMLDAQIGQQRSQIAQADADAAAARAEAARRDADATRYKQLLAE
FT                   SAASGQRWEQAHADALKARAELTRAGAAVRVQTDQQTVLQRRREQSTAAIAQARARLAA
FT                   AQAKLALAQLDLDHTVIRATRDGSVGQRAVRAGQYVEVGMPLLAVVPLSDVYVVANFKE
FT                   TQLGAMHDGQPVQIDVDTYSGHTLHGRVIGLAPGSGAQFALLPPDNATGNFTKIVQRIP
FT                   VKIRVDTPPAGVVLRPGMSVIARVDTRGTQGAGS"
FT   sig_peptide     31723..31833
FT                   /locus_tag="Bcen2424_3192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.534 at
FT                   residue 37"
FT   gene            32844..34427
FT                   /locus_tag="Bcen2424_3193"
FT   CDS_pept        32844..34427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3193"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4967 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09939"
FT                   /protein_id="ABK09939.1"
FT                   /translation="MTAATAQAAHEDTVSLRAWVAVLGGVFGCFMAGMNVHVTNASLPD
FT                   IRGSLGASFEEGSWITTAYLVAEIVVIPLTGWLVQVFSARRVLLVGATGFLAFSLACSV
FT                   APSISTMIIARALQGAFGGVLIPLSFQLIVTELPPSKHPLGMALFAIANNVAQAAGPSV
FT                   GGWLTDMYSWRWIFYLQIPPAIALVAAIGWAIRPVPVQLGMLRRADWFGIATMAVGLSA
FT                   LQIVLEEGGRKDWFASDLIVELSIVAALGLAAFVAIELRRKEPFINLRLLGQYNFGIAS
FT                   LMQFLFGAVVFGVVFLVPNYFAELHGYSARDIGLAMIPYGLVQFAMSFLTPPLMRRTSP
FT                   RTTIVLGFVLVAAGCLMNIHLDADAASNVIVPSLIVRGIGQSFVVIALAVMAVDGIEKA
FT                   QLGSASGVFNMVRNVGGAIGIAVMSQIVVERQKLHAMRIGEAVTPFSEAFQERMAMLAR
FT                   LLARVHAPRADVLPGGSFSGVHELALGLVNQRVMREALLMAYSDTFLIAGIAMIGCTAA
FT                   AFILKGKKKA"
FT   gene            34627..34962
FT                   /locus_tag="Bcen2424_3194"
FT   CDS_pept        34627..34962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3194"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: bcn:Bcen_4966
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09940"
FT                   /protein_id="ABK09940.1"
FT                   /translation="METNQTVAALSALAHESRLAVFRALVQAGPPGLPAGQIAALLDVP
FT                   PSSLSFHLKELAHAALVTSRQEGRFVIYSANFATMNGLLAYLTENCCGGNPCSPVSACS
FT                   TSGTQTC"
FT   gene            34959..35477
FT                   /locus_tag="Bcen2424_3195"
FT   CDS_pept        34959..35477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3195"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bcn:Bcen_4965 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09941"
FT                   /protein_id="ABK09941.1"
FT                   /translation="MTRSRALPMTTHVLILCTHNSARSVLAEGMLNHWAAKLGKDMRAY
FT                   SAGSAPSGRLDPFALDALTNAGVDTSGYRSKSWDEFVGAGAPDMRVVVTVCDSAAAETC
FT                   PHWPGSPVKVHWGYADPSNAPGGDEGKRLAFELTREALGYRMLQLLALPLDRMSNAELQ
FT                   AALVEISRN"
FT   gene            35486..36613
FT                   /locus_tag="Bcen2424_3196"
FT   CDS_pept        35486..36613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3196"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: bcn:Bcen_4964 bile acid:sodium
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09942"
FT                   /protein_id="ABK09942.1"
FT                   /translation="MATGEKPLAARDTEIDTRSMNAPDVSPAGKAAAMPAINFFERYLT
FT                   VWVALCIVAGIALGQALPGLFQHIGRMEYAHVNLPVGLLIWVMIVPMLVKVDFGALHEV
FT                   RRHVKGIGVTLVVNWLVKPFSMALLGWLFIRHLFASLLPADQLDSYIAGLILLAAAPCT
FT                   AMVFVWSRLTGGDPLFTLSQVALNDSIMVVAFAPLVGLLLGMSAITVPWATLITSVGLY
FT                   IVIPVIVSQVLRKRLLAKGRAAFDAAMTKIGPWSIAALLATLVLLFAFQGEAILKEPLV
FT                   IALLAVPILIQVFFNSALAYWLNRAVGEKHNVACPSALIGASNFFELAVAAAISLFGFH
FT                   SGAALATVVGVLVEVPVMLLVVRVVNRSKGWYERA"
FT   gene            36661..37401
FT                   /locus_tag="Bcen2424_3197"
FT   CDS_pept        36661..37401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3197"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bcn:Bcen_4963 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09943"
FT                   /protein_id="ABK09943.1"
FT                   /translation="MTRRASVLDLSNDLPQLDLESFRVPDAGQLRPASPSTHAPRFLLL
FT                   YGSLRERAFSRLLIEEAARLLTAMGAEVRVFNPSGLPLPDDAPESHPKVVELREQVQWS
FT                   EGMVWCSPERHGAMTGIMKAQIDWIPLSMGAVRPTQGKTLAVMQVSGGSQSFNAVNQMR
FT                   VLGRWMRMLTIPNQSSVAKAFGEFDEAGRMKPSAYFDRVVDVLEELVKFTLLTRDVGPY
FT                   LVDRYSERKESAEALSKRVNQWSI"
FT   gene            37732..39177
FT                   /locus_tag="Bcen2424_3198"
FT   CDS_pept        37732..39177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3198"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: bcn:Bcen_4962 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3198"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09944"
FT                   /protein_id="ABK09944.1"
FT                   /translation="MGITDHQHIIGRLATWLAGSPTGTWPPYRRRVSRAAGDAYDRFFQ
FT                   DSSIAIRVLGQKAAQHEAMLATLGATALSAPPPHMLDTLRTRMPQLDGLEFRPPGAGRH
FT                   DASLAVRRSPPRDATTFSIEFAGDGYWLAADSGWAVRIDPGQLLAPGDWPDSLASAALH
FT                   LQGRAFELLHRDAPATPFGWTMHVEKHLPARPQAYVLTTTRTLTAADLPWLSIALWNVV
FT                   AALLVLGALGAWRLRDARRREHARARLDGVTRLDTLGEMAAGLAHELNQPLTAIVTHTR
FT                   AAERMLDTPSERDSVRRALQTSVAQAKRAAAILDRLRTAMTSSRDDARRALDPDALMAS
FT                   LLFLHADDAAREHVALTWRNAAPRARPLADPVAVEQILHNLIRNARDVLAGAPRGEIRV
FT                   SGARDGRHYRFSVTDTGPGVPDDALPRLFEPFFTTRTDGLGLGLPLCDTLAQRQDGALT
FT                   IRNLPSGGAEAVLLLPMAREGHG"
FT   gene            39174..39818
FT                   /locus_tag="Bcen2424_3199"
FT   CDS_pept        39174..39818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3199"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: bcn:Bcen_4961 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09945"
FT                   /protein_id="ABK09945.1"
FT                   /translation="MSTHEAMHPPEAGSVVAIVDDDEAVRDGLALLLWTVGLRTRRFAD
FT                   AHAFLAEADDSTLGCVLLDLRMPGMSGLDALDCLAGRRSLPVIVLTGHGNVDACRRAFK
FT                   RGACDFLRKPVDDDELIDVVQQALRGHADRRDGDAAEQARASRMATLSARERDVLDGIV
FT                   RGGSNKAIARDLGLSPRTVETYRANLFDKLQVASLVELVRDYAALAGVSAT"
FT   gene            40097..40876
FT                   /locus_tag="Bcen2424_3200"
FT   CDS_pept        40097..40876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3200"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: bcn:Bcen_4960
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09946"
FT                   /protein_id="ABK09946.1"
FT                   /translation="MNTTRITMIRLAAAALFATTAIAPGAHAADAPASAPAAPTGHGFD
FT                   YDHQREWHLESGDAQSPVAIDSATVKRATRYEDENVAIDVHIADTRAKAIDNGHTIQIV
FT                   PAGGSATIRGRHFRLQQIHFHAPAEHTLDGRSSPIEGHFVFRSQDGRLAVVAVFYRTGS
FT                   ENAQFAAVMDALRGADTASVPSFHAAALMPRSVKTYYHYLGSLTTPPLTENVEWYVLDE
FT                   PVELSADDITAFRMRYSHNARVVQPLNGRPLLRYDAK"
FT   sig_peptide     40097..40183
FT                   /locus_tag="Bcen2424_3200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            40990..41700
FT                   /locus_tag="Bcen2424_3201"
FT   CDS_pept        40990..41700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3201"
FT                   /product="porin, opacity type"
FT                   /note="PFAM: porin, opacity type; KEGG: bcn:Bcen_4959
FT                   porin, opacity type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09947"
FT                   /protein_id="ABK09947.1"
FT                   /translation="MIKSFALPLSLALLFSGAAFADTVAPETKKQDPSDAGYYATARVI
FT                   GAFDNAVNMELTSPRVTSRIGGPDGQDRVTGSVAGGYQFGNGWRAEGEYVFKRSGNFVS
FT                   YWAPFDANANEFHVSSQRLMLNGYRDFDLGRGFSVYGTLGVGVAIVSAEGWQGNDTRRF
FT                   ASKTQTNLAYSAGAGVSYAINKRFTIDVGYRYVDMGNVETGFNTFVNRVSARDEQLKSK
FT                   LSSNEVFIGLRGRF"
FT   sig_peptide     40990..41055
FT                   /locus_tag="Bcen2424_3201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            41791..42810
FT                   /locus_tag="Bcen2424_3202"
FT   CDS_pept        41791..42810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09948"
FT                   /protein_id="ABK09948.1"
FT                   /translation="MAHRERAGNEIALTRIVAARISPVRFTRDIPYGDTRSQSNLLTGA
FT                   RIGAADVGRSVVDIMGMQDIEGRFALPLARPFSDLPPPFGRRRRPFVTSKQPKPGVFDL
FT                   SGTREAPVPAAVRAADFGSDNKPWVKPRLARRGWQPTVLTLVAGLILGSVGLAGAHAFH
FT                   GGRRAPARNTVYQAAIATTPARSETASVIVPADPDDASGTAAAAAATAIGVRAAARDEA
FT                   APMPGASAGTPSERKSASTARRKSVRPETARERLAAAAPASGAASRTHAERQDDASSAA
FT                   SRPAHAAVGMTASEFKQWLAETREPARAASADVSPGTDLQVALPSHTRLVEAGSAGTQ"
FT   gene            42807..43475
FT                   /locus_tag="Bcen2424_3203"
FT   CDS_pept        42807..43475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3203"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: bcn:Bcen_4957 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09949"
FT                   /protein_id="ABK09949.1"
FT                   /translation="MTFDRLIPEILFGFMGLVGIINPFGMAFVFLERTQSLTEPERALL
FT                   SKKLGRNVFFTLLVIFFVGAPVLNFFGISMEALRIGGGFAVAVAGWSMLNVPDVSTDAS
FT                   MAQGSDFPNLMSRAFFPMTVPLTIGPGSIAAGIALHANRSHGVKDYVLSGVISVAVAAL
FT                   VAFAIWQIYSRATTLARYLGSEGTKVAMRVSAFLLLCVGVQIMLTGLAAFAQMLGGHAG
FT                   "
FT   gene            43760..45265
FT                   /locus_tag="Bcen2424_3204"
FT   CDS_pept        43760..45265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3204"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4956 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09950"
FT                   /protein_id="ABK09950.1"
FT                   /translation="MGILAKIRRMYFREKVPLREIARRTGLSRNTVRRWLRQTDAVEPK
FT                   YPKRVSPSVIDDWAAQLTGWLRADSHRPKRDRRTARFMFEAIRAEGYAGSYGRVSAFVR
FT                   RWHEEQAEAPRRKAFVPLAFEPGEAFQFDWSCEYAFVGGLRRRLEVAHVKLNSSRAFWL
FT                   VAYPTQSHEMLFDAHARAFAAFGGVPRRGIYDNMKTAVDKVGRGKERAVNARFEAMCSH
FT                   YLFEPEFCNRAAGWEKGIVEKNVQDRRRQIWHEASLRRWETLEILNEWVAGQCREAWHM
FT                   RHPQWPELTVEDVLQDERTRLMPNPRPFDGYVEQTLRVSSTSLIHFQRNRYSVPTEYTN
FT                   QLVSVRCYPAYLSVVVNAQEIARHERSFERHMTFYDWRHYITLVERKPGALRNGAPFIT
FT                   MPQPLQLLQRHLLKHPGGDRVMTQVLAAVREHGLDAVLLAVQAALDSGRPSAEHVLNVL
FT                   SRLKAPVTNGRLATTKLQLKEEPAADVGRYETLRANPPEDRHV"
FT   gene            45258..46055
FT                   /locus_tag="Bcen2424_3205"
FT   CDS_pept        45258..46055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3205"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bcn:Bcen_4955 IstB-like
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09951"
FT                   /protein_id="ABK09951.1"
FT                   /translation="MSNDIAAQLKGLKLHGMASTWPELLAQSRHTDFEPERFMKQLLMA
FT                   ETAERQVRSIAYQMTAARFPAHRDLKGFDFAQAHVDEALVRELSELSFLASAHNVVFIG
FT                   GPGTGKTHLASAIGIEAVQRHGKRVRYFSTVELTNALEQEKSIGKQGQIAHKLMYVDLV
FT                   ILDELGYLPFSQTGGALLFHLLSKLYEHTSVAITTNLSFGEWASVFGDAKMTTALLDRV
FT                   THHCHIVETGNESWRFRTSSAKAKTTRKRAEKPAGNEELSTPE"
FT   gene            complement(46105..46641)
FT                   /locus_tag="Bcen2424_3206"
FT   CDS_pept        complement(46105..46641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3206"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: bcn:Bcen_4954
FT                   NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09952"
FT                   /protein_id="ABK09952.1"
FT                   /translation="MSSRVPSTIFVIGGTGAQGLPVIRALVADGKYAVRALSRDPESRR
FT                   AIELSTLGNVSIVKGTFADEAVLRDGFRNCSAAYINLDGFNTGEKTEIYWAIRCYEIAI
FT                   EEDVKFFVYGNLDYALKRSGYDSRFRTGHYDGKGRVGEWILFQNLTNRDRMGAALLTTG
FT                   PYMEMAVSVLISTES"
FT   gene            complement(46823..47740)
FT                   /locus_tag="Bcen2424_3207"
FT   CDS_pept        complement(46823..47740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3207"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bcn:Bcen_4953 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09953"
FT                   /protein_id="ABK09953.1"
FT                   /translation="MNPAYFAFAALGFIWGTNFLFMKWASVDLAASQIVFLRVLFGFIP
FT                   LLTVALFTKALKWRHLRHAHHFVVMSLLATVIYYYAFAKGAGLLFSSIAGMLSGAIPLF
FT                   SFLCAWALLREERPNARMIAGIASGFVGVLLIARPWNAHAAGVNLLGVGYMVAGSLSVG
FT                   CSFVYARRFLSGLDLSPLALSTWQIGFALVLIGCVTNFDGIARVTSDARALLGLVLGLG
FT                   LTGTGIAYILYYFIVGRLGAVAASSVTYIPPVVALLMGSWLAQEPIGAVELFAMGAILG
FT                   GVFLLQRGRQPRAVAARGPAKAAG"
FT   gene            47840..48751
FT                   /locus_tag="Bcen2424_3208"
FT   CDS_pept        47840..48751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3208"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4952 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09954"
FT                   /protein_id="ABK09954.1"
FT                   /translation="MRSIPPLKALPAFEAAMRHGSFTLASRELNVTPGAIGQQIQKLEE
FT                   WLGVALFVRQIRQVTPTEDGRAYFAQIQPALAELIHASHRIRERRGSGVRLSMPPSFAA
FT                   KWFAPRMADFLQANPGIALSLSTSTTMVDFELDDVDLAVRHFDGMDARLSVQLLCHDEA
FT                   RAYCHPVYAKQRRLKRPDDLRTATLLHNTLHPHWATWLARFSGLDGSQIETITGIRFDQ
FT                   SLIAIDAAVRAQGVVLTSPLLVEAELARGELIEPFDNALALDAGYYLVHPASAGTKQAV
FT                   QLLKAWFTDSIARGCAQRGGYF"
FT   gene            complement(49093..50340)
FT                   /locus_tag="Bcen2424_3209"
FT   CDS_pept        complement(49093..50340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3209"
FT                   /product="Citrate synthase"
FT                   /note="PFAM: Citrate synthase; KEGG: bcn:Bcen_4951 citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09955"
FT                   /protein_id="ABK09955.1"
FT                   /translation="MQNWITLTEAARRLGVRAQTVYAYASRGSIAVMQDPDDPRKSLYR
FT                   AEDVVALCRKKQVGRKRAALAASTIFGAEPCIYSGITTFSKGRAWYRGRDSVQLADTAT
FT                   LEETAALLWQATTPVSFDPPALALPPGERDRQCAFTMLATLAAHGHSTLGRLDSALHIE
FT                   AGQLVAIVSRAFGAHDDAGASPLHTHQRLAAGWGLDSHGADLLRRAMVLVADHEITSSA
FT                   FAARITASTGASLAGCLLTGLATLSGPLHGDASGRVRAVFDDVQRLGAERVVDHHLKSA
FT                   IPIPGFGHHLYPDGDPRADALLARLDPPTELAHFVDKVTTLTGQRPTIDVALAMLSVQL
FT                   QLPRDAAFGLFSIARSVGLLAHCIEQLRVGKVIRPRSRYTGPTLDDRHLRPAADDDGKQ
FT                   TKVGVINKNRLFKVVE"
FT   gene            complement(50401..50793)
FT                   /locus_tag="Bcen2424_3210"
FT   CDS_pept        complement(50401..50793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3210"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bcn:Bcen_4950
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09956"
FT                   /protein_id="ABK09956.1"
FT                   /translation="MIEFKWDHLQLCSADAEATAAWFARCLNAEIVRRPGRVDLRIGAI
FT                   NLFITALPDACPAIVPDGARMQGIDHLGVLVEDLDAAYAHLVDNGAEIVQPVTRIRAGV
FT                   RGCFVRAPGDILVEVLERRPAEMTFN"
FT   gene            complement(50841..52127)
FT                   /locus_tag="Bcen2424_3211"
FT   CDS_pept        complement(50841..52127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3211"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_4949 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09957"
FT                   /protein_id="ABK09957.1"
FT                   /translation="MRGFDAHAGAARRSRVRYGVLSMLLVATVLNYVDRSALGIVAPAL
FT                   SKDLALTRVQMGELFAVFGLAYSIALLPAGVLADMLGSRVAYALSLVGWSLATLTQGLA
FT                   HGYHMLLGSRLAMGALEAPAFPSNARAVTMWFPVQERGFATSVYVMGQYIGTPLFTGLL
FT                   LWISSAFGWRTVFFATGAFGILFSVVWYRLYRDPSRHPRVNAAELQYITEGQPVVTARD
FT                   RFDWCMALRLLGYRQILAICLGKFCNNTLLVFFTTWFMTYLVEERHMSMIKVGFFQAMP
FT                   FIGATLGILIAGYLSDLCIRRGVSMSSSRKAPLVIGTFLGASIVLVNFVQSNALVIAIL
FT                   TVAFFAQGIGSMSWAAVSEIAPKRYVGLTSSITSLAANIAAVTTPLMIGYVTQHTGNFF
FT                   WALNLMGAICLLGTLSYSVLLGKLSRIEL"
FT   gene            complement(52222..52980)
FT                   /locus_tag="Bcen2424_3212"
FT   CDS_pept        complement(52222..52980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3212"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcn:Bcen_4948 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09958"
FT                   /protein_id="ABK09958.1"
FT                   /translation="MQAEKKIAAVTGAGTGIGQAAAVALAQAGFSVALLGRRIDPLLAT
FT                   QEIIELAGGVAAAIPTDVSDETSVDASFTRIAHDFGRLDVLFNNAGRNAGAVPLDDYSL
FT                   EFWNDVVATNLTGVFLCARAAWRQMKRQTPQGGRIINNGSISAHTPRPHTIAYTATKHA
FT                   VLGITRSLALDGRPFNIACGQIDIGNAATSLTERMDSGVLQADGRIAPEPRVDVVHVAS
FT                   AIVQMASLPLEANILNMTIMASAMPFVGRG"
FT   sig_peptide     complement(52912..52980)
FT                   /locus_tag="Bcen2424_3212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.468 at
FT                   residue 23"
FT   gene            53294..54256
FT                   /locus_tag="Bcen2424_3213"
FT   CDS_pept        53294..54256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3213"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: bcn:Bcen_4947 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09959"
FT                   /protein_id="ABK09959.1"
FT                   /translation="MPDNNRTQLLVARRVPAAVAARAAAEFNAYVTDADMDAPSVVEFC
FT                   NRYETPAVLIGKKSGLQAEHIAALPPSVKIIANASAGYDHMDVAAARARGIAVSNAPDA
FT                   LTDCTADFTMLLVLAACRRASEYERIVRAGWGKSFGMTDMLGTRVNGKTLGIVGFGRIG
FT                   RAVAQRARGFGMKIVYTDRRPAPPEIEAGARYCADLDTLLPQCDILTLHVPGGGTPLMT
FT                   RREFGLLCAGAVFVNAARGSLVDEDALYDALTSHRLFAAGLDVYRNEPNIDPRIAALDN
FT                   VFLSPHMASATVETRDQMGFTALDNVAAVLDGKGAPNAL"
FT   gene            54801..55946
FT                   /locus_tag="Bcen2424_3214"
FT   CDS_pept        54801..55946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3214"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, C-terminal domain protein; KEGG: bcn:Bcen_4946
FT                   mandelate racemase/muconate lactonizing enzyme-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09960"
FT                   /protein_id="ABK09960.1"
FT                   /translation="MKIVTIEVIRISLAFDAGRRPVAAVEPTVADTYNAADRSLRRMES
FT                   LLVRLTDDAGRVGWGEAFGHLINPVTFAALEGPVGRWFKGAEFEPTRHGIAALRDAADR
FT                   ALHAFGRTGPVLYALSAIDTALHDLAAQAAGVPLYRWLGGHRGEIDVYASLVNYDNDPD
FT                   EVARHVRRASDEGFRRIKLHETQRAAIAAARAALPAGSELMVDVNCPWTASDALRHVSE
FT                   LADLRLGWIEEPVWPCDDADGIARVRGAGVPIAAGENASGVAGFRDLFERGALDVAQPS
FT                   IAKIGGPTGIAEVIALAAEHGVRVVPHCFYYGAGLLATAHVVATLPDDVALEIPYLDWP
FT                   ERLHDGQRPGARLRLPDVPGLGFLPDEAVLARNTIAHATIG"
FT   gene            56029..57351
FT                   /locus_tag="Bcen2424_3215"
FT   CDS_pept        56029..57351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3215"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_4945 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09961"
FT                   /protein_id="ABK09961.1"
FT                   /translation="MRRHVPGSTGDNMKTRYRWWIGALLFGAGMLNYLDRAALSVVAPI
FT                   IKRELGIDDAQMGILFSSFFIGYCVFCFVGGWAADRFGPRRVFACAAGVWSLFCGATAL
FT                   AGSFAHLLIVRVAFGIGEGPMGTTTNKAISNWFPRREAGRAVGWTNAGQPLGAAIAAPI
FT                   VGLVALQFGWRVSFVVIATLGFVWLAAWWALFRDDPASHPRVSPEEVREIASDRTVGVS
FT                   LDAHADERAARPLLRDLLSRPVLGVALAFFSFNYVLYFFLSWLPSYLTDYQHLNIKQMS
FT                   VVGILPWLGATVGFVAGGTVSDRIYRRTGDVLFARKIVIVVGLAVAAACVLLASRVSSL
FT                   GAAVTLIAIASLFAFMAPQACWSLLQEIVPRERVGSAGGFVHLLANLAGILSPSLTGWL
FT                   VQYGGGYASAFVLAGASALAGAVILTFAVRARAVSQMRRAA"
FT   gene            complement(57495..58202)
FT                   /locus_tag="Bcen2424_3216"
FT   CDS_pept        complement(57495..58202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3216"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Male sterility
FT                   C-terminal domain; KEGG: bcn:Bcen_4944 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09962"
FT                   /protein_id="ABK09962.1"
FT                   /translation="MKIQGSVALVTGANRGLGAAFTRALLTAGAAKVYAAAREASTVTA
FT                   SGVVPVRLDVTRADQVEALARELGDVSLLVNNAGIGGSGAVLAPSSIDMLRQQFETNAV
FT                   GPLRMAQAFAPILAASGSSAMINVISALSWATLPGITGSYSASKAAAWALSNAMRQELS
FT                   AQGTEVLSLHVAFMDTDMARGVPGPKASPDEVARMALAALEAGHSELLADEVTRSVHAG
FT                   LTAVPPMYLGMLG"
FT   gene            complement(58227..58523)
FT                   /locus_tag="Bcen2424_3217"
FT   CDS_pept        complement(58227..58523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09963"
FT                   /protein_id="ABK09963.1"
FT                   /translation="MKYYLCKFIPPRPDFLATMSDDELKLMKRHGAFLDELFAQGVIVA
FT                   HGPVIDDTGGYGVSLYQIPDEDDIAAFTSQDPIVQNGVGHYEHYVMLRLTSHN"
FT   gene            complement(58603..59409)
FT                   /locus_tag="Bcen2424_3218"
FT   CDS_pept        complement(58603..59409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3218"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcn:Bcen_4942 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09964"
FT                   /protein_id="ABK09964.1"
FT                   /translation="MKKTILITGASSGFGLMLANKLHKDGFNVIGTSRQPEKYARNVPF
FT                   KLLRLDIDDDTSIESFTHELFTYTKQLDVLVNNAGYMVTGIAEETPLEVGRQQFETNFW
FT                   GTVKVTNALLPFFRKQKSGQIITVSSIVGLIGPPNLSYYSASKHAVEGYFKALRFELNQ
FT                   FNIKVSVVEPVWFKTNLGQNSVSSTGGNIPDYDAYRKQVRAATQKGIDEAEAPDAVVHT
FT                   ITKMIGTKEPKFSNPVGKMTGMILFLQSYAPKMFESSILKSVRTAG"
FT   sig_peptide     complement(59335..59409)
FT                   /locus_tag="Bcen2424_3218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.683 at
FT                   residue 25"
FT   gene            59748..60842
FT                   /locus_tag="Bcen2424_3219"
FT   CDS_pept        59748..60842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3219"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_4941 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09965"
FT                   /protein_id="ABK09965.1"
FT                   /translation="MNTKSNYPPSGRHGHPTDYAIWPGWRLLMQDAGIAASPVLRRAQL
FT                   PGDLFSRQNVRLDPTSFFMLWKAIEAEAATINADVPAALQIAKVMSSDWFDPELFAALC
FT                   SSNMGGALDRIAKYVRLIAPMIIRIDRAIEHTTVSIDFLDHTLPPPDVFLTFKLVFFVQ
FT                   LARLATRSPVRPLRVSWPLATGESNDSVAAYQAYFGVPVTDAPLATVVFAAEDIERPFL
FT                   TENHKMWQFFEPSLRQRLADLDRTASMAERVRSTLLETLPAGEVSMQVISRKLAVSVRT
FT                   LQRRLQDEGTSFQQTLDTLRESLAYHYLGNTTMSSAEISFLLGFDDSNSFARAFHSWTG
FT                   KTPHKVRTEIGVSNSESNADTAGV"
FT   gene            complement(61126..61530)
FT                   /locus_tag="Bcen2424_3220"
FT   CDS_pept        complement(61126..61530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3220"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   bcn:Bcen_4940 protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09966"
FT                   /protein_id="ABK09966.1"
FT                   /translation="MNDAKQLLSAYLESIRDPRAAAALFADDGVLELPYLKSLGIDGRA
FT                   QGPKAIEGFIASLLAKVPDFSFRNVRLLIETPEQVFAEYEVEALVPSTGKIYRQMYAGR
FT                   LVANNGKILLLREALDTMAAARAFSTAQAI"
FT   gene            complement(61564..62529)
FT                   /locus_tag="Bcen2424_3221"
FT   CDS_pept        complement(61564..62529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3221"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bcn:Bcen_4939 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09967"
FT                   /protein_id="ABK09967.1"
FT                   /translation="MNTQATPNTPDTATVTFLDALNSATGPAIETLTPAEAREVLAGAQ
FT                   RSVPVDVSGIDVTRRTVEQDGLVVSLVVVKPQDSRGVLPVFMFFHGGGWILGDYPTHER
FT                   LVRDLVVQSGSAAVFVEYTPSPEARYPVAINEAYAATKWVAAHGAEIGVDGARLAVVGN
FT                   SVGGNMAAVVSQMAKDRQGPAIRFQGLMWPVADHAFDNASYDAFANGYFLSRDMMKWFW
FT                   NAYTIDEGERNERYASPLRASLDELKGLPPALIQTAQFDVLRDEGEAYGYRLDQAGNDV
FT                   TTIQYKGTIHDFGLLNVLAADAPTRAAMQQMATALKTHLQ"
FT   gene            complement(62692..63609)
FT                   /locus_tag="Bcen2424_3222"
FT   CDS_pept        complement(62692..63609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3222"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4938 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09968"
FT                   /protein_id="ABK09968.1"
FT                   /translation="MAQLPDFEGLAMFAKVAEHGSFAAAARATGVSVATVSRGVARLED
FT                   RLGARLFNRTSRQLSLTEFGRTISEKAGEIYHQAEEAESSAREMSVQPRGLVRLAVPMS
FT                   YGLRWVAPLLPGFFRAYPEVSIDLHLSDASVDLVADGFDAALRIAALPDSSLVARRLCA
FT                   VTQFVVASPEYLRREGRPTHPRELVDRPCLSYAYRARSAVWRFTNDAGEEEPVMPTGPL
FT                   RVTNSDALLPTLLDGLAIAELPEFIAGEYLADGRLEAILTDWSLTKGGLYFVTPSARAR
FT                   PAKVAALSDYFAEHLSEPTWRWPK"
FT   gene            63747..64511
FT                   /locus_tag="Bcen2424_3223"
FT   CDS_pept        63747..64511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3223"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_4937
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09969"
FT                   /protein_id="ABK09969.1"
FT                   /translation="MARKLDNKIALVTGATSGIGLATAQRFAAEGAHVYLTGRRQVELD
FT                   AAVKGIREAGGNATGVRSDSTQLDELDALYAQIKEEQGRLDVLFVNAGGGSMLPLGNIT
FT                   EAHYDDTFDRNVKGVLFTVQKALPLLAEGASVILTGSTAGSAGTAAFSVYSASKAAVRA
FT                   FARSWILDLKERRVRVNTISPGATRTPGLLDLAGDDATQRQGLADYLASLIPMGRLGEP
FT                   EEIAGAALFLASDDASFVNGIELFVDGGQQQI"
FT   sig_peptide     63747..63833
FT                   /locus_tag="Bcen2424_3223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.941 at
FT                   residue 29"
FT   gene            64595..65302
FT                   /locus_tag="Bcen2424_3224"
FT   CDS_pept        64595..65302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3224"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; KEGG:
FT                   bcn:Bcen_4936 pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09970"
FT                   /protein_id="ABK09970.1"
FT                   /translation="MIEHRPFPSLDAIRRDGVDVRQHFRAGDVGHADHAPLGPLHMWND
FT                   IEFAQHAGLGLRVHRDVEIVTWVRSGAITHEDDAGNRARLVANCVHVMSAGTAIHHAER
FT                   NEENIPARQFQIWLRPRTPAGTPRCSTRVCSPGCREGRFVTLASGDPEDVRTGALPLHA
FT                   DARVRIATLREGAAMQHVLPMPGSAYLVADHGRLDIGPIRLTRRDGIAVRDEARLVLRA
FT                   RDDTDVVIVELLR"
FT   gene            complement(65670..65927)
FT                   /locus_tag="Bcen2424_3225"
FT   CDS_pept        complement(65670..65927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09971"
FT                   /protein_id="ABK09971.1"
FT                   /translation="MKQIIVTAGLALLASAPLTSFAQSDMPLSRAQVRAELANLEQAGY
FT                   NPLSVDVDYPAGLQKAEARLQAEQTSSQRQAAIQSGAQQH"
FT   sig_peptide     complement(65859..65927)
FT                   /locus_tag="Bcen2424_3225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 23"
FT   gene            complement(66065..67009)
FT                   /locus_tag="Bcen2424_3226"
FT   CDS_pept        complement(66065..67009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3226"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4934 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09972"
FT                   /protein_id="ABK09972.1"
FT                   /translation="MDYAAWKLFIDAAELGSLSKAAVAYGTSQPHISRQIVELEQYCGG
FT                   RLFQRTGRGVVLTDLGARIAPRVRTWLASTEQLSNDIRSSAGEPIGVVRLGILPSTAHP
FT                   LVSTLYHRLRERYPLVQLQVREGQGALLDTWLENGSVDLAILFRNSPTPKDGDEYLVEA
FT                   ATYLVGAEGDPLTKHPTIAFSKLDGIPLVFFCRPNSWRDRLEQIAGEHQVSLNFAAEAD
FT                   SLSLQGHIVADGGIYGLLGPYAIATLEKECRLQASMVVEPSVPRFIALAMSPHGELTLA
FT                   CRTVKQLTKEIARSRALSSDLRLGVSAAFLRSI"
FT   gene            67191..68114
FT                   /locus_tag="Bcen2424_3227"
FT   CDS_pept        67191..68114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3227"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bcn:Bcen_4933 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09973"
FT                   /protein_id="ABK09973.1"
FT                   /translation="MKAIDLRGLVPAPVTPFTRDGAVDHAAIQRLGSWLGSIEGVKGLT
FT                   VLGHAGEGTFMTQKEQAQVIESFVKSVDGKIPVIAGITLEGTQVAVDEAKRAVEAGASA
FT                   GLVYPSHGWLRFGYQKGAPQDRYRAIYEGSGLPLILFQYPDATKATYNLETQLEIAAQP
FT                   GVFAMKNGVRNMRRWDVEIPIIRRERPELQILTCHDEYLLHTMFDVDGALVGYGGLAPE
FT                   PLIELIKAGKAKDYAAARAIHDRLLPVTRNVYHRGSHMEGTVALKHGLVARGILEHATV
FT                   RSPLLPLAEGADVEIADALRSAGLVD"
FT   gene            68351..69793
FT                   /locus_tag="Bcen2424_3228"
FT   CDS_pept        68351..69793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3228"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_4932 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09974"
FT                   /protein_id="ABK09974.1"
FT                   /translation="MNTPLTAYSVGVGQSESATRTTSEQLRAANLLFRIENVPFCRWHT
FT                   KARIIMGSATLFDAFDALSLAFVLPVLIGLWHLSAGQIGVLIAAGYLGQVVGALVFGWL
FT                   AERIGRVPSATVTVGVMSAMSIVCAFTGSFHMLFLMRFLQGIGVGGEVPVAATYINELS
FT                   QAHGRGRFFILYELIFPLGLLAAAQLGAFIVPRFGWEYMFLVGGIPGIIVAFLIARLPE
FT                   SPRWLISKGRFDKAEGIIERLEASTPKRNLDTKTQKAEVDERVVGLLNGLQSKQTGSWK
FT                   ELFSPFYRGRTIVVWLLWATSYFVANGINNWLPSLYKTVYHLPLQESLHMASISNVLST
FT                   CGVLACALLIDRVGRRRWAMACFIISGILLAALGIHGAGSAWSVMFLGSSAYAVMATTT
FT                   VLLYLYTPEIYPTRMRAIGTGLATSWLRAASAAAPAIVGVVLTGKGIAAVFILFAVVSA
FT                   VGFFVASRMVETTNRALEEISP"
FT   gene            69984..71057
FT                   /locus_tag="Bcen2424_3229"
FT   CDS_pept        69984..71057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3229"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_4931
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09975"
FT                   /protein_id="ABK09975.1"
FT                   /translation="MKKAQRVMARASMRKVAGTLGVAAMLSAGLALTSVGARADSGSQV
FT                   QLYGIVGTYVGSVKRSDTPQSTVLIGSGGLTTSFWGIRGKEDLGGGVSAIFALESFFQP
FT                   QNGAQGRNATDPFFSRNAYVGFQGDFGQLTFGRQRNPTYTAESLINPFSSSTVFSPLVL
FT                   QTFVTNYGGTIIGDTVWNNTAKYTTPDFKGFGATVIYGLGGVAGSPGVGNLGAHLNYQG
FT                   HGLTAVVSGQRVRYTAAGPVGAQYAYLAGAAYDFKLVTLYGAWAMTSDVSTPTGSHTYE
FT                   AGFSIPFTPADFLLAEWARTQRSGPTHTTNSLRNTAALGYDHLLSKRTDIYAIYSIDKL
FT                   SDHPIGNTFAVGIRHTF"
FT   sig_peptide     69984..70103
FT                   /locus_tag="Bcen2424_3229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 40"
FT   gene            complement(71289..71417)
FT                   /locus_tag="Bcen2424_3230"
FT   CDS_pept        complement(71289..71417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3230"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bcn:Bcen_4941 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09976"
FT                   /protein_id="ABK09976.1"
FT                   /translation="MSGAEISFLLGFEDPNSFARAFQAWTGKTPQAVRSALRQDGP"
FT   gene            complement(71447..71734)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3231"
FT   gene            71783..73180
FT                   /locus_tag="Bcen2424_3232"
FT   CDS_pept        71783..73180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3232"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_5505 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09977"
FT                   /protein_id="ABK09977.1"
FT                   /translation="MGRIAEWVYQITGRGAMHSPGAPSLRHEIERRFWKQIATGVTSER
FT                   AAEAVGVSSAVGSRWFRYRGGMPLFMSKPISGRYLSFAEREEIGLLSAQNIGVREIARR
FT                   IGRSPSTISRELTRNAATRGGRLEYRASVAQWKAEHFAKRPKPAKLATNQRLHHYVQER
FT                   LEGKVCDADGRKIAGPQQAPFKGRNKPHRGDRKWVNGWSPEQIANRLRIDFPDDESMRI
FT                   SHEAIYQALYIQGRGALKRELVGCLRTGRALRVPRARARAKAWAHVSEDVMISSRPAEV
FT                   EDRAVPGHWEGDLLIGLNRSAIGTLVERSSRFTMLVHLPREKGYGLIPRTKNGPALAGY
FT                   GAVTMANALKKTVTDMPARLWRSLTWDRGKELSDHARFTVESGVQVFFADPHSPWQRGT
FT                   NENTNGLLRQYFPKGTDLSRWSAQEIQAVAHTLNTRPRKTLGWKTPAEALNEHLKSAQQ
FT                   SRVATTG"
FT   gene            complement(73334..73708)
FT                   /locus_tag="Bcen2424_3233"
FT   CDS_pept        complement(73334..73708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3233"
FT                   /product="putative transposase protein"
FT                   /note="KEGG: rso:RSc2313 putative transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09978"
FT                   /protein_id="ABK09978.1"
FT                   /translation="MSRSCLYAHRGRARRVDTERMVLRSRVHELFIESRSSAGSRSIMG
FT                   MMREEGTAIGRFKVSRLMEELGLICKQPGRHAYKQATVERIDIPNHLNREFEVGTPNQV
FT                   WCGVVTSRMSGRRDVGIIWP"
FT   gene            complement(73762..74070)
FT                   /locus_tag="Bcen2424_3234"
FT   CDS_pept        complement(73762..74070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3234"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bcn:Bcen_4929 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09979"
FT                   /protein_id="ABK09979.1"
FT                   /translation="MSKQRRTFSPEFKQQAACLVLDQGYSHMEASRSVGVGETVLRRWV
FT                   QQLQMERQGVTPQGKAITPDQQRIQELEARIERLEREKAILKKATALLMSEGIERTK"
FT   gene            74109..74234
FT                   /locus_tag="Bcen2424_3235"
FT   CDS_pept        74109..74234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09980"
FT                   /protein_id="ABK09980.1"
FT                   /translation="MSGFIRPLQSGDVSAIAAGVVGWAVFALFLHDPLIGVRPFG"
FT   gene            complement(74441..75178)
FT                   /locus_tag="Bcen2424_3236"
FT   CDS_pept        complement(74441..75178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3236"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bcn:Bcen_4927 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09981"
FT                   /protein_id="ABK09981.1"
FT                   /translation="MLVLIILAGLWAGLQNALAGGGSFVTLPALIVSGMSPLAANITST
FT                   VALFPGQVTTGWASRKMVRGAGTLSFRALFVISVIGGALGGLLLLKTPSSIFSQLVPWL
FT                   VLFATVVFAWGSFFRKPTEAAQHLGPMAAGISQFLIAIYGGYFGGGIGFLMMAALTMAG
FT                   LSPRHAMSTKNALAGVMNASAVLLFVTSPQLHWGAALALGSGAIVGGLLGAWALHRVNE
FT                   RVLRIAIVCIGAALTVGLFVRPI"
FT   sig_peptide     complement(75119..75178)
FT                   /locus_tag="Bcen2424_3236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.939 at
FT                   residue 20"
FT   gene            complement(75454..76029)
FT                   /locus_tag="Bcen2424_3237"
FT   CDS_pept        complement(75454..76029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3237"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   bcn:Bcen_4926 protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09982"
FT                   /protein_id="ABK09982.1"
FT                   /translation="MTLPFYTIGHSNRTLDELVAMLRAVDITLLVDIRKMTRSRTNPQF
FT                   NEATLPDALAAADIGYEHIAELGGLRGKSRDVPDALNGFWTNRSFHRYADYALSPEFRA
FT                   GLARLIALGEQQRCALMCSEAVWWRCHRRIVSDYLLARGETVLHIMGLNRVEPARITAG
FT                   ATVRDDGAIVYPDADGDTQEDAAAQSNE"
FT   gene            complement(76026..76253)
FT                   /locus_tag="Bcen2424_3238"
FT   CDS_pept        complement(76026..76253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09983"
FT                   /protein_id="ABK09983.1"
FT                   /translation="MTTPFEPGDHVRWNSEAGYVTGTIIAVHTQDFDYKGHRHRASPDD
FT                   PQYEIKSDRTDHIAAHRGRVLERVAGKERT"
FT   gene            76444..76779
FT                   /locus_tag="Bcen2424_3239"
FT   CDS_pept        76444..76779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09984"
FT                   /protein_id="ABK09984.1"
FT                   /translation="MTTLLWPTARRRSGEADESRSRSDRPAFGAVSERPPRIGARFGNG
FT                   PPTGHRASAKLWQFLQMRCHLPQIHAGWMSIKYASRRRFKAPTCRVPVLRPGSEQALCD
FT                   VDGRDAS"
FT   gene            complement(76866..77222)
FT                   /locus_tag="Bcen2424_3240"
FT   CDS_pept        complement(76866..77222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09985"
FT                   /protein_id="ABK09985.1"
FT                   /translation="MSRNPAVAFCLNEFGPHFGARLSARDHGRGAARIDYTGARGKRDA
FT                   RDEPEYRCNCRAHENLLPCEAVAPRSDEAIHGEQHDVRDLLSRRIADHDVGPLNGARGH
FT                   DCLCDFRNDKFHDD"
FT   gene            complement(77415..78587)
FT                   /locus_tag="Bcen2424_3241"
FT   CDS_pept        complement(77415..78587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3241"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_4922
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09986"
FT                   /protein_id="ABK09986.1"
FT                   /translation="MKTKKIEIIVGSLVGLASSVAHSQSSVTLYGEIDNGIHYQTNVGG
FT                   GKAVYMDSLDGIDGSRWGLTGKEDLGGGLKAIFTLESGINVNNGQFAQGGTAFGRQAFV
FT                   GLSSDTYGSLTAGRQYDMVWYFPEFLAGSAAVGDLPSAHPGDFDNTSNSVRFNNSVRYM
FT                   SPDFRGFSFGVEYSLGGVPGDFTSMSGYSLGVGYTHGPLQIGAAFDYFKHPTSTPGNGW
FT                   FTNYASGFNLLASSLNSAYQVAQAYQDAVIAAAYTIGNATISASYSNVQYANLGAGFMN
FT                   GTAVFNNYDIGLNYRVTPVFFVGVAYDYMNARSVTTAQGNAVGNQHYNQVAFTLDYLLS
FT                   KRTDVYFSGGWQRASGTSSTGAPAVANIGGSGDSSNNHQMVYRLAIRHKF"
FT   sig_peptide     complement(78516..78587)
FT                   /locus_tag="Bcen2424_3241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            complement(78662..80011)
FT                   /locus_tag="Bcen2424_3242"
FT   CDS_pept        complement(78662..80011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3242"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_4921 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09987"
FT                   /protein_id="ABK09987.1"
FT                   /translation="MEIRKINVYDIIDSRRIGRRQYFIVAFCALLMLFDGFDTQVISFI
FT                   VPVLAKEWQLPKAVFGAIFSAVFFGLLIGNFGIPFATRRFSTKKIAFVATAAFGLFTVL
FT                   TVFATSVPQLIALRFLTGIGLGAATPCAVGLVSEFSPKRTRATFVILVYMGYALGFIFA
FT                   GICSSALIPRFGWEGPLWLGGLAAVGLTVLLVPLLPESVAYLSANAQPGELLRATKRLF
FT                   PDFTLQADSELVTHEEKPADASVLGLFSAQFRVGTFLLWAVFAINLAAFYFLQSWLPTV
FT                   LASISFPPALVVWATITVIIGGMVASLLMGPIMDRTSPYRILSAVYVGGAVSMYAISIA
FT                   IGSSHLALLTTIFFCGFCISGGQTCAIALCTLFYSPELRAPGVAWAYGFGRLGAAGGTY
FT                   LAGVLYANNWSVDAMFRVAAAPILIAAACVALMGACYGLTKNGLKKSFSA"
FT   gene            complement(80335..80619)
FT                   /locus_tag="Bcen2424_3243"
FT   CDS_pept        complement(80335..80619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09988"
FT                   /protein_id="ABK09988.1"
FT                   /translation="MCFVHGLWRVTCTLDEPGEPHDGVEQIGVDGTAKFSGPPTANYAS
FT                   IDRSHRTICRTEHRRGNTRIINTAWTAAIFLRAIKMTSRSRRPGFLQTQ"
FT   gene            80715..81692
FT                   /locus_tag="Bcen2424_3244"
FT   CDS_pept        80715..81692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3244"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_4919 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09989"
FT                   /protein_id="ABK09989.1"
FT                   /translation="MKSWRHSSVARDAAVPAYASHRSPQFQHVARMPDMNRYVSLPDFA
FT                   DPDAIDRPAVAMCMHVDEHAAEIPVHKHQKGQLVLALHGAVTCRVAGAFWIVPPQCGVW
FT                   IPGEMPHSNHATPNARLCYLFAEPGVVDLPTECCTLSISPMLREMILHLAGAPLDYEQG
FT                   GHTDRLARVLLHELTLMPVERLYLPVTDHPRIRQMADALNANPGDRSTVAQWAKRLAMS
FT                   ERSLARLVVSETGLTFGRWRQQLQLLVAVRELAGGASVQRVSDELGYESVTAFITMFKK
FT                   ALGHSPGRYFAALARTQSEAGLAPAAATEMDDRADGAADVVGDA"
FT   gene            81908..84622
FT                   /locus_tag="Bcen2424_3245"
FT   CDS_pept        81908..84622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3245"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: bcn:Bcen_4918 2-oxo-acid
FT                   dehydrogenase E1 component, homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09990"
FT                   /protein_id="ABK09990.1"
FT                   /translation="MTDLSTGTPSILSLGQTKVDDDPLETAEWLDALDGVVRHAGAERA
FT                   QYLFDRLAAHASSNGIATARLNVTPYVNTIAVAQQPPYPGDFDIEEKLAAALRWNALAM
FT                   VVRANRAYGELGGHIASYASAADLFEVGFNHFFRGANDANGGDLVYFQPHSAPGVYARA
FT                   YLEGFLDEAHLEHYRQEITGAGLCSYPHPWLMPDFWQFPTGSMGIGPINSIYQARFMRY
FT                   LQNRGLQRTEGRKVWGYFGDGEMDEPEAIGALSLAARERLDNLVFVINCNLQRLDGPVR
FT                   SNGRIIDELEAQFTGAGWNVIKVLWGSDWDPLFARDRSGALLRAFAHTVDGQFQTFSAN
FT                   DGAYNRDRFFGQNAELAALAAHLSNDDIDRLRRGGHDVRKLHAAYDKASKHSGQPTVIL
FT                   AKTMKGFGMGSIGQGRMTTHQQKKLDIEQLKAFRDRFRLPLSDDDVEQLKFYKPDESSA
FT                   VMQYLHARRAALGGYLPRRRTAASHAPAVPAMSSWGRFALDTNDKEMSTTMAFVRMLGN
FT                   LLKDAELGPRVVPVVADEARTFGMANLFRQIGIYSPLGQLYEPEDMGSMLYYREDTGGQ
FT                   ILEEGISEAGAVSSWIAAATSYSVHDLTMLPFYIYYSMFGFQRIGDLIWAAADQRARGF
FT                   LIGATAGKTTLGGEGLQHQDGTSHLAASTIPNCRAYDPAFAYEVAMIVDEGMQEMIARQ
FT                   RDVFYYMTVTNENYAQRSLTEADLDRVRSGVLKGMYVLEPAQIEIAQVQLLGSGAILGE
FT                   VQAAARMLKDDWNIDAAVWSVTSFTELHRDGVSAERAQRLLDHGEPAVPYVTAALGAAR
FT                   GPVIAATDYVRAVPELIRAYVPSRYVVLGTDGFGRSDTRAALRAFFEVDRASIVIAALK
FT                   ALVDEGRQDPDVVRQAIDRYGRSGTGLTEPWLV"
FT   gene            84758..86119
FT                   /locus_tag="Bcen2424_3246"
FT   CDS_pept        84758..86119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3246"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /note="TIGRFAM: pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; catalytic domain of
FT                   components of various dehydrogenase complexes; E3 binding
FT                   domain protein; KEGG: bcn:Bcen_4917 dihydrolipoamide
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09991"
FT                   /protein_id="ABK09991.1"
FT                   /translation="MKCLLLETNVRVTRIEVPDIGDYKNIPVIEVLVGVGQRVEREQSL
FT                   VVLESDKATMDVPSPTAGVIKEMKVAVGETVSQGTLIALLDSDGERQDDAAPVPPAASA
FT                   ARDLACPSANVATGLVPALAPAPELNSASAPLHHAPAREGEPSRASHASPSVRKFAREL
FT                   GVDVARVSGSGPKGRITKDDITGFVKGVMSGQRAAPGAAAAPAGGGELNLLPWPKVDFA
FT                   KFGPFEPKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEALRVQLNKEHEKAGVK
FT                   FTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTPNGLVVPVIRDADKK
FT                   GLVDIAKEMAELSKAARDGKLKPDQMLGGCFSISSLGGIGGTHFTPIINAPEVAILGLS
FT                   RGQMKPVWDGKQFVPRLTMPLSLAFDHRVIDGAEAARFNAYLGALLADFRRIIL"
FT   gene            86394..88181
FT                   /locus_tag="Bcen2424_3247"
FT   CDS_pept        86394..88181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3247"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; KEGG: bcn:Bcen_4916 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09992"
FT                   /protein_id="ABK09992.1"
FT                   /translation="MSLIEVKVPDISDFNGIDVIEVNIKPGDVIEKEQTLLTLESDKAS
FT                   MEVPSHIAGTIKEIKVKAGDKVSQGTVIALVEASANATAPAKAPEPAKPVAAAAPAAAP
FT                   AQAAAAAAAAPAPQAGSYGGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLIERYST
FT                   LGGVCLNVGCIPSKALLHTALVVEEAAALASHGITFGKPQVDLDKLRDFKGGVVKKLTS
FT                   GLAGMARARKVEVVTGIGAFVDPFHMEVQGDNGKKIVKFKQAIIAAGSQAVKLPFMPED
FT                   PRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVVEMMDGLMMGADRDL
FT                   VKVWEKFNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPN
FT                   GKKIGADKAGVAVTERGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAA
FT                   HGEKAYFDALQIPSVAYTDPEVAWAGKTEDQCKAEGIKYGEAVFPWAASGRAIANGRDE
FT                   GFTKLIFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTIHPHPTLGESVG
FT                   MAAELYEGVCTDLPPPRKA"
FT   gene            88337..88939
FT                   /locus_tag="Bcen2424_3248"
FT   CDS_pept        88337..88939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3248"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bcn:Bcen_4915 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09993"
FT                   /protein_id="ABK09993.1"
FT                   /translation="MPAGAEIDVLPRKRAFELQGTGALCKEETRAMNVALDRIDLSILS
FT                   ELQEDSSLTNLELAARVNLSPSPCLVRVRNLERLGVISRRVAVLNASLLGLGIMAIVEI
FT                   SLERQGMQARESFADTVRGITEVMDCFMMTGQTDYLLRVVARDLVELEHIITHKLTSLP
FT                   GVASVRSNVVLKRLANKTTLPIDKTRPIQIHGLAQAS"
FT   gene            88962..90110
FT                   /locus_tag="Bcen2424_3249"
FT   CDS_pept        88962..90110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3249"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   GTP cyclohydrolase II; KEGG: bcn:Bcen_4914
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09994"
FT                   /protein_id="ABK09994.1"
FT                   /translation="MSNAMSAGRPADSRADIATALEIIEEARAGRMFILVDDEDRENEG
FT                   DLVIPAQFATPDAVNFMATHARGLICLAMTRSRCESLGLHLMSRINGSRHETAFTVSIE
FT                   ARDGVSTGISAADRSRTISLAINPETGRDELVSPGHVFPLMARDGGTLVRAGHTEAAVD
FT                   IARLAGLAPAGAICEIMNDDGTMARLPDLIAFSRRHQLKLGTIADLIAYRRRTERLVEA
FT                   VEHGSFTEPNGRHWRIVVYRNRIDQVEHIAFVMGDLRGADPVLVRMHAMDTMNDVIGGH
FT                   HLASLRGAARLLENENRGVIVVIRESRPTAVSERVRAMMHPKPAEPELRDYGIGAQILT
FT                   ELGVKNMILLSNHERTIVGLEGYGLNMVEQRKIERIHDDQEV"
FT   gene            90312..91949
FT                   /locus_tag="Bcen2424_3250"
FT   CDS_pept        90312..91949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3250"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_4913 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09995"
FT                   /protein_id="ABK09995.1"
FT                   /translation="MKTTAENPYTIGLERDPANFIALSPLTFLERAASVWPERTAIVHG
FT                   TIRRDWAETYRRCRMLAGALRGRGIGNGDTVAMIAANTPELFEAHFGVPLCGAVLNTIN
FT                   TRLDADTIAFILGHGDAKLLITDREFSSTVKKALARLGRAIQVIDIDDPQFGEGDLLGE
FT                   KDYEALLQEAAHTEFSVAMPEDEWQAISLNYTSGTTGNPKGVVYHHRGAYLNAVSNALS
FT                   WHLDEDTTYLWTLPMFHCNGWCFPWTMALVAGTSVFLRHTRAERILAAIRTEAVTHFCA
FT                   ASVVLNMINNAAPELKAGIRHGVKVMTGGAPPPASVIAGMERMGWDVTHAYGLTESYGP
FT                   VVQCVWRDSWNALDLDAKARLKARQGVRGPALEAVMVASPDTLEPVPKDGQTLGEVFLR
FT                   GNNVMKGYLKNSDATVEAFSGGWFHTGDLAVWHPDGYLEIKDRSKDIIISGGENISSIE
FT                   IEDILYSHPAVLEAAIVARPDDKWGETPCAFIALKDDSAVTEADIIAFCRERLAHFKVP
FT                   KTIVFSPLPKTATGKIQKFHLRERARQL"
FT   gene            complement(91987..92808)
FT                   /locus_tag="Bcen2424_3251"
FT   CDS_pept        complement(91987..92808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3251"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_4912 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09996"
FT                   /protein_id="ABK09996.1"
FT                   /translation="MSASRAMTDPVKINYQPFDPDSVDLPVISVLLETSGKEDELPMHV
FT                   HRKGQLVVALSGSVMCRSPSGWWIVPPNGAVWIPGGIPHSNHASDFAKLYVIFIPPDEA
FT                   GLPTDCRSFTITPLIRELIRSLARFPPDYPKDGPVGRLARVLLDQLALLAPDDVFLPIS
FT                   DNPRLQQIASALLDNPADRSTIAEWGRRYAMSERTLARLVRSETGMTFGRWRERLHIII
FT                   ALQRLSAGASVHAVALELGYEGPNSFITMFKKTMGQSPGKFRVDQKEASSR"
FT   gene            93027..93791
FT                   /locus_tag="Bcen2424_3252"
FT   CDS_pept        93027..93791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3252"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bcn:Bcen_4911 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09997"
FT                   /protein_id="ABK09997.1"
FT                   /translation="MKTDELICTRIDADVVQLTIDRPPANALNEPLITALMSVFRDFAR
FT                   HDVPPGIVFTGAGEKFFCAGGDINEVADHELALSRMEAFHAFLAQLEQYPSPLVCAVNG
FT                   YAVGAGFEMALHADYVVASAESRLGFPEINHGLLPAAKGMRHAAALLGRRAARSLLFSG
FT                   ELITAGEALAIGAVDAISAHDETLRDALAKCRALCAKDRQLFAAIKRTLRESPRMNDEA
FT                   LLQMTLDDLRGYLGNARTADARSRFLNRNKKA"
FT   gene            93794..94573
FT                   /locus_tag="Bcen2424_3253"
FT   CDS_pept        93794..94573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3253"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: bcn:Bcen_4910
FT                   creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09998"
FT                   /protein_id="ABK09998.1"
FT                   /translation="MSNLKLPETLHLARMTYEGVAAALATQFDRVIIPCGAIEQHGPHL
FT                   PLSMDADHADALAVEIATLLGRTLIAPTIRVGCSKHHMAFPGTISLQEHTYAALCHDYC
FT                   VSLAAHGFKCIYLFSAHVGNFNALHAMLPELRQAVGPDVQVLAYTDHQAWLREWRLAVE
FT                   EAGGDPESVGGHADIAETSLMIHLDPDSVRLARLTAGHVGAMTTEQLNRMWKEGVASIS
FT                   RNGVLGDARGSSREIGEACLRATARLLASAFAAESST"
FT   gene            94864..96018
FT                   /locus_tag="Bcen2424_3254"
FT   CDS_pept        94864..96018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3254"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: bcn:Bcen_4909
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK09999"
FT                   /protein_id="ABK09999.1"
FT                   /translation="MPLKFGFWSEQETQVGHSYSNRLRELVREARFAEQMGFDFVALSE
FT                   QHFALGGVSSSAPEVVFGYLAAVTSRIKLRPAVALMPKAINHALRTAERLAATDILSEG
FT                   RMEMYCGRANTTIAMRAFNVSPEETLPQMEEGMALLRKAMREDVFTFEGKYYQVPPRSL
FT                   VPKPLQKPYPVLGVAATSANSHAWAGSEGLAVMSHAIYQGWEKQKGLLDTYWNSWKRDE
FT                   TGPLHKPRAGMPIFIGIGKTDQEAKDIYAGAIMNYARISTDAYPRLAKLADNYAYMAES
FT                   VPAMQRAAEDWDYLLNESATTVCGSPDTVIRQLEQYEKLGIDEVLLHIDSVPHEQIMST
FT                   IDMVGRYVIPHFNDRNNIVRPTDELLEKIRAMRPQAANPKQSQG"
FT   gene            96023..96811
FT                   /locus_tag="Bcen2424_3255"
FT   CDS_pept        96023..96811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3255"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bcn:Bcen_4908 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10000"
FT                   /protein_id="ABK10000.1"
FT                   /translation="MNTSSRYQYLNVEQRSSGVAIVTMNRPEILNAINWDMHDELERVF
FT                   VELDHDKAVKAIVLTGAGRGFCSGGDQKSIDNGNIPSATRGGRHLIRNMLEVEVPIVAA
FT                   VNGVAVGLGATLALFCDMIYASPTARFADTHVNAGVVAGDGGAVIWPLLLGPVRARHYL
FT                   MTGDFVSAEEALTMGMINKIVESDKLLEAAIDYAELLASGPRDAIVWTKYCVNKLVKQN
FT                   AHLLLDTSIALETITFNSPERREAVASFTERRKRFGDNWK"
FT   gene            96808..98715
FT                   /locus_tag="Bcen2424_3256"
FT   CDS_pept        96808..98715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3256"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_4907 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10001"
FT                   /protein_id="ABK10001.1"
FT                   /translation="MSAAPWTSGNQFATTTIPALLIERVKNDADANAFFQRRAGAWVPT
FT                   TWKGYANAVCSVSAALGAAGVARGDRIAIMGDVSQEWLIADMATICSGAVTVGVYFTAS
FT                   VEEVRYYLEDSGATLAFAGSAEQLRVMKAADTSSRLLKIVVLDPDWKRSPDETGMNVVS
FT                   LAEFASHFDGDEVAYLREQSELARPTDLVSLGYTSGTTGAPKGAMLTHVSMLAGAFTWP
FT                   TFCPAILSEPQRMVIHLPLSHTVARIQATTLPLIAKTVPYFVDVSADFAKCIQEVRPTS
FT                   YMAPPRFYQKFATQIINHVNGSSEAERRNYTLALGIAREVLADRQDAGTGDPFKEQLYA
FT                   ICREHVFKPLLARIGFDDLRYPYTASAPVPPEVVTLFQLWGVNLKENYGQTEMVGGNLA
FT                   QVTDWSRPGNSGVPLDDPAWETRVLPDGEMIVRGPGLFIGYWNKEAETKAALRDGWLYT
FT                   GDIVDVGADGSYKLIDRKKELINTAAGKSISPVQVENELRQSPYITEALVIGEGRKYLT
FT                   ALIEVDGTLAMDWARTHDPSVTQYADLASSQPVIDLIREEVEKANARLARAEQIKAFRI
FT                   FPEELTPENGVMTATRKKRRKALMARYAHIIAGLYDDAEEQLIKEQLVGSGTAASVHRQ
FT                   "
FT   gene            98806..99387
FT                   /locus_tag="Bcen2424_3257"
FT   CDS_pept        98806..99387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3257"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: bcn:Bcen_4906 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10002"
FT                   /protein_id="ABK10002.1"
FT                   /translation="MLHARTRGAPPRSRTAVPSTERGTAVIALSPDRTTFREAMSRIGA
FT                   AVNIITTTTPSGDVGMTVSAVCSVTDDPATVLVCIDRSSRQYGHFSKAGIICVNVLSHE
FT                   HEMLAPIFAGKGDVQMTERFTYGEWIRLVTGAPVLATAAASLDCTVDRSIDIGTHTVFF
FT                   CAVQALHLGSACTGLVYHGRAYHRLPQQHA"
FT   gene            99641..101440
FT                   /locus_tag="Bcen2424_3258"
FT   CDS_pept        99641..101440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3258"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4905 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10003"
FT                   /protein_id="ABK10003.1"
FT                   /translation="MLAEILKEASANRDFLKLSGGCLAVAFLQRKLGQCSLTLLARCTC
FT                   SLILLAHVSRGLIGIHMASIEERAARAAKIASVLRPLGNGVLSRQQAERAAQLLGVHCT
FT                   TVYRLRRRFLADPVASTLEPRQPGRATGGRLDAAVECVIDEAVHEWLPDQRHLAHPATD
FT                   LVLEVKRRCSVAGLSPPSRSTIARRWLSYREQDALARAALPNAAVAPGTFQVRHPLDIV
FT                   QVDHTQADILLVSELDGQIIGRPWLSVALDVATRCVLGFYVAMERPGAATVSLLLSRVV
FT                   LRKEPWLERLGVEADWPMRGIPRTLHLDNAAEFKSRALRSGCREYGIELMYRPVGKPHF
FT                   GGHIERLNRTLMERVRGLPGSTGSSVKGRKARQAEKTASLTLKQFEQWLAVEIGRRYHC
FT                   GPHRGLLGLQPAQKWQETWRAADSRCLPAQPDAELKFLIRFLPVASRTIQRDGLKLFLI
FT                   RYWHPLFAAWRETRRSVTVRYHPEDLSRIFVSAGRGSFVEVRYADLRRPPISLFEQRAA
FT                   LRAIRARGQRAVSEREIFETVEQQRQLVVTSQRATRARRRMARQAGGLVPKSSIEDLSL
FT                   TEQRQVEQVNYDAPVTAYDVEQW"
FT   gene            101450..102319
FT                   /locus_tag="Bcen2424_3259"
FT   CDS_pept        101450..102319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3259"
FT                   /product="TniB family protein"
FT                   /note="PFAM: TniB family protein; KEGG: bcn:Bcen_4904 TniB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10004"
FT                   /protein_id="ABK10004.1"
FT                   /translation="MKQDDFAHLLPAARDQVLLGKEDRIKSLLRDRWIDYPRATEALQL
FT                   LQRLYDTPRRERMPCLLLHGDSNIGKTKITAKFRRAHPSEFDERTGVERCPVVSVQMPP
FT                   TPDQHRFYAALLFELGAPHNPAAGLATLERLARDILRRMSPQMLIVDEVHHLLAGTYRE
FT                   QRASLNLLKYRANDLQISMVLVGTRDAVLGLQTDSQMISRYRPFEIPRWRESESLRRLM
FT                   AAFEKVLPLRKPSNLSRREIVQLVLEISGGLTGAISTILNEAAELAIRNGDECIDIAHL
FT                   ERVARAYV"
FT   gene            102300..102824
FT                   /locus_tag="Bcen2424_3260"
FT   CDS_pept        102300..102824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10005"
FT                   /protein_id="ABK10005.1"
FT                   /translation="MPARMSDTHRPWPIAPRPFLEEAFGSWLGRIAARYQTSVDLIWES
FT                   GTGVAMPSLTKAGWILFPPVPSATLSRLSRVARLNDGILSMIQTPHEWVFDQKYLVYCF
FT                   RCLVLNDADVTASRWKREWLDPSADYCRVHHSLLETVPQSIFARAPNFDAALRAISRYR
FT                   CPPLRLSKTLR"
FT   gene            102833..103174
FT                   /locus_tag="Bcen2424_3261"
FT   CDS_pept        102833..103174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10006"
FT                   /protein_id="ABK10006.1"
FT                   /translation="MNIASTTLGTASIDCELLHELAVPGLRIGFKFRWTALGGGVATEA
FT                   KITQQARMTITPDLPLPFDAQAAAKIGGLVIVISGASCRHAHFRTGRLLKFGAVTWPTR
FT                   SIALAARFR"
FT   gene            complement(103261..103479)
FT                   /locus_tag="Bcen2424_3262"
FT   CDS_pept        complement(103261..103479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3262"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bcn:Bcen_4901 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10007"
FT                   /protein_id="ABK10007.1"
FT                   /translation="MPLINVKVIEGVFSAADKEKIISTLTDAMVSIEGESMRPVTWVIV
FT                   EEVKSGDWGIAGNALTTERVKALAAGQ"
FT   gene            complement(103538..104746)
FT                   /locus_tag="Bcen2424_3263"
FT   CDS_pept        complement(103538..104746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3263"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   bcn:Bcen_4900 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10008"
FT                   /protein_id="ABK10008.1"
FT                   /translation="MGYNFDRSISRRNTNAMAEEGFANYLFGADAPALALEMPREELIS
FT                   MWVADMQFAAPDAAIDAITERLKHPIFGYTADLDEQLYQAFHSWCAQRYSWHFAREEMQ
FT                   VSLGVIPALFALVEYVCRPGDKVLSLTPAYGYFKHAALQRDREFVTSRMLASDDGKYSI
FT                   DFEDFEAKVSDPAVKLFFLCHPHNPTGRIWTSDELRRMGELCIANGVKIVSDEIHCDLL
FT                   RTGNAHTPLAKLFPGSPDIITCMAVSKTFNLAGMMIATVIIPDPELRSEWKRRHYPFVN
FT                   PLSLAAAIGAYRDGAPWLDALRLYLDENFALTQHFLSDHLPKAKFRVPEATYLAWIDLR
FT                   TYFDDSVNLTRFFLEKSGVVLEGGEMFVENGDRRVRLNLACPRAQLRLSLERIRDAIVK
FT                   QYH"
FT   gene            complement(105127..106236)
FT                   /locus_tag="Bcen2424_3264"
FT   CDS_pept        complement(105127..106236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3264"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bcn:Bcen_4899 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10009"
FT                   /protein_id="ABK10009.1"
FT                   /translation="MMSKLFTPYDLSGTQLANRVVMAPMTRTRTPDNIPNDLTALYYAQ
FT                   RASAGLIITEGLPVSEEGRGYLYTPGLYTDEQTEGWRKVTDAVHKKGGKIFAQLWHVGR
FT                   LSHVSIQPGNAAPVSSGEVPATTTMVYAWVEPGKEGPVLPSVPRALTTDEVQRVTQDFV
FT                   ASARRAMDAGFDGVEVMAANAFLFDQFLSSALNTRTDQYGGSIANRQRFLLETIDALAD
FT                   AIGGEKVGVRVSPFGRIYDMEAFEGEADAWASMASALNERKLAFVHLNYQTTISAAGTP
FT                   NGFGAAFRKAYQGTLIGAGGFTQELAEAELAKGELDLIAFGTAFISNPDLVERMKNGWP
FT                   LTEPDRSTFYGVIGAKGYTDYPTFEQETA"
FT   gene            complement(106385..107065)
FT                   /locus_tag="Bcen2424_3265"
FT   CDS_pept        complement(106385..107065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3265"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bcn:Bcen_4898 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10010"
FT                   /protein_id="ABK10010.1"
FT                   /translation="MKRVNVEVWSDFVCPWCWIAKRRLEKAIEGVTQHVDVVVTHKSYR
FT                   LARGMVPTGFTDALYAKFGNATAAQRMMDAVCSAGAQEGLNYRFETMRFGDTSDAHLLV
FT                   KSVQTSEDKQRMIEAIYRAATTDGIDIFDRAALIDLAKSIGISAASLSFDDREMVSEIA
FT                   RDEAEANRIANGVPLFVFNNRTYLSGAREVAVFEKALFDSAENVPDESEDTGGMSCSID
FT                   GCAH"
FT   gene            complement(107135..107476)
FT                   /locus_tag="Bcen2424_3266"
FT   CDS_pept        complement(107135..107476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3266"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bcn:Bcen_4897 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10011"
FT                   /protein_id="ABK10011.1"
FT                   /translation="MENWTETIGAVTRRVHELARYTPDTLKGVGLLGAAGAKTNHLDAK
FT                   TRELIALAVAVTTRCDGCIAFHAAEANKLGVTKEEVAEALGVAINLNAGAAVVYSTHVL
FT                   DALDHLGRE"
FT   gene            complement(107603..108166)
FT                   /locus_tag="Bcen2424_3267"
FT   CDS_pept        complement(107603..108166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3267"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_4896
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10012"
FT                   /protein_id="ABK10012.1"
FT                   /translation="MAVGTRDALVQAAEGLMRSRGYAAFSYADLAETVGIRKASIHHHF
FT                   PTKEDLGVAIVEAYVARVVEAFERIDRENEDFWGRLNGFFDTFRASSDGSLLPLCGALA
FT                   AEMAALPPELQKLTHRFFELQLRWLTRVIDKGISDGEIAAGVGSCQKAYQVLSVLEGAS
FT                   FVEWAMKNGETLDRGIIRLIVSAA"
FT   gene            108525..109079
FT                   /locus_tag="Bcen2424_3268"
FT   CDS_pept        108525..109079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3268"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcn:Bcen_4895
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10013"
FT                   /protein_id="ABK10013.1"
FT                   /translation="MTTHPNGIDVPALQQFAQEVATDPTKRNARFNVKTKWEHQTRSVA
FT                   TVSHYELGGVTHQRHFEIAADEPTQLLGTNSAPNPQELLMAALNACLTVGYVVNAAAMG
FT                   ITVHSLEIETDGELDLRGFLGLDESVNPGYDEVSYVVRLHTDASRERVEELHQVVTKTS
FT                   VNLANFSKAIRMVSTLEVREG"
FT   gene            109232..110002
FT                   /locus_tag="Bcen2424_3269"
FT   CDS_pept        109232..110002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3269"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   Insect alcohol dehydrogenase family; KEGG: bcn:Bcen_4894
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10014"
FT                   /protein_id="ABK10014.1"
FT                   /translation="MNDFSGKKLLVVGGTSGIGLATAKQVLKSGGSVVLTGNRKDKAEA
FT                   VRAELSGLGPVSVIAANLMTEEGMNAIRSEINANHKDISLLVNSAGIFAPKAFIDHEES
FT                   DYDMYLSLNRATFFITRDVVRNMLAAKLQGAIVNVGSIGAQAALGDSAASAYSMAKAGL
FT                   HALTRNLAIELADAGIRVNAVSPAIVQTSIYEGFMAKEDIAGAMKALESFHPLGRVGTP
FT                   EDVANTIVFLLSDKTSWVTGAIWNVDAGVMAVRK"
FT   sig_peptide     109232..109303
FT                   /locus_tag="Bcen2424_3269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.843 at
FT                   residue 24"
FT   gene            110147..111019
FT                   /locus_tag="Bcen2424_3270"
FT   CDS_pept        110147..111019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3270"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bcn:Bcen_4893 5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10015"
FT                   /protein_id="ABK10015.1"
FT                   /translation="MRFAVYKTDGHRGIAVEHGGRWFGLTAEDTAYPGDLDALLAHGAD
FT                   LAEVGALLARGAPVDLEAVRLLPPFGRSGKIVCVGLNYLDHSTETGFAKQAYPTVFARF
FT                   ASSLIGHGDPIALPAQSSQLDYEGELVAVIGKGGRSIARERALDHVAGYSIFNDATLRD
FT                   YQFRTPQWTMGKNFDGTGAFGPWFVTADELPRGCKGLKIQTRLNGAVVQEASTSDMIFD
FT                   VETLVVLLSDVMTLQAGDVIVTGTPAGIGMAREPQLWMKAGDVCEVEIERLGVLRNPVA
FT                   YVGTVRRDA"
FT   gene            111151..111417
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3271"
FT   gene            complement(111523..112965)
FT                   /locus_tag="Bcen2424_3272"
FT   CDS_pept        complement(111523..112965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3272"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: bcn:Bcen_4892 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10016"
FT                   /protein_id="ABK10016.1"
FT                   /translation="MKDFQTLIATHDGIALAALVREKEVTPTELLDAVLASLDAINPSL
FT                   NAVAERLDETARLAASTITGHESVLAGVPTLIKDLFMPVRGARMANGSFLFGDYRPDFD
FT                   GELVGRLRRAGIPIAGTSLSPELGTSFCTSSARFGVTRNPWNPHVSAGGSSGAAAALVA
FT                   ARVLPFAHGNDGGGSLRVPASCCGVFGLKPTRGRTPNGPMIGEGWAGMAINHAITRSVR
FT                   DSAALLDLTAGADTGAPYAAPCQPETFLAATQRDPRPLKIAVIEQAPPWPLHPACRPAL
FT                   AHTVALLRSLGHHVEPLDSPVDSEAFYDRVFTIIGAQTRALVDMIGNQRGLPVRDGEIE
FT                   ARTRIILREKGNASGAEYASAVDWIHALGRTFGRLMERYDVLLTPTLAMPPLAPAELAT
FT                   ADDTQSLSEVIDRAHRFSPFTAWFNATGQPAMSVPLYWDEQGLPIGSHFAGAFGAESLL
FT                   FSLAAQLERAAPWADRVPPLCV"
FT   gene            complement(113002..114231)
FT                   /locus_tag="Bcen2424_3273"
FT   CDS_pept        complement(113002..114231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3273"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4891 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10017"
FT                   /protein_id="ABK10017.1"
FT                   /translation="MNPLSSAHTAPYSRAARQAGASQGAVLLLGSSLTVMGAVMIAPIL
FT                   PKLAADFVPANPRLAALVPLVATGPALAIALCAPLAGWLADRVGRKMLLLLATLVYGLV
FT                   GAAPAWLDSFTAILVCRFALGAAEACVMTCCTTLIGDYWHGEQRVRYVNRQVVTIGVVG
FT                   TIFFVLGGAAGEHAWRYPFYLYLLPILLIPAIAALLWEPLRHGRPAEPGDGGTPLSGGK
FT                   LASTLAIGYLLICVGMVSSFVVPVQMPQLMIDIGQHSSTMIGAVSGIGLLSTLAGSIAW
FT                   PWLRDSLGRRFVNVALLVLLAVGLYLLASANTVPAIVVAVVIHGFGGGMLVPNAILPLM
FT                   RRLSLAIRGRALGGFTAALYLGQFLSPLVVLGCAQAFGGLRPAIVSIASGTAATALLWL
FT                   LPAFRSRGDD"
FT   gene            complement(114254..115192)
FT                   /locus_tag="Bcen2424_3274"
FT   CDS_pept        complement(114254..115192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10018"
FT                   /protein_id="ABK10018.1"
FT                   /translation="MKVLRRPHGVRHCRTRTTVVAIGTLAATLACQSAGALENDGPITP
FT                   FGVFDFGAGMTPPPTPNGTLATRFAYYSTHTMRNGGNADFSLTAASWSLAYIRMTNARL
FT                   FGANVGFGAIVPFLNLNGHVNVPTPAGTLAMSADPTNIGDADFQPLILAWTLPNLFVNV
FT                   ALQVQAPTGAYRSTRLFNPGVNHWTFSPIIGATYITDSGFEISTSIEVDQNTTNRATNY
FT                   RSGTGFRQEFALGQHIGPFTAGLGGYIERQLSNDHGPNVDGNRAHVNAVGPAISYVEQG
FT                   KPAVWLHVYKEFGAQNHAQGYQIALRAALSF"
FT   sig_peptide     complement(115082..115192)
FT                   /locus_tag="Bcen2424_3274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.885 at
FT                   residue 37"
FT   gene            complement(115271..116278)
FT                   /locus_tag="Bcen2424_3275"
FT   CDS_pept        complement(115271..116278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3275"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_4889 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10019"
FT                   /protein_id="ABK10019.1"
FT                   /translation="MPYTPLPPATTGDSSTDGMPFIRRFTCNDVDSLAECTHGWSIHLD
FT                   QLSPGPFQGTVHAIRLDEMQLLRERVNRSLLKRGDQCAGSTSFSIPLETSGTGYCGGSP
FT                   LRDKALLVSSGTSLPELRTPDHQDVVLLTVPTDTLRRLVWLGDNDGEAGGTPSSETSIA
FT                   RVPVARYEALKSLLVAGFSAADTSEQRLARLQTRKALRDTILIELVDALEAAGRPVRLD
FT                   PSARRRIVDRVRELVISQPGVPLTVLDVCRAVGASRRKLQYCFEEILGTHPAWYLRVVR
FT                   LNAVRRELREHSPASASVSDVACRWGFWHLSRFASHYRELFGELPSDTLKRPPR"
FT   gene            116340..116621
FT                   /locus_tag="Bcen2424_3276"
FT   CDS_pept        116340..116621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10020"
FT                   /protein_id="ABK10020.1"
FT                   /translation="MRLYPEAGRARRARGWQTFGRRRRRRIHEPASVIDFLIAPHQRVD
FT                   LANAQTDPLRCTPGFPTHLGDQHHLGSVKFSHGALSEIEYRESLGLTT"
FT   gene            117248..118624
FT                   /locus_tag="Bcen2424_3277"
FT   CDS_pept        117248..118624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3277"
FT                   /product="glycoside hydrolase, family 28"
FT                   /note="PFAM: glycoside hydrolase, family 28; KEGG:
FT                   bcn:Bcen_4887 glycoside hydrolase, family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10021"
FT                   /protein_id="ABK10021.1"
FT                   /translation="MKGKSSTRLVLRLSTLAALAVQASAQAATCTPQWSSSASTNTTNL
FT                   QNAIQQCAASGTSSSPGLVDLASNNGISTAVITSVNLANNIVLKLEKGFTLKGSPAQPS
FT                   SGAMLTGSNLSNLTITGTGAIDGDGQDYWPAAVGQNNTARPKLIAITGSNLQIGSNFTD
FT                   AGKSQSIVAFPSSSNATGSALIIRNSPKEQLVIESGSKNVTIDGVWIYANPNRNASGDD
FT                   LAPNTDAIDIIGTQTATIKNCLLDTGDDDIAIKSNAGGAATSSVNVSHCVVGGGHGISI
FT                   GGQEAAGTTLAKPGVSQVTVDTMQFSGTDYGYRIKTDQTAKDSGATTGVTYRNTCMRNV
FT                   QQPFLFTYAYASGTGGALPIIANVTIDNVIATATKQQGAIIGLSNSLMGVPKSGDTGIS
FT                   ITNSQISGGKAFSVTDGELQLGSHSSATTSTGSNGQVVGIPDTGATLSCPSSITIPAQI
FT                   "
FT   sig_peptide     117248..117331
FT                   /locus_tag="Bcen2424_3277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.799 at
FT                   residue 28"
FT   gene            118853..119017
FT                   /locus_tag="Bcen2424_3278"
FT   CDS_pept        118853..119017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10022"
FT                   /protein_id="ABK10022.1"
FT                   /translation="MGNAAWSKHACNPARHYRWPGWLTRIREANLIRSMSCKGCSPHNA
FT                   ACEGFLGCS"
FT   gene            120142..120537
FT                   /locus_tag="Bcen2424_3279"
FT   CDS_pept        120142..120537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3279"
FT                   /product="transposase, IS21 family"
FT                   /note="KEGG: mxa:MXAN_3613 transposase, IS21 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10023"
FT                   /protein_id="ABK10023.1"
FT                   /translation="MTIPVELEAQILRLYYAEKWPCGTIAKQLRVHRETAQRVIAHAGL
FT                   PRIGPQPKPSMIEPYLPFIRQTLTKYPTLTASRLYVMVRERGYKGAPDHFRHLISLHRP
FT                   RKPAEAFLRLRTLPGEQAQVDWGHFGH"
FT   gene            120537..121628
FT                   /locus_tag="Bcen2424_3280"
FT   CDS_pept        120537..121628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3280"
FT                   /product="transposase"
FT                   /note="KEGG: eba:p1B6 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10024"
FT                   /protein_id="ABK10024.1"
FT                   /translation="MAFVMVLSYSRDIYLRFFLDARMENFLRGHIGAFNTWCGLPRVLL
FT                   YDNLKSAVLERVGDAIRFHPTLLAFAGHYRFEPRPVAVARGNEKGRVERAIRHVREAFF
FT                   AARKYTDLDDLNAQAEQWCRTQAADRPCPEDRTMTVREAFAREQPLLLTLPDNPYPVEE
FT                   QLAVKVGKTPYVRFDLNDYTIPHTHVRRTLTVRADLNQVRVFDGAEMIASHRRCYDRAE
FT                   QIEDPQHLKTLEQFKREARQHRGVNSLTRAVPACELLLIRAAERGASVGGLTSSLLRLL
FT                   DRYGAAELQAAVEDALRAGSAHTNTVRAALERRRAARGAPPPVAMNLPEHVRRKDAPVQ
FT                   PHRLDTYDQLTAEKKDDVDPEQQ"
FT   gene            121603..122391
FT                   /locus_tag="Bcen2424_3281"
FT   CDS_pept        121603..122391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3281"
FT                   /product="IstB transposition helper protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bcn:Bcen_4884 IstB-like
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10025"
FT                   /protein_id="ABK10025.1"
FT                   /translation="MTSTPNNNEMLRSRARALRLNGLVEHWSEVDGSTWLAPLLQWEED
FT                   ERAHRSLQRRIRAAKLSKFKTLTDFDWDWPKRIDRAAVEDLMSLSFLDDATNIVFIGPN
FT                   GVGKSTLAQNVAHHALIQGRTVLFKSASEMLGELAALDSDSALRRRLHHYATPDILVID
FT                   EVGYLSYSNRHADLLFELVSRRYEARSTIVTTNKPFAEWSEVFPNAACVVSLVDRLVHR
FT                   AEVISIEGESYRLKEARERNEARARQRKTRKPAAKKGPTS"
FT   gene            122388..122609
FT                   /locus_tag="Bcen2424_3282"
FT   CDS_pept        122388..122609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10026"
FT                   /protein_id="ABK10026.1"
FT                   /translation="MSRAPLLPSGRRRGLPFVVPDDWTPEQALAAYELLEDLLAVITDF
FT                   YGAQLHEQLREQRTSRPGIRTRKLDPPF"
FT   gene            complement(122950..123963)
FT                   /locus_tag="Bcen2424_3283"
FT   CDS_pept        complement(122950..123963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3283"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: bcn:Bcen_4882
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10027"
FT                   /protein_id="ABK10027.1"
FT                   /translation="MVTLAQVAQRANVTAATVSNVLRNPQKVKPATVERVMAAIRELGY
FT                   RPNLTARALAEGRTSTLALMLSNITNPFYPEFVLAAEREARKRGHYLLVSNTDDDPAIT
FT                   RNYLERIAGTLAAGAIVMNTDLAEAELADIARHGASIVLCMWERVHASRTLPCVTVDFA
FT                   AAGALAAAHLSGLRHRAFGALVGKGSGGPQSVRLRGFADELAARGHPADALTAVSAHDS
FT                   IEGGYEAAAALLREKPGLTALFATNDLMAIGAMQAAADLGLRVPAELSVVGMTDIQLAH
FT                   QFRPALTTVRFPTSQIAARAIALTLDMIDGIEPGAAVHTIGAPELVVRESTGTAPD"
FT   gene            124199..125353
FT                   /locus_tag="Bcen2424_3284"
FT   CDS_pept        124199..125353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3284"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_4881 ABC transporter related; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10028"
FT                   /protein_id="ABK10028.1"
FT                   /translation="MTAISLKDVSKRYGDHAPVLRDVNLEIASHEFCVFLGPSGCGKST
FT                   LLRMIAGLEDVTEGELRIGGARINDTPPAERGVAMVFQSYALFPHMTVFDNIGFGLRIA
FT                   GTPKDEIRRRVTEAARVLQLEALLDRKPKALSGGQRQRVAIGRAIVREPRVFLFDEPLS
FT                   NLDATLRGQTRVEIARLHARFTQSSSVYVTHDQIEAMTLADRIVLLHAGDDVARFGSIA
FT                   QAGAPLELYHRPANRFVAGFIGSPRMNFLPAIVDACDAHGCRLTLDRTGETLTLRERPL
FT                   PRHVGCGARVLLGIRPEHLTIAASGDAGLPSIVRDIALVEQLGEAAYVHLDQPDGVPLL
FT                   AKLPGQATLRRGERHAFHVPPSRCHLFDEAGIALPAIHAEAAFA"
FT   gene            125417..126655
FT                   /locus_tag="Bcen2424_3285"
FT   CDS_pept        125417..126655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3285"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bcn:Bcen_4880 extracellular solute-binding
FT                   protein, family 1; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10029"
FT                   /protein_id="ABK10029.1"
FT                   /translation="MRLRASRLLLALTTAAVCAAGTADAGTLKVNVAARGNQRATWQAT
FT                   FDQFHKANPDIDLKVSYVGEEAYKVQMSGWLATDPPDVLSWNNGERLAYFAKRGLIEDL
FT                   SADWQKNGWSDTYASVKQSSTYGGKLYSLPLGYDAYGLFYRKDLFEKAGIHGEPADWPQ
FT                   FLDACRKLKAAGIAPIAVAARDAWTLAAWFDYLDLRINGYAFHQKLMAGDVAYTDPRVR
FT                   AVYAAWKKLIDDKYFIDNALSYDVDSLSPLIVNGQAAMTLMGTWYSAGLLSATRNPISF
FT                   FRFPVIDASVPLAEDGPVNVLIVPAKAHNKTDARRFLAFMGQPAVSGEFAKGMGQLPSN
FT                   NKAPEPQDPISKIGFHTLATTPGGIAQFYDRDMTKEMADEGMKAMQQFLSDPAQLDAIL
FT                   QRLEQTRKRIYRK"
FT   sig_peptide     125417..125494
FT                   /locus_tag="Bcen2424_3285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 26"
FT   gene            126746..127663
FT                   /locus_tag="Bcen2424_3286"
FT   CDS_pept        126746..127663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3286"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_4879
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10030"
FT                   /protein_id="ABK10030.1"
FT                   /translation="MSTSLSESAARRDAGPQRPARASLARRRNRAALWFVLPGFALFTV
FT                   FVLYPIVSSIWLSFHHWDGMTPMMFAGLDNYRELLQSDTFYVALKNNVLWLVLFLAAPP
FT                   LGLALALYLNQNVFGIRLLKSLFFAPFVLPGVVVGLVFSWFYDPTFGLLKLIVGHGIPV
FT                   LGDPRYATYGVIAAALWPQIPFCMILYLTGLTGINGEIVEAARMEGARGFTLLWHVILP
FT                   QLRPATFMAVVLTVIGALRSFDLISVMTGGGPFDSSTVLAYFMVDQSIKYYREGYSAAI
FT                   AVVLFAIMLVYIVWQLRKLVRVES"
FT   gene            127675..128526
FT                   /locus_tag="Bcen2424_3287"
FT   CDS_pept        127675..128526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3287"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_4878
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10031"
FT                   /protein_id="ABK10031.1"
FT                   /translation="MYPMPVSRWGRPARWLYRLSLPCALALWLVPLLAVLVTSIRSTDE
FT                   IIAGHYWDWPKQFALLDNYGAALAQTPMLHYFANSVLITVPSVAASILLASLAGHALAN
FT                   FRFRGNLVLLGLFVAGNFVPIQILMIPVRQIMLGVGLYNTVWALVLFHTAFQTGFCTLF
FT                   LRNFIRELPFELIEAARVEGASEWAIYWRVVLPLVRPALAALAILVFTFVWNDYFWALC
FT                   LTQGDDAAPITVGVAALKGQWTTAWNIVSAGSVLAALPSVAMFFAMQKHFVAGLTFGAT
FT                   KG"
FT   sig_peptide     127675..127779
FT                   /locus_tag="Bcen2424_3287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.624 at
FT                   residue 35"
FT   gene            128563..130533
FT                   /locus_tag="Bcen2424_3288"
FT   CDS_pept        128563..130533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3288"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase, family 42, N-terminal
FT                   domain protein; Beta-galactosidase trimerisation domain
FT                   protein; Beta-galactosidase C-terminal domain protein;
FT                   KEGG: bcn:Bcen_4877 beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10032"
FT                   /protein_id="ABK10032.1"
FT                   /translation="MHLGVCYYPEHWPREQWERDALRMAELGLTRVRIAEFAWSRMEPA
FT                   PGRYDWAWLDEAIDTLARQQLKIVLGTPTAAPPKWLVDRHPEMLPVAADGAVWQFGSRR
FT                   HYDIASPVYREHCVRIVDAMARRYGTHPAVIAWQTDNELGCHNTLPSYTRAALEGFRAW
FT                   LAVRYGDIDALNRAWGNVFWSMEYRGFDEIELPRHTPTDANPAHLLDFRRYQSDEVARF
FT                   HAVQVDAIRPHAPGRDVLHNFMGFFTEFDHHAFARGGLDVAAWDSYPVPRTEVLPLDEA
FT                   DKRRWARTGHPDVSAFSHDLYRGIGNGRMWVMEQQAGPVNWGPYNPVPHAGAVRLWTWE
FT                   AFAHGAELVSYFRWRQYPHAQEQLHSGLNAPDDRLSPGGREVARVACELAALDPAFVGG
FT                   PRETARVALLFDYEADWMIRIQPHGADFDYQQHAFDWYRALRELGLDVDIVAAGADLSR
FT                   YALVVAPTLPVVTDRIVEQVAGGFAHWLFGPRTGSRTAAFAIAPGLAPGKLRDVLPVRI
FT                   GQVESLRPSLAPRVSFDGVDGHALKWRDHIDREAAPGVDVLAACDDGVPALVRRAHVTM
FT                   ATACFDRALLRAIVSRCARDAGLQVRALPDGVRLRRRGRVTFAFNYGDAPCLLPAPDGA
FT                   RFVLGGRELGAVDVAAWVEPD"
FT   gene            130538..131833
FT                   /locus_tag="Bcen2424_3289"
FT   CDS_pept        130538..131833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3289"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4876 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10033"
FT                   /protein_id="ABK10033.1"
FT                   /translation="MQSLRPLRLHFARLAGIAYFVPLSAAALMLGIAMSFTAPYLSLFG
FT                   VEAAGMSPFLAGVFMTSIAASGVVASTWAGRWSDRRERHRPLLVLSLAAAALGFALLCV
FT                   LRAHGPVIAAGTILLGAGAVSLSQIFSFARAVLPVADDAQRELASAALRTMLSIAWVFG
FT                   PALGALILAQTGFTGLFLSASAGFVACAAIVARIPEPARRPATVHLPAVTRVAPPLDDA
FT                   RAAIVVASRASVLRTLVALTLIGLVANATMIVLPLFIVRALGGTPANVSAALGLAALLE
FT                   IPMMLWLGIRSTHLDKARWLTACALVHAAYFIGLAAVTRVNLILPLQLLSACVVAITSC
FT                   LGMTHVCDLMPTRPGTATAMFFSTARVGSIASGVLSGACVDLFGYRATFAGCCGLALLA
FT                   CVLLAVDAYGGRGDAGGGNGTRGARRGFGSPH"
FT   sig_peptide     130538..130645
FT                   /locus_tag="Bcen2424_3289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.518 at
FT                   residue 36"
FT   gene            complement(131877..133040)
FT                   /locus_tag="Bcen2424_3290"
FT   CDS_pept        complement(131877..133040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3290"
FT                   /product="Arabinogalactan endo-1,4-beta-galactosidase"
FT                   /EC_number="3.2.1.89"
FT                   /note="PFAM: glycosyl hydrolase 53; KEGG: bcn:Bcen_4875
FT                   arabinogalactan endo-1,4-beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10034"
FT                   /protein_id="ABK10034.1"
FT                   /translation="MNRRSMLRWSMSSAALACLDLAGPLAAFARPAPHSAAAAEFAMGA
FT                   DISTLPELEAHGAAFFDRGGAPRDCLKILRAHGVDSIRIKVWNDPGNPDFFPANQSDAA
FT                   GYNNAAHVVVLAQRAAALGMRILIDFHYSDWWADPGKQYPPHAWAGKSLAETCALLSAY
FT                   TTDVLRRLQRAGVSPEWVQIGNEITGGMLWPLGRYDQWDNLAQLLKTGHDAVKAVDPRI
FT                   KVMLHVDSGGDNGKSRWWFDSATQRGVAFDVIGLSYYPQWQGSLDDLRNNANDLAVRYD
FT                   KELIVVETAYPWTTSDGDSEPNAMTNTGSTTFPPSPAGQAQFLAAVVDIVKGVPGNRGK
FT                   GVFWWEPEWIPTRGVGWKLGAGDQWDNNTLFDFHGHALPSLDAFRQR"
FT   sig_peptide     complement(132951..133040)
FT                   /locus_tag="Bcen2424_3290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 30"
FT   gene            complement(133318..133789)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3291"
FT   gene            complement(133809..134117)
FT                   /locus_tag="Bcen2424_3292"
FT   CDS_pept        complement(133809..134117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10035"
FT                   /protein_id="ABK10035.1"
FT                   /translation="MLFAIKLDYVRPFEEIQAHLDAHKAWLIKYAQAGNILAAGPLHGE
FT                   SGGFVLAYAGQPRDIETMIAEDPFHIHGLAKFDVVCCEPAICVAGFPTHWAAGARTI"
FT   gene            complement(134130..134774)
FT                   /locus_tag="Bcen2424_3293"
FT   CDS_pept        complement(134130..134774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3293"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: bcn:Bcen_4872
FT                   (acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10036"
FT                   /protein_id="ABK10036.1"
FT                   /translation="MNILHLDSSMLGNSSITRELSAAVVAGLRAQHPSAHVTYRDLVHD
FT                   EIRHLTGPIAAGFRQIGVGALDDATAREHELSEALVKEFLASDVIVIGAPMYNFSVPSQ
FT                   LKAWLDRVAQAGRTFRYTENGPVGLAGGKQVIVASARGGFYADAPLSHMDFQESYLKAF
FT                   FGFLGITDVRFVRAEGASKGQAVRDESIALARATLTDVLVDIRTSGAQTIQ"
FT   gene            complement(134826..135269)
FT                   /locus_tag="Bcen2424_3294"
FT   CDS_pept        complement(134826..135269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10037"
FT                   /protein_id="ABK10037.1"
FT                   /translation="MKGLVYLSALVPDDGESVADLLQRLHAPMTGLASDAHGLIWLDDA
FT                   RAFQHVMAADIPLEQARVLASVQQPVAAACFTGKIQHAAWHDKPVWYLRTTNDNALKPA
FT                   VQQAIAQHIGATVTSIRSSHMSMLSHPDEVARLIDLAARKASQ"
FT   gene            135412..136362
FT                   /locus_tag="Bcen2424_3295"
FT   CDS_pept        135412..136362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3295"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4870 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10038"
FT                   /protein_id="ABK10038.1"
FT                   /translation="MNTHKNARLTFARRLEMVQEITESGSSVSRAAADHGVTAPTVRKW
FT                   LGRYLAGGAVALADASSRPARSPRAIAPSTALLIVELRQQRLLQRQIARQVGVSASTVS
FT                   RVLVRAGLSRLSDLQPREPVQRYEHKAPGDLLHIDIKKLGRIARPGHRVTGNRRDTVDG
FT                   VGWEYLFVAVDDHARIAYTAMHPDETKRSAVQFLRDAVAWYAGLGVRVHRLLTDNGSAF
FT                   RSHEFARACQELGIRHKFTRAYRPQTNGKAERFIQSALREWAYAWTYQSSAHRIEALAS
FT                   WQHHYNWHRAHSAIGGVAPMARLPASRNNLLTLHN"
FT   gene            136451..137005
FT                   /locus_tag="Bcen2424_3296"
FT   CDS_pept        136451..137005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10039"
FT                   /protein_id="ABK10039.1"
FT                   /translation="MIEYVSDALLAALFPPGVGDMDVLRVAGPVAVDAGTEASGIDFAG
FT                   TRHLVFFADVMTYAGHDEQYIQDTAVAWNGGFVPASQSRLVKFFRAEADRETMFYPSDW
FT                   PLPDPAMIWQFSEALGMALIGHADTFPGTTQYFYMPQTGKLDALYNRLARKFERGEFGV
FT                   SFRCVTRPASDEGGFYGFERI"
FT   gene            complement(137333..138196)
FT                   /locus_tag="Bcen2424_3297"
FT   CDS_pept        complement(137333..138196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10040"
FT                   /protein_id="ABK10040.1"
FT                   /translation="MPLAAGGHVVVLRVAPSPNAPHRLLRNNHFYLRNSVGKETMDIHA
FT                   IRTAFAFSEGLADRAVAFRDRRLGLLRSRQIQVPLVPDQPMLVVHLVPVLSLTRREGHT
FT                   IEELKAAAEDLQRAQPAANPLGRPVANFEGVICTSNTDRQDQHYAFAQLFRDGCIELVS
FT                   VLTTEEQGNPPLPTIFPATYEPSLVQHALPVAFQALTTLGIPAPLYLSVSLLNVRGLRV
FT                   AIRRPRTGLAGFPELPANLVDLTSSLRYVEDPAVSPAVLAGPAIDVVWNAVGIDHSQIV
FT                   IWNPAP"
FT   gene            complement(138291..139088)
FT                   /locus_tag="Bcen2424_3298"
FT   CDS_pept        complement(138291..139088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3298"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bcn:Bcen_4955 IstB-like
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10041"
FT                   /protein_id="ABK10041.1"
FT                   /translation="MSNDIAAQLKGLKLHGMASTWPELLAQSRHTDFEPERFMKQLLMA
FT                   ETAERQVRSIAYQMTAARFPAHRDLKGFDFAQAHVDEALVRELSELSFLASAHNVVFIG
FT                   GPGTGKTHLASAIGIEAVQRHGKRVRYFSTVELTNALEQEKSIGKQGQIAHKLMYVDLV
FT                   ILDELGYLPFSQTGGALLFHLLSKLYEHTSVAITTNLSFGEWASVFGDAKMTTALLDRV
FT                   THHCHIVETGNESWRFRTSSAKAKTTRKRAEKPAGNEELSTPE"
FT   gene            complement(139081..140586)
FT                   /locus_tag="Bcen2424_3299"
FT   CDS_pept        complement(139081..140586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3299"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4956 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10042"
FT                   /protein_id="ABK10042.1"
FT                   /translation="MGILAKIRRMYFREKVPLREIARRTGLSRNTVRRWLRQTDAVEPK
FT                   YPKRVSPSVIDDWAAQLTGWLRADSHRPKRDRRTARFMFEAIRAEGYAGSYGRVSAFVR
FT                   RWHEEQAEAPRRKAFVPLAFEPGEAFQFDWSCEYAFVGGLRRRLEVAHVKLNSSRAFWL
FT                   VAYPTQSHEMLFDAHARAFAAFGGVPRRGIYDNMKTAVDKVGRGKERAVNARFEAMCSH
FT                   YLFEPEFCNRAAGWEKGIVEKNVQDRRRQIWHEASLRRWETLEILNEWVAGQCREAWHM
FT                   RHPQWPELTVEDVLQDERTRLMPNPRPFDGYVEQTLRVSSTSLIHFQRNRYSVPTEYTN
FT                   QLVSVRCYPAYLSVVVNAQEIARHERSFERHMTFYDWRHYITLVERKPGALRNGAPFIT
FT                   MPQPLQLLQRHLLKHPGGDRVMTQVLAAVREHGLDAVLLAVQAALDSGRPSAEHVLNVL
FT                   SRLKAPVTNGRLATTKLQLKEEPAADVGRYETLRANPPEDRHV"
FT   gene            140888..141151
FT                   /locus_tag="Bcen2424_3300"
FT   CDS_pept        140888..141151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3300"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bcn:Bcen_4865 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10043"
FT                   /protein_id="ABK10043.1"
FT                   /translation="MKKRHTDEQIIRILREAESQEVPVKDLCKRHNISEQTFYRWRTKF
FT                   GGMDVAEARRLKELESENEKLKRLVAEQLLVIDGLKEFSRKK"
FT   gene            141148..141987
FT                   /locus_tag="Bcen2424_3301"
FT   CDS_pept        141148..141987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3301"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4864 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10044"
FT                   /protein_id="ABK10044.1"
FT                   /translation="MNSPTGRREALEVLTRRGLSQRKACRYLGLSRRVAIYTLKQPEKD
FT                   RSLGERLIAASQEVPRFGYRRISAWLSLGESRVRRMWRALKLNIPKRRPRRRRCGSDIR
FT                   LPGATKPNSVWSYDFVHDQLVDGRVLKMLCVIDEYTRECLAIEVGASLRSQDVILVLSR
FT                   LMRLYGKPAFIRSDNGAEFTAAKVMRWLRDAAIGPAFITPGNPWQNGFVESFNGKLRDE
FT                   LLNREWFRSRAEAKVLIERWRQFYNERRPHSAHRYQPPATVRRAWLDSENIDRRLTA"
FT   gene            complement(142253..142480)
FT                   /locus_tag="Bcen2424_3302"
FT   CDS_pept        complement(142253..142480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10045"
FT                   /protein_id="ABK10045.1"
FT                   /translation="MTQLDVGQAAYAGLHREIADVVASSREATARTVNALMTATYWEIG
FT                   RRIVEFEQGGKGRPAYGDAVIRRLGAGLSE"
FT   gene            complement(142562..143050)
FT                   /locus_tag="Bcen2424_3303"
FT   CDS_pept        complement(142562..143050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3303"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_4862 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10046"
FT                   /protein_id="ABK10046.1"
FT                   /translation="MSGAQLVVAALEAAHDRSRFACGTPALDRYLREVVTQDVRRRVAA
FT                   CFVMLDGNVVAGYYTLSAASVALTDLPHAIARKLPRYPAIPVVRMGRLAVDQAYRGRRL
FT                   GAALLVNALQRAAKSEIAAVALTVDAKDETAAAFYRHFGFAPLTSDPLALFMPLATVK"
FT   gene            complement(143047..143316)
FT                   /locus_tag="Bcen2424_3304"
FT   CDS_pept        complement(143047..143316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3304"
FT                   /product="conserved hypothetical protein, with unknown
FT                   function"
FT                   /note="KEGG: bcn:Bcen_4861 conserved hypothetical protein,
FT                   with unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10047"
FT                   /protein_id="ABK10047.1"
FT                   /translation="MATTRFEARIETDVHAAIRRAAEIQGRTMSDFVVSAAREAAQRAI
FT                   ADAEVIRLSVAESERFAHAILTPAEPVDALKRAIDLHDQLLRNA"
FT   gene            complement(143649..143891)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3305"
FT   gene            143946..144128
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3306"
FT   gene            144140..144958
FT                   /locus_tag="Bcen2424_3307"
FT   CDS_pept        144140..144958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3307"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4858 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10048"
FT                   /protein_id="ABK10048.1"
FT                   /translation="MSYIVDHYGLPTQRACRLVKQARSTHYYRSVKDPQTALRQRMREI
FT                   AQTRVRYGYRRVHVLLKREGWRVSRNRVYRLDAEEQLQLRSKLPKRRKMVVSRRERCVP
FT                   VRPNEVWSLDFVADQLADGTRLRALTVADIFSREALAIEVGKRLRAEDVVSVLNRLVAQ
FT                   RRAPRFLFADNGSEFSGRLLDMWAYHYKVQIDFSRPGKPTDNSFIETFNGSFRDECLNL
FT                   HWFESLAEAKREIEAWRRDYNETRPHMALKELTPGEFARQYSLRPTAEGS"
FT   gene            complement(145238..145375)
FT                   /locus_tag="Bcen2424_3308"
FT   CDS_pept        complement(145238..145375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3308"
FT                   /product="transposase"
FT                   /note="KEGG: bte:BTH_I1930 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10049"
FT                   /protein_id="ABK10049.1"
FT                   /translation="MSANRTPTALSRLAIAFEHYNERHPHKALKYRSPREFRRNAVSST
FT                   "
FT   gene            complement(145380..146396)
FT                   /locus_tag="Bcen2424_3309"
FT   CDS_pept        complement(145380..146396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3309"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4857 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10050"
FT                   /protein_id="ABK10050.1"
FT                   /translation="MRLRWVRMYHETGNAGLVCTRCGISRPTLRKWLRRYQEAGEEGLR
FT                   SQSRRPLTSPNRKVSDADRATILRLRAERKGARRIQNELRLNEQRELSLATIHKVLCEA
FT                   LVKPLVRPRRPAQPRRYSRPVPGDRVQMDTMKIARGVYQYTAIDDCSRFRVLAVYPRRN
FT                   ARNTLFFLDRVIEEMPFPIQRIQTDRGGEFFAESVQRRLMNECIKFRPIPPRSPHLNGK
FT                   VERSQLTDLNEFWFHHAPTERAIDLRIEEWQFDYNWRRPHGSLGGKTPVDRIAELGEIT
FT                   PLAEAVEGAYDERKERIRHREWRVDKILGEHHRRASEPVFPTGATGSDAPKKRPSKK"
FT   gene            complement(146447..147178)
FT                   /locus_tag="Bcen2424_3310"
FT   CDS_pept        complement(146447..147178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3310"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bcn:Bcen_4856 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10051"
FT                   /protein_id="ABK10051.1"
FT                   /translation="MKTVCEVLGVARSAVAVKRARSSDWRDGRRARVTNDAGLVEEIQA
FT                   HVAHLPTYGYRRVWALLRRSREQSGAPCINVKRVYRVMREHQLLLRRPGVRRDKRRHDG
FT                   RVAVDRSNTRWCSDGFEFRCDDGTPLRVTFALDCCDREAISWAATTGGHSGDVVRDVML
FT                   AAVEQRFGTTQAAQPIEWLTDNGSAYIDHRTRSFARELGLEPLTTPVRSPQSNGMAESF
FT                   VKTMKDNYVAYMDKSDAPTAV"
FT   gene            complement(147175..147576)
FT                   /locus_tag="Bcen2424_3311"
FT   CDS_pept        complement(147175..147576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3311"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bcn:Bcen_4855 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10052"
FT                   /protein_id="ABK10052.1"
FT                   /translation="MPISKPSHYVESIEILTEPERRRRRTAQEKIAIVQETLEPGASVS
FT                   AVARRHGVNANQVFGWRKQYQEGSLAAVKAGETVVPASELAAAIKEIKELQRLLGKKTL
FT                   EVEILKEAVEWGRSKNLIARSPLLPGGDR"
FT   gene            148123..148770
FT                   /locus_tag="Bcen2424_3312"
FT   CDS_pept        148123..148770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3312"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   bcn:Bcen_4854 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10053"
FT                   /protein_id="ABK10053.1"
FT                   /translation="MTTQDFVAMAQQCAPAVAPQTLAAIVRIESGFNPYAIGVVHGRLV
FT                   RQPRREDEAIATVKALQAAGWNYSAGLAQINRDNWSRYGLTARTVCDVCRNLSVGAAIL
FT                   RACFRRARPIHAHPQEALRAALSCYASGNFVTGFRVGYVRRITEAAASGDTFVPALTSS
FT                   ATPIPVIRDRVTGSRAESRGRSTPVSPPSSNPNDDTARSQNNGGVEGSAVIF"
FT   gene            complement(148822..149079)
FT                   /locus_tag="Bcen2424_3313"
FT   CDS_pept        complement(148822..149079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10054"
FT                   /protein_id="ABK10054.1"
FT                   /translation="MRDIAKPGVLKHHFEAGPDDGNRTHHPAHTEQRVLNSDQQGIDLT
FT                   ELCRCRRGCHDEHAEHCNAAPIRRDPRNTRFSQSHVAYAN"
FT   gene            149168..149488
FT                   /locus_tag="Bcen2424_3314"
FT   CDS_pept        149168..149488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3314"
FT                   /product="type IV secretory pathway, VirB3 family protein"
FT                   /note="PFAM: type IV secretory pathway, VirB3 family
FT                   protein; KEGG: bcn:Bcen_4852 type IV secretory pathway,
FT                   VirB3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10055"
FT                   /protein_id="ABK10055.1"
FT                   /translation="MNTLSDPVFKGCTRPAMLWGVPLVPLLMVAGGMLIPAIWVLMASA
FT                   PLGVAIVLLIVPVFATMRMITRQDDQRLAQRMLRVKMRLCQRNRRFWGAHAYAPIRLKA
FT                   RG"
FT   gene            149490..151970
FT                   /locus_tag="Bcen2424_3315"
FT   CDS_pept        149490..151970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3315"
FT                   /product="type IV secretion/conjugal transfer ATPase, VirB4
FT                   family"
FT                   /note="TIGRFAM: type IV secretion/conjugal transfer ATPase,
FT                   VirB4 family; PFAM: CagE, TrbE, VirB component of type IV
FT                   transporter system; KEGG: bcn:Bcen_4851 type IV
FT                   secretion/conjugal transfer ATPase, VirB4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10056"
FT                   /protein_id="ABK10056.1"
FT                   /translation="MSTPSAHATLVPREVVLADFIPFSSHVTDRVIRTREGDYIQIWKI
FT                   PGIAFETADPADILARHVTFNQLVRNLPGGHVALWTHRLRRRTADRFETTYLNRFCQDL
FT                   AERYYASFAGYTMMTNELYVSAVYRPHRTRLGRLFSRAARRTVDDIQRDQQDALRALAD
FT                   IAAQIETGLKPWSPCALGVYERRDPLTKRLCRYSAALEMLGYLVNGTWEAVPVGYGRIC
FT                   DTLPTSRLFFHREKLEIRTPTRTRYAALLDLKDYPEQTEPGMLNGLLYGDFEYIETQSF
FT                   TVLDRPSAKEALERQRNQLIAGDDVAVSQIEAMDQAANDLVNGDFVLGEYHYTLAVLGD
FT                   TLDEVVRHVAQARTKLADAGFQSALIDLVADAAWFAQCPGNWRYRPREAKLTSRNFCAM
FT                   ASLHNFATGKREGNPWGEAITIVKTPSGQPLYLNFHATPEKVDSNDEKALANTQIIGRA
FT                   GAGKTVLELFLLAMAMKYGVMGVLFDKDRGAEIGIRAMGGQYTVFHRGEPTGMNPFQLE
FT                   ADEATHSFWMRLVCKLVDNGVPLSAKDELDISRAIREVARMDRSLRRLSMVRQLLPNVG
FT                   DNSLHARLAKWCAGGRLGWVLDNPVDRIDLDAHRLFGFDDTELLDDPEVCAPLTMVLLH
FT                   LTERLIDGRRFIYVMTEFWKRLRDPVFSEFANDKQKTIRKQNGLGIFDTQSPADVLSSP
FT                   ISRALVEQTATFFFLPNPSADHDDYVHGFKLTEAEFNIVRRMGEHSRLFLVKQGHRSAI
FT                   GRLDLSGMGDVLDVLSGTSDNVALLNTIRAKVGDDPDVWLPRFHDALTARRRQTSAFQT
FT                   ALSSTATHAQGGVL"
FT   gene            151967..153118
FT                   /locus_tag="Bcen2424_3316"
FT   CDS_pept        151967..153118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3316"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: bcn:Bcen_4850 TrbL/VirB6 plasmid conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10057"
FT                   /protein_id="ABK10057.1"
FT                   /translation="MNGLFSAVGGTLENGMHTYVSDASSALSSALVPAATTGVVIWVLA
FT                   YGMAVIRGEAHEPVPAFAWRGMKVVITLAFALSAGLYQSQVVSAVSETTTGVAQAIQTA
FT                   AVRTGAGNVGCGSVEQASEASEHAVGIYRTLDCYDRQLNLVVDAYFDKATHEGLSMSGI
FT                   VAGIGDLACGLVAAFGGAIFLMVLGVEVMMARMLLDLVLALGPIFIVCGAFSPTVRFFE
FT                   AWTAKLVNYALLQVLVAAFLGLALAAFSANLAPFQVTTADPDASADALAAAARQALQAS
FT                   APWAAAFGMFVTSMLLATIGWQLPAVASGLAGGATVSGFGAFVAGYASRQAAGAMAFAL
FT                   RSANRNASSGGRISRPGALVSTASPHPPAYQRAAREQLDRAHD"
FT   gene            153134..153841
FT                   /locus_tag="Bcen2424_3317"
FT   CDS_pept        153134..153841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3317"
FT                   /product="type IV secretion system family protein"
FT                   /note="PFAM: type IV secretion system family protein; KEGG:
FT                   bxe:Bxe_C0452 putative type IV secretion system protein
FT                   VirB5/TraF"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10058"
FT                   /protein_id="ABK10058.1"
FT                   /translation="MKRYLFTHVLMCAIVAGSASFIEPAKAEIYSVYDEKNVAQAIAMV
FT                   GQLKQQVQQEMALYRSMSGARGFGALLDRPGVVNALPGNWQRVYAAIREGGYAGLTGPA
FT                   QALRAQSKLYDCEDQHGIDQRICQRALNKPFQDKALGLQAYQTELAELDRIERLMRHID
FT                   TTRDPKGIAELQARIQSESVAVGNEMTKLQMFKMLAETEDRLIAEQQTELLLKRAGNTR
FT                   RLQDQMVPITFGR"
FT   sig_peptide     153134..153217
FT                   /locus_tag="Bcen2424_3317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            154023..154727
FT                   /locus_tag="Bcen2424_3318"
FT   CDS_pept        154023..154727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3318"
FT                   /product="VirB8 family protein"
FT                   /note="PFAM: VirB8 family protein; KEGG: bcn:Bcen_4848
FT                   VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10059"
FT                   /protein_id="ABK10059.1"
FT                   /translation="MNDQSDYRRALDFEASLTALQACSERRAWQVAFAAVIVAIGSVAA
FT                   LAVMMPFYRVVPLPIEVNKLTGEAQFIEVLDAKHVPLREIEDKHWVEVYVRTRERYDWG
FT                   LLQMDYDRVLDMSDESVARAYRQIYSGPNALDQQLGASVQYRTRIVSTTLVPDEPGHAV
FT                   VHLERTVRKNGIDTGEPAKRFVITLAFTYRPTVLVRERSAIENPFGFKVTAYSRDAEDT
FT                   PPAPQPGAGAGR"
FT   gene            154724..155548
FT                   /locus_tag="Bcen2424_3319"
FT   CDS_pept        154724..155548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3319"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: bcn:Bcen_4847 conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10060"
FT                   /protein_id="ABK10060.1"
FT                   /translation="MKTLATMAILLACFAAQAVDAHVMPDWTHDARVRKVRYVPDEVVR
FT                   IIAQRGFATHVELDPTEHILVVAPGDRDGWYVVANRGDHDVYLKPKLAAHDTNLIVRTD
FT                   RRSYSFDLLVLPLKARFGNAHEMYRVSFVYPDTAASDASIAARLACLQKRLSQPSVVRN
FT                   AAYSMQVMPHAEDIAPSAVWDDGRFTYIRIPNNRRIPAIFRIEDDDTERVVDKHIDRDV
FT                   VVVHELARRLVLRLGDEAVGLWNDAFDIDGVAPRHGVTVDGVRRTLRSREHD"
FT   sig_peptide     154724..154780
FT                   /locus_tag="Bcen2424_3319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 19"
FT   gene            155541..156764
FT                   /locus_tag="Bcen2424_3320"
FT   CDS_pept        155541..156764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3320"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   bcn:Bcen_4846 conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10061"
FT                   /protein_id="ABK10061.1"
FT                   /translation="MTEDTSPNGAATDDRIRRNSSADMDTDTGSESSVMLDRGMPSLDG
FT                   FGRRSFINWLVPLAIIVLALIGAVWTVHGVLAHRDEAARARRSALHARGAHEKVFDEVP
FT                   ALAEPASAAAMPIPAPAPAAVQPAPSSDRAAPLRSYYDAPLLAVGASNGQMADASESES
FT                   ASPSIFPVHADQQPSNATADMAEERAKPFSQPLSQVLTPTRMPKVMAAFIGNRSLLLAQ
FT                   GTKIDCAGDTAFDSTQAGISTCTVARNVYSDDGRVVLIERGSQINCEYRANLAPGQRRV
FT                   FILSARIATPHGVAVQIDSPVADALGRMGMDGSIENHWGARVGAAMMLGLSHDAIGYLA
FT                   TRGGNGNGTIVYQNTQAQGSDMATRVLDQTINIAPTLKQHQGTEFTIVLARDLDFSSVY
FT                   ALEPEGVR"
FT   gene            156854..157912
FT                   /locus_tag="Bcen2424_3321"
FT   CDS_pept        156854..157912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3321"
FT                   /product="ATP/GTP-binding site motif A (P-loop)"
FT                   /note="TIGRFAM: ATP/GTP-binding site motif A (P-loop);
FT                   PFAM: type II secretion system protein E; KEGG:
FT                   bcn:Bcen_4845 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10062"
FT                   /protein_id="ABK10062.1"
FT                   /translation="MRSFAPLLADEAVTELVINRPQRILTETHRGWQAHDLPELDFERL
FT                   MAFAVAIATLTNQGVSTEHPLLSALLPDNARLQLVVPPVVPPRTVSITIRRPSADEKTL
FT                   ECHRADGMFEDTVWRHVDGLGKTGLALRGADRMLVERLEARDFSAFFESAVRARRNIVI
FT                   VGSTGSGKTSFMRSLCRYLSATERIVTIEDVRELFIRHLENCVHLLYSKGAQGRAHITP
FT                   ADLIACAMRMRPDRVLLAELRGAEAYDFLKLLTTGHAGSMTSFHASSAGIAIERFALMA
FT                   KEHPEAAAWDIASLKRVLRLTIDVIAHMEAQPVLDSHGVQVGKRWAMTEVWFDPREKAA
FT                   IEFDPTERCCDA"
FT   gene            157914..158279
FT                   /locus_tag="Bcen2424_3322"
FT   CDS_pept        157914..158279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10063"
FT                   /protein_id="ABK10063.1"
FT                   /translation="MSGTLAPVWRVTILTLAITIGIYVGLAAAEWLASCMLYASMHRNP
FT                   IRASWSTWLDALVAWYDGRFPNMGRRVAGAGLMGLLVAFGGPALAVYTWLEQAGRRPLY
FT                   GDARFANDAEIRRAGLL"
FT   sig_peptide     157914..158003
FT                   /locus_tag="Bcen2424_3322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.831) with cleavage site probability 0.783 at
FT                   residue 30"
FT   gene            158276..159988
FT                   /locus_tag="Bcen2424_3323"
FT   CDS_pept        158276..159988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3323"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: bcn:Bcen_4843 TraG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10064"
FT                   /protein_id="ABK10064.1"
FT                   /translation="MRQIAPAKSQPTLVVGRWRGRYLRFAGQQFVLLAAPARSGKGVGI
FT                   VIPNLLSYSDSVVVLDIKQENFRLTAGFRRAHGQAVYLFNPFAEDGCTHRYNPLSVIAD
FT                   DMFRVGDILAIGYVLYPAGGHDEFWKDQARNLLLGLVLLLCDLREARRAGASGVPDYPI
FT                   TMGEVLRQSSGNGQPVKTYLNRMLIQHRQYLSRACIDALNRFLANDDKVLASILATFNA
FT                   PLTIWANPIVDAATSANDFDLRDVRRRKMSVYLGVTPDHLSEAAILMNLMFSQLVNLNT
FT                   KELAEDNPALKYQCLLLLDEMTAIGKIQIIARAVAYMAGYNLRLLSIVQSDSQLESVYG
FT                   RADARTIVTNHAMQILFAPREQKDANAYSEMLGTRTERSRTTSRSNGMFGARGGASESF
FT                   SDQRRALMLPQEIKELARDKEIILLENTKPILADRICYWRDRAFTSRVMDAPAVPALDL
FT                   VRFGAQIEQRLRELSDDDVDEQTGELTHVRADYLELVHAWDPRELPQALDNVSCEEAAA
FT                   YVDRHFTLLGVPAEDVARAGRRLARGEDGMTDTETGARKRDPSPVARASGGVQ"
FT   gene            159985..161832
FT                   /locus_tag="Bcen2424_3324"
FT   CDS_pept        159985..161832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10065"
FT                   /protein_id="ABK10065.1"
FT                   /translation="MSVAYISEADRVRTALATIPADDYTTWVDMAFAVKHGLGEAGFEL
FT                   WDAWSQTAPNYDARSARATWRSASESGAITLASLFWLAREHGFDLAGSRAFGDRAARSA
FT                   SAHAPIVGADASLERKRRARRAAVARDALSIWRWARPVAPDHPYLVRKQIAPLPTLREL
FT                   EAEELHVLLGYAPKSNDAALVGRVLIVPVRIGHQISTLELIDCEGRKSSLAGGAKAGGW
FT                   WSVTPEQCRRDACLPVLIAEGVATAVSAWQATGWYTLAALSSGNLSKVATVWRAQHPKD
FT                   VLVILADFGAGFTHAEHAARGAHARLVAPRFASGAHIADQLPTDFNDMAVLDGTEAVGE
FT                   LLRRAVLETPTPASADSKASRTQTEGMSFYLTGDADMGSRKTDNGTGADDVRRHAEADR
FT                   SGGDCASTQPSGTPEEGKLAFTHEPAASPVTETTDDGQHSNQGPRHAMGELIYGLDAVP
FT                   TEVKMAAERRFGSVLRMSTPRENGGPYRGEVLNTEHFLVQEVAPRSVVFHAKGKMTFAS
FT                   DRLRWMDEHHRLNGADVQIVYEGERAKLYPWDRARDQLERAVASLKKSAREMGLDDMDV
FT                   KLDALRAASWARVKAARAAALAQARSRVDGRGEIDDPQR"
FT   gene            161898..162920
FT                   /locus_tag="Bcen2424_3325"
FT   CDS_pept        161898..162920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10066"
FT                   /protein_id="ABK10066.1"
FT                   /translation="MRYMMDDTQSPALFAPSADFAVNAIEPEWTADVDIARRRPSDHFP
FT                   AKQFGYLAMLARRRSEFDAARALLREQAGGSRFEAGRDDAGTDGVSDPGAINSVPKFTE
FT                   IADAPERVRRSYLRAGSQYFLKEAPYPLAFEDRGRYLVTMQTRTDIVASMMDMVQAKAW
FT                   TRIRVSGHDAFCREVWLQAVSIGIEVSGYTPEPADLARLSELNAPTEHTRDRDSERPGL
FT                   QPQAATTATPEGARDESPDRPMGAPVRHSRSLDDEIQLAVIVAAMREQGFSDRSVNRVK
FT                   RRAVRMLDALHAEGVELPRPRVFDPTAPSARAEKDEPQQSSAPSREINHAPAMPSPGER
FT                   "
FT   gene            162927..163445
FT                   /locus_tag="Bcen2424_3326"
FT   CDS_pept        162927..163445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3326"
FT                   /product="conserved hypothetical 20.3 kDa protein"
FT                   /note="KEGG: bcn:Bcen_4840 conserved hypothetical 20.3 kDa
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10067"
FT                   /protein_id="ABK10067.1"
FT                   /translation="MGSRNRARIAVELGALKPLWQARCAQNGVSAGEGIRRLVAEALDI
FT                   AHDPPDTAAILSTPSEPFVRIGVGLMPAELECIKGLAHVQGFTANRWIAALIRAHLTGE
FT                   PQLGNREMMLLAESNRQLAAIRTRLGELARNTGEGHHVPEWEHARAMILTHLRFVAQLL
FT                   QTNLDRWSR"
FT   gene            163447..164502
FT                   /locus_tag="Bcen2424_3327"
FT   CDS_pept        163447..164502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3327"
FT                   /product="plasmid-related protein"
FT                   /note="KEGG: bcn:Bcen_4839 plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10068"
FT                   /protein_id="ABK10068.1"
FT                   /translation="MPFPRQYVDALLVNWGDRLFHEPLRHVRAPHLPGVALPRDARRLR
FT                   ERLALTLRRAPEVMVKITNKASGAQGMGAVRRHLQYISRDGHVELEDQDARVLVGEAAL
FT                   QDLFDEWRWGGWGMPEESRRRETFNLMLSMPAGTDRAAVREASRAFAREIFGDGRLYVF
FT                   AQHDDQPHPHVHLCVRVRGPDGRCLNPRKRDLRTWREVFARQLREHGVDANATPRLARG
FT                   ETQRFPTQAVLRMQSRGVAPRFYRSVLDVRAEKALWDAHIETLAVWRGVAQALAHSGVP
FT                   EDRTMAMAIVDFVQHMPARQLEPGATRLDPATTCSHRDRSNEPRYIARFTGKQRSVNGR
FT                   PPEPDPLFDRD"
FT   gene            complement(164699..165010)
FT                   /locus_tag="Bcen2424_3328"
FT   CDS_pept        complement(164699..165010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10069"
FT                   /protein_id="ABK10069.1"
FT                   /translation="MPGGGPEATPLHHFRASSATHRYTKTDPIGLVESVSAIVSNSRNG
FT                   LHIGWETDAFAVSVCGTPPDATADVESAHAEGLDMKPRDFDARPEHARKQMQRCMREH"
FT   gene            complement(165010..165819)
FT                   /locus_tag="Bcen2424_3329"
FT   CDS_pept        complement(165010..165819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3329"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: bcn:Bcen_4837
FT                   redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10070"
FT                   /protein_id="ABK10070.1"
FT                   /translation="MLSIGPFSIRVAAVAVAALLAWLVARVIQRRPPDGHHKSASSLIL
FT                   DVLLLGLIAARVGYVAQWWPDYAASPRAIVALGDGGFDARIGIAAALVFAGWRLRRLPA
FT                   LRRPVLAGIVAGLGAWGIAQGTLATLQRGAPPLAAMPLQALDSTPVLPAGFVGKPVVVN
FT                   LWATWCAPCRREMPILEQAQRDHPGITVLMLNQGENAHAVRAFLEQQSLRFDHVLLDPS
FT                   LHAMHAYGSRGLPTTLFFNAKGELVESHMGELTAARLKDAITQRFGQ"
FT   gene            complement(166398..166988)
FT                   /locus_tag="Bcen2424_3330"
FT   CDS_pept        complement(166398..166988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10071"
FT                   /protein_id="ABK10071.1"
FT                   /translation="MKSLIRHAALAFVTIGFLSGCASSVTRDASDTAGAAVTASTTPFG
FT                   KKPVIVTVTLDNAAQEALKDNLKFDAKKLQEKIEHALDARKLLAKADATDAMHLNVEVT
FT                   GIRVRSSFSAVMFGFMAGSDYVDGTVTFTDADNHPVDHFKVSASYALGGIAGIDSMRMD
FT                   WLYEKFTEKTLATLDPTTAATQGDAAPAASRKL"
FT   sig_peptide     complement(166899..166988)
FT                   /locus_tag="Bcen2424_3330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.408 at
FT                   residue 30"
FT   gene            complement(167210..168211)
FT                   /locus_tag="Bcen2424_3331"
FT   CDS_pept        complement(167210..168211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10072"
FT                   /protein_id="ABK10072.1"
FT                   /translation="MPSILAPANLPASPVAAETRMVHDVATLKLSDYRSADGASWVIST
FT                   ITPAADSGANVTGTTYFDTAKGQTVPVPDARRRYANRGMWQVVASSSPAVPATGRYDWL
FT                   TLAWLPINRRPLPQTPEHLYSPFIRGGTIVYRWNPSAEGGEQFGNVRMIFPEWTQQVAD
FT                   ALRSTPAAVQDRAWSAPQPALDRLKADTNPMTAVLDFGDALRDEPVERIVAGLPALLRV
FT                   KDRHELSAIVFLCLSAPRAEDRPRFVETINASIAGTDDRARLLAIAYGAFAAGRTQPVP
FT                   FRDGAQRALIDDVFGALKQRTMALGVPVTQGSPWYEFFTAYRLGEAVSGNGQ"
FT   gene            168396..168647
FT                   /locus_tag="Bcen2424_3332"
FT   CDS_pept        168396..168647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3332"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   bcn:Bcen_4834 prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10073"
FT                   /protein_id="ABK10073.1"
FT                   /translation="MTITTLSSRELNQDVTKAKKATKDGPVFITDRGRPAHVLLSFEEY
FT                   QRLTRQQRNIADSLAMPGVEDVEFDPPRANVKIKEVDF"
FT   gene            168647..169066
FT                   /locus_tag="Bcen2424_3333"
FT   CDS_pept        168647..169066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3333"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bcn:Bcen_4833 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10074"
FT                   /protein_id="ABK10074.1"
FT                   /translation="MMFVLDTNVVSELRKVRAGKADRNVAAWCSTVDASVLFVSAITIM
FT                   ELETGVLQIERGDAEQGALLRAWLDGQVLPEFAGRVLPVDTAVAQRCARLHVPDQRSER
FT                   DALIAATAIVHGMTVVTRNVADFVETGVAILNPWD"
FT   gene            169101..169913
FT                   /locus_tag="Bcen2424_3334"
FT   CDS_pept        169101..169913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3334"
FT                   /product="pimeloyl-CoA biosynthesis protein BioC"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bcn:Bcen_4832 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10075"
FT                   /protein_id="ABK10075.1"
FT                   /translation="MPLACKRASIRFGLPCASWANDADRSGARMTGTKAITEHWTRVAD
FT                   QWIGWAGKPGHDAFWKYRAGLAAYIGRGTGVALEVGCGEGRVSRELKALGYDVTASDAV
FT                   PAMLDAARHADSAHRYQLADAAALPFDAASFDLVMAYNVLMDLDDMPRALNEARRVLKP
FT                   DGTLFISIVHPFRDRGAFAGPQPDAPFVLTGSYFGREHFDGMETRDGLSMHFAGWSLPL
FT                   QAYMEALEASGFAIVSLREPPPDHADTDQLKQWARVPLFLWIKARPLR"
FT   gene            complement(170076..170540)
FT                   /locus_tag="Bcen2424_3335"
FT   CDS_pept        complement(170076..170540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10076"
FT                   /protein_id="ABK10076.1"
FT                   /translation="MEEPAPYSLSGALSVQDDLDDEQLDRVSRHLSGIASVYVKHDTVA
FT                   HTVSLCISGTLMRDDARYIEQRIERFAEEHARAASILLSEWNGVTSELVVGMNWDAQCL
FT                   IKLAAIQEQLGKLPERYFDFLLRLEPAGAPARGKQFLSVSIETSDDQQVV"
FT   gene            complement(170619..171020)
FT                   /locus_tag="Bcen2424_3336"
FT   CDS_pept        complement(170619..171020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10077"
FT                   /protein_id="ABK10077.1"
FT                   /translation="MPFTYEICGALPVVGSFRRNHAQQFAQSLAASATVYCVTDAVTHS
FT                   VMIRLRGALTDQEVASIEGKLKEFSRKWARTAAVFSRIRFGEQSLMPLTPGRQVEQLQD
FT                   PAKEYVRHHASTPPHSDTQNTQVLGAPLG"
FT   gene            171155..171526
FT                   /locus_tag="Bcen2424_3337"
FT   CDS_pept        171155..171526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3337"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   bcn:Bcen_4829 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10078"
FT                   /protein_id="ABK10078.1"
FT                   /translation="MNSFSLRLKQERRRLQMNQAEFGEAGGVRKQAQSNYEQGSRIPDA
FT                   SYLTRLAEIGVDVQYLLTGRPSDPGTLALTGDEELLLAGFRELKPRERRGVLALVAAIN
FT                   GTPTERSGTGQASGEAEDV"
FT   gene            complement(171602..172165)
FT                   /locus_tag="Bcen2424_3338"
FT   CDS_pept        complement(171602..172165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10079"
FT                   /protein_id="ABK10079.1"
FT                   /translation="MPIPARPYAWLGVDDYDEWLPQWDHNRFYSRFDATRATAAHHVAH
FT                   VVALLRRLRTGVRAGRAASLQARRVRAFPVYGRSTTHIGPSCYLQDLSTLDSEHGKGVG
FT                   RALIEAVYDAARRHRAERVHWLAAARDGSHSASTTRHVHPDRRADMASRPRVARGIQIR
FT                   PFTGFLYPRGHHFDVSVFVAINGS"
FT   gene            172407..174071
FT                   /locus_tag="Bcen2424_3339"
FT   CDS_pept        172407..174071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3339"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: bcn:Bcen_4827
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10080"
FT                   /protein_id="ABK10080.1"
FT                   /translation="MNEHHAPNPITEVLRAYWKADRWMLLTVAAVVVLSSATAVAAPYL
FT                   FSRLIDALSHRGALHALMAGFVVYAVLLGLSSALQRVVQYLAFMTSGNLGFITSTRFFE
FT                   RVLKKTTAFFVEHNPTEIQSANTRGSRALAVLVQLALMDLIPGTLQIVFTLVTLGAMIN
FT                   LEVAAITAAYGAIAVTIAIVSARRSRVYLDRAIEAGQDNARFVGGAINAMETLRHFGSH
FT                   RWMSERFAEKARAERDNWRAYVMQHVGFLALLGLGLAIQFSVTFWLLLPRHAAGALSIG
FT                   DIVLFNTLLLQLNLPFDMLARSIDESVRSRAALVPFTALWTAPEERQVSHASAFAPRDG
FT                   RIVFERVGYAYGNGRGVRDVDFVAERGGITFVVGETGAGKSTVFKLALKSIEPTDGRIL
FT                   VDGVDFATIDRADWYGAVAVVPQDIVLLNDSLEDNILLGRPRDAQRLRDAAAKAAILPF
FT                   IDGLPDGFRTTVGERGLKLSGGERQRIAIARALYGNPTVLFLDEASSALDEATERDIMA
FT                   HVRLLARDVTVIAITHRRSVIGPTDKVVRLGAARVPA"
FT   sig_peptide     172407..172532
FT                   /locus_tag="Bcen2424_3339"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.966 at
FT                   residue 42"
FT   gene            complement(174090..175127)
FT                   /locus_tag="Bcen2424_3340"
FT   CDS_pept        complement(174090..175127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3340"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bcn:Bcen_4826
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10081"
FT                   /protein_id="ABK10081.1"
FT                   /translation="MEYRTLGRSGLQVPALSFGAGTFGGTGPLFSAWGNTGVDEARRLI
FT                   DICLEAGVNLFDTADVYSDGASERVLGAALKGRRDQVLISTKTGLPTGDGPNEAGTSRA
FT                   RLVRAVDDALRRLDTDYIDLLQLHAFDAGTPVEEVMSTLDDLVRAGKLRYIGVSNFAGW
FT                   QIMKSLAAADRHGWSRYVANQVYYSLVGRDYEWDLMPLGADQGLGALVWSPLGWGRLTG
FT                   KIRRNAPLPEGSRLHETASYGPPVDDARLYDVVDALDAIAEETGKTVPQIALNWLLQRP
FT                   TVSSVIVGARNEEQLRQNLGAVGWTLTDAQVAKLDAASAVEAPYPYFPYRRQAVFARLN
FT                   PPMRG"
FT   gene            175255..176136
FT                   /locus_tag="Bcen2424_3341"
FT   CDS_pept        175255..176136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3341"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4825 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10082"
FT                   /protein_id="ABK10082.1"
FT                   /translation="MLLDNLALFLRIVEKGGLAAAGREVGLSPATVSERLTALERHYGA
FT                   ALLTRTTRAISLTDEGRTLVDGARRLLAEADELESRVRLGVQTLSGPVRLSAPADLGRE
FT                   RVVPVVDAFLADHPGVTVDLHLGDGYVDLVGQGLDFAIRRGTLADSSLRSRSLGRARRV
FT                   VCASPAYLAAHGAPMHPDELAAHDCIVMRFGQELYAEWPFSIDGVLKRVVVRGRRVAND
FT                   GALVRAWCIAGHGIALKSLVDVERDLASGALVEILRDFSPGEVDLQIVYPGSVAQPRRV
FT                   RALIDRLAQALA"
FT   gene            176316..176615
FT                   /locus_tag="Bcen2424_3342"
FT   CDS_pept        176316..176615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3342"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein, ArsR; KEGG: bcn:Bcen_4824
FT                   putative transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10083"
FT                   /protein_id="ABK10083.1"
FT                   /translation="MDDVTRLSALANESRLAVMRWLRQPRKHFPPQPHGDVDELGVCCT
FT                   YITEKLGIAPATTTRHMRILADAGLVRATRVGKFTYYKRIDGALQRLGRDLSQL"
FT   gene            176636..177988
FT                   /locus_tag="Bcen2424_3343"
FT   CDS_pept        176636..177988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3343"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   bcn:Bcen_4823 pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10084"
FT                   /protein_id="ABK10084.1"
FT                   /translation="MDELSLLADADRRAHAYLAATNERRAFPDAAALAGLAAFDEPLPD
FT                   AGRPADDVLRLLDEHGAPATVASNGPNYFGFVIGATLPAAAAAERLMLAWDQCASSYAN
FT                   SPVAATLERQAARWVVDALGLPEGSAVGFGTSATACTLVALVAARRALLARKGWDIDED
FT                   GLIGAPEVKVVISALAHITVKKALRVLGFGMKRIVVAPVDTHGRIDPAQLPPLDDMTIF
FT                   CVQAGEVNTGEFDPFAALIPPAKAAGAWVHVDGAFGLWARASSKRALTDGIDGADSWTT
FT                   DGHKWLNTPYDGAMVICRDAAALATAMNSDAVYLSGAHDAQKNLNLEFSRRARGIPVWA
FT                   ALRSLGRAGVATMIERHCAQAARVADGLRAAGYDVLNRVVLNQVLVRAGTDEETAAILE
FT                   AAQASGDVWFGATVWQGRPAFRISVSSWRTEDVHIDRLVALLTKLRGVHVG"
FT   gene            complement(177992..178981)
FT                   /locus_tag="Bcen2424_3344"
FT   CDS_pept        complement(177992..178981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3344"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4822 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10085"
FT                   /protein_id="ABK10085.1"
FT                   /translation="MIIFTCHSAFRPAPVPSFSLDRSPMKLKQLDAFLAVAEHRTIRGA
FT                   ARALGVTQPAVSGIVRELEHELGVPLVVRSVKGIALTDYGSAFAIRARLIVEEIQRTRD
FT                   EIEQLRLGTTGSVSIAVSPTVALTILPRAFAAFTRDLPGATLNVDDALTATDLARLRDG
FT                   SLDFIVTHQLSNALPDPDEFASIPLFRTAFAVVARSRHRLARARSLRELVDAHWCVPRY
FT                   GEGGDDLIRSIFMPFGLDVPKRVVHCPSFAATLGLVSQTDALGVFARPLAEVERQSRGI
FT                   VALNLAEPMPALTVAIVMRRHALLTPAALHFIECLKGASATVSAADDA"
FT   gene            179053..180276
FT                   /locus_tag="Bcen2424_3345"
FT   CDS_pept        179053..180276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3345"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: bcn:Bcen_4821 amidase,
FT                   hydantoinase/carbamoylase; TIGRFAM: amidase,
FT                   hydantoinase/carbamoylase family; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10086"
FT                   /protein_id="ABK10086.1"
FT                   /translation="MMRVNQQRLWDSLMEMATIGATAHGGSCRLALSDDDAQGRRRFIA
FT                   WCEAAGCEIRIDPIGNVFARRPGTQPGLPAVMCGSHLDTQPLGGRFDGVYGVLAGLEAI
FT                   RTLNEHGIATRHPIDVVAWTNEEGSRFTPGMMGSAVYAGALDLDYALARPCMQTGVLLR
FT                   DELERTGFAGPARERQMPKAYFEAHIEQGPVLEQAGLPIGVVTGVQGIYELDVTVTGFE
FT                   SHAGTTPMSVRRDAMGVAAAMIAAIVEHGHAFDADARVTVGHVACEPNSPSTIPGKVRF
FT                   SVDVRHPSRPALQQLVADIEAICMERTALRGTCVQVQTIAEYAPVVFDADCVVRVRQAT
FT                   AAAGYPYLEMCSGAGHDAVNLSYVAPSAMVFVPCKAGLSHNEAEDADPVHLAQGAAVLA
FT                   NLLADCAR"
FT   gene            180398..180865
FT                   /locus_tag="Bcen2424_3346"
FT   CDS_pept        180398..180865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3346"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin domain protein; Cupin 2, conserved
FT                   barrel domain protein; KEGG: bcn:Bcen_4820 cupin 2,
FT                   conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10087"
FT                   /protein_id="ABK10087.1"
FT                   /translation="MSTPFPRELLKAADIAKMEPTRAVHSLNPNAVRLKRPLSDLTGLT
FT                   QFGVHLLTLMPGHESAEYHRHLYEEEFVYVLSGTGAVTIGEHASEIGPGDFIGFPRGGD
FT                   AHTVQNTGDAPLELLVGGQRLEHDVCEYPRIGKRLYIAGELEEYVELPKQP"
FT   gene            181120..181500
FT                   /locus_tag="Bcen2424_3347"
FT   CDS_pept        181120..181500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10088"
FT                   /protein_id="ABK10088.1"
FT                   /translation="MRQIPFLAFALSALVPGLVWSYWADDPGSLKYSIPIAYLGTAAFA
FT                   IPQYLLVTKYWRVSMISSCLCGSITGLLTWIATYLICTAIWDDDVFKAGVAVVLGFMAF
FT                   VGLGALAGFVFWLMHRWQRSER"
FT   sig_peptide     181120..181185
FT                   /locus_tag="Bcen2424_3347"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.562 at
FT                   residue 22"
FT   gene            complement(181469..181759)
FT                   /locus_tag="Bcen2424_3348"
FT   CDS_pept        complement(181469..181759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10089"
FT                   /protein_id="ABK10089.1"
FT                   /translation="MTFRAPAQSVENAGRVFISAFWYPKKMHRPIEIPVLRNGQWAPAC
FT                   PNKRVFSTPCFYEFLFCLSKQKAIDSIFIRNPSSPPLARSKFIVRIAANDA"
FT   gene            181832..184291
FT                   /locus_tag="Bcen2424_3349"
FT   CDS_pept        181832..184291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3349"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="TIGRFAM: putative alpha-1,2-mannosidase; PFAM:
FT                   glycosyl hydrolase 92; KEGG: bcn:Bcen_4818
FT                   alpha-1,2-mannosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10090"
FT                   /protein_id="ABK10090.1"
FT                   /translation="MSRNWGLGTALLALCVAVASCGGDGDSPSAVAANMSTSAQSQGNE
FT                   NGNGGNDNESGNGSEAARKNADVRVVQYVNPLIGTDYATDQPADPVGSGLGGGTFPGPT
FT                   VPFGMMQWSPMTPTAQYDGRKGDGSGFSGGYWYGDASINAFSILHLSGTGCWANGGYLN
FT                   VMPQLAPGDAGTPATFDHTNETAQAGYYGVTLGNGIKAELTATLRTGFARFTYPALAQG
FT                   QQATIAIDPTVLNNRAQGTTSDTVSQVGDRALSGTIAGGGFCWAGHAVPVYYYAEFSQP
FT                   FAAKPALSNNRPVTLTFNVDSKHPDVMMKLGISFVSEANAKANLRAENPETDAQGERNW
FT                   RFDKVRRAASAAWNARLNAIQVAGGSDADKTKFYTALYHASLHPNVFNDVNGQYPDFYA
FT                   SNGASTAPTRQVENGRTMYANFSGWDIDRSFIQLQALLDPVRTSDIVQSLVLDAKACGA
FT                   FPRWAYFNTETAVMPGDAGSIITANAYAFGATHFDTQAALSIMKASTAPGAACAGTPVM
FT                   GSRADYDRLGYVPASGSGDNQTASNTLEYALRDFAVSRFATALGDTATAGALLKSSGNW
FT                   QHLFDRGAIRPKTSAGAWITDGSGFMEGNAEQYTWYVPHDLAGVIAQAGGATPVVKRLD
FT                   TFFTHLNIGTEQPYFYVGNEVTMAVPWVYAWAGAPSHTQRVLHASLANAFGPGAAGLPG
FT                   NDDLGALSGWYVWAALGLYPVVPGVSGVALSSPQFEAITVRVGQQDGSYRLLHIAAPGA
FT                   GSGDGASFYVKSLKLNGTSWPAAWLPLEHIAKGGKLTYAMTADASAATWGADASAMPSF
FT                   PRAAGAQ"
FT   sig_peptide     181832..181900
FT                   /locus_tag="Bcen2424_3349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.615 at
FT                   residue 23"
FT   gene            184357..187017
FT                   /locus_tag="Bcen2424_3350"
FT   CDS_pept        184357..187017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3350"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="TIGRFAM: putative alpha-1,2-mannosidase; PFAM:
FT                   glycosyl hydrolase 92; KEGG: bcn:Bcen_4817
FT                   alpha-1,2-mannosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10091"
FT                   /protein_id="ABK10091.1"
FT                   /translation="MKLRHVVGIGCLAVLSGCGGDQGATDASVLAQMSNAPGNQKDQGN
FT                   QNDQGDQNDQGENGGAHKRSVLRSVDPMIGTANLDINADWSSGVRGHGHVYPGATVPFS
FT                   MVQLGPDTTGGAHTLPWNWDRTSGYQYDDPFITGFTHTHLSGTGIGSGGEVRFLPTLAP
FT                   VDTATLAKVAADASITYDASFSHDDETASPGYYRVKLAPVGSGNTPWNVQGAKILAEMT
FT                   ATTHAGVHRYTYFPSAATQKRSMIVSIDNPIGGSTASGKIQVVDARTIAGWQFTNNWAN
FT                   NKPTYFVARFSKPFDTQHVAFSADGFKAYLTFADGGDGGAVAVKVGISPSSITDAQANL
FT                   ASEVGAKSFDQVRGAAERAWSAALDRVRIKGGSADQRTMFYTSLYRTMLAPTVYNNADG
FT                   SYVGMDSSNDGTTSPPTTSKHANPGFDYSSTFSLWDTFRAEAPLMTLVQPERVDGWVKS
FT                   LLTQFAQNGKGELPVWPLAQTETFTMAGHPSIPMIADAYLKHLTSAGIDDIWTALTTTQ
FT                   RASAHGFDQYRQRGYVYAGDNASVSTTQDYAFDDWATAAVGKAAGKSTADYQPYLTRSQ
FT                   NYRNVFNPAPNNGWKFSQPKDAQGNWVAGFDPTAAEKTDFSESNSWVDTWNIFHDFPGL
FT                   ITLLGGKSQFIAQLDRTFDPANPLTFQYNQGFPDLTGRSGQFFAGNEPANHLPYLYDVT
FT                   GMPSKTQDRVRTVMDDMYSLTLTAGDRALLSGDSLKAALNDPRRVRDAAIPGNDDCGQL
FT                   SAWYVLSALGIYSLNPVGGVFYFGTPLFEEVSIDIPMASGSSAGGALKFGGARRFTITA
FT                   HTASGAAPSSVNRYVQSVSLNGTPLHRPYITYDEMKAGGRLDFVMGSTPNDAWVGQWNG
FT                   QDPNSALAPALALIN"
FT   sig_peptide     184357..184428
FT                   /locus_tag="Bcen2424_3350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.875) with cleavage site probability 0.770 at
FT                   residue 24"
FT   gene            187380..187598
FT                   /locus_tag="Bcen2424_3351"
FT   CDS_pept        187380..187598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3351"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: bcn:Bcen_4816
FT                   transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10092"
FT                   /protein_id="ABK10092.1"
FT                   /translation="MFEATLTSKGQLTLPAGIRHALGLAAGVRIVFTPLDDGTVILRAK
FT                   TRSLLDLQGALPSITSVPIDAMGIGDA"
FT   gene            187598..188017
FT                   /locus_tag="Bcen2424_3352"
FT   CDS_pept        187598..188017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3352"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bcn:Bcen_4815 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10093"
FT                   /protein_id="ABK10093.1"
FT                   /translation="MPSLDTNILVRWLTNDDVDQVAHVRELFAASAGQADAFYIPVTVM
FT                   LELEWVLRSRYKFDRQQILTALTALLETRELSFEAEGALERALHMYREHGGDFADCLHV
FT                   GQASAAGRAPLLTFDERAARLPGAEILGAGRAQLL"
FT   gene            188202..189023
FT                   /locus_tag="Bcen2424_3353"
FT   CDS_pept        188202..189023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3353"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: bcn:Bcen_4814 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10094"
FT                   /protein_id="ABK10094.1"
FT                   /translation="MDAPLPPMSAPIAETTPETEAAGEPRASRVHRPVALVTGSTSGIG
FT                   AAVARRLAADGYAVILHSRSSADTGRAMARELGGAYVQADLADDAERVRLIRDALAVHG
FT                   RLDVLVNNAGVSRVIPHDDLAAATPDVWREMHEINVIAPFRLVAEAEAALREAASHGRA
FT                   GCVVNVSSHAGMRPKGASIPYAAAKAALNHTTRLLARTLAPAIRVNAVAPGLVDTPLTA
FT                   DWTDAQQLWRERAPMRRAATPDDIAQTVAMLVASDYVTGEIVMLDGGLNLT"
FT   gene            complement(189111..189890)
FT                   /locus_tag="Bcen2424_3354"
FT   CDS_pept        complement(189111..189890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3354"
FT                   /product="5'-nucleotidase / 3'-nucleotidase"
FT                   /EC_number="3.1.3.6"
FT                   /EC_number="3.1.3.5"
FT                   /note="KEGG: bcn:Bcen_4813 stationary-phase survival
FT                   protein SurE; TIGRFAM: stationary-phase survival protein
FT                   SurE; PFAM: Survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10095"
FT                   /protein_id="ABK10095.1"
FT                   /translation="MQATRPLFDRVLLTNDDGFDAPGLDILEQVATQLAREVWIVAPAE
FT                   DQSGTSHSLSLHEPLRVHRKGERRFAVRGTPGDCVAIAVSHLMKGARPDVVLSGVNRGA
FT                   NLGTETVFSGTVGAAMTSMLVGVPAIALSQAFTDRNAVPWGTALAHAPDVIRRLVAAGW
FT                   DSDACLNVNFPPRPADDVRALKVTNQGAGTLQGVEIVSGRDPREIDYHWLKLARAPRDD
FT                   DAGSETVALGEGYIAVTPLKFERTHDQALARLRSNLG"
FT   gene            complement(190082..190390)
FT                   /locus_tag="Bcen2424_3355"
FT   CDS_pept        complement(190082..190390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3355"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   bcn:Bcen_4812 branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10096"
FT                   /protein_id="ABK10096.1"
FT                   /translation="MPELPDFGTVATIVLMASTTYLSRILGYVLLRNRTLSPRMASVME
FT                   NVPGCVLISVIAPAFVSTRPADLLALAVTLLAATRLSILPTVIVGVASAGLLRYLLG"
FT   gene            complement(190383..191117)
FT                   /locus_tag="Bcen2424_3356"
FT   CDS_pept        complement(190383..191117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3356"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: bcn:Bcen_4811
FT                   AzlC-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10097"
FT                   /protein_id="ABK10097.1"
FT                   /translation="MSSSVSTSSGLRDKPAYVAEMGRGLRAALPVMLGFVPFALVLGAQ
FT                   AAQKGLSLFEVPMMTGLNFGGGSEFAAIHLWTSPPHIALIVAMSFLVNSRHILMGAAFE
FT                   PYIRRLPRRHAFVALFFMCDESWAMSLADARERSATHISVPYYAGICIGLYLTWISMTT
FT                   LGAAVGPTIGNVEQYGFDMAFTAVFLVLLRGMWKGVRASRPWFVSLVVAAATHLALPGA
FT                   WYVAAGACAGLISALLWEPRDA"
FT   gene            191243..191701
FT                   /locus_tag="Bcen2424_3357"
FT   CDS_pept        191243..191701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3357"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bcn:Bcen_4810 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10098"
FT                   /protein_id="ABK10098.1"
FT                   /translation="MKLDAIDRRILSALQRDGRMQNVELAHEVGLSPSPCLRRVRLLEE
FT                   AGVIEKYVAVLNPAKVGKGLTIFTRVWLKGQDAESVNRFAEAVQQMPEVVECHLMAGDC
FT                   DFLLRVVAADIDDYRRFQMEYLTRIPGVLSVKTDIPMQKVKLTSALPT"
FT   gene            191937..192506
FT                   /locus_tag="Bcen2424_3358"
FT   CDS_pept        191937..192506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10099"
FT                   /protein_id="ABK10099.1"
FT                   /translation="MQPFNTPWNSLEIVKLVLGVLTPLSVACLGWLVARRLKRLELVQW
FT                   TNQRLIEKRLALYDAVAPQLNALLCFYTWIGYWKDISPDDVIRAKRDLDRTFHIYRYLF
FT                   DDDVYDAYHTFIHALFEMHTGPGRDARIRSLIQAPDGDRSVHGSYEWKPVWSERFSTAN
FT                   VVSKDDVLRHYTRLMERLRVALGATR"
FT   gene            192655..193335
FT                   /locus_tag="Bcen2424_3359"
FT   CDS_pept        192655..193335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3359"
FT                   /product="protein of unknown function DUF1105"
FT                   /note="PFAM: protein of unknown function DUF1105; KEGG:
FT                   bcn:Bcen_4808 protein of unknown function DUF1105"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10100"
FT                   /protein_id="ABK10100.1"
FT                   /translation="MVVDPGRQPLLIRSPGARRRRLLSAGAPDSLAEPLPAEPEIGDIV
FT                   FIRVTVRPFLEVASATRSWTNHVGIVVGERGGETLIAESTFPLSRVTTMSRVLARSDRG
FT                   ACVIARLRQPLDAAQRRELVAAAMRRIGVVYDTGFNLASRRQFCSRFVREVVCDATRIV
FT                   LGDVETFDTLLHRNPDHPLGFWRIWYFGRIPWHRRTVTPASILDSGSLRVVMDTRDSGT
FT                   GRDG"
FT   gene            complement(193390..194022)
FT                   /locus_tag="Bcen2424_3360"
FT   CDS_pept        complement(193390..194022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3360"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bcn:Bcen_4807 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10101"
FT                   /protein_id="ABK10101.1"
FT                   /translation="MIDLSTLALFSGACLALTITPGPDMLLIASRSVSQGRRAGFATLA
FT                   GIQAGTYCHALAAAFGLSQLFVAVPLAYDVVRFAGAAYLLYLAWKTFRSDATALSPVAS
FT                   QRRRSTATIFRQGLTTNLLNPKMALFVLALFPQFVRPEQGSIAVQILVLATVLNLIGLV
FT                   VNGAVILSASRLSQRIGARRRPSKVPQYLLGSVFVGLAARLAMAGRH"
FT   sig_peptide     complement(193972..194022)
FT                   /locus_tag="Bcen2424_3360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.678 at
FT                   residue 17"
FT   gene            complement(194165..195034)
FT                   /locus_tag="Bcen2424_3361"
FT   CDS_pept        complement(194165..195034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10102"
FT                   /protein_id="ABK10102.1"
FT                   /translation="MLPSVASPLSRHLASIVSIAVLAGATFGGTASAEPLRTASDIAGA
FT                   SLVPLGTLPHSPESGSLDPFCTQYRAKSTTAAGREVAKRDWIVTSEAPLGHYTVVSFAS
FT                   GFNAGTSAICFARNGNLGVFDGATLVALGYTARKAGWQLGSVDRLENGALLVWGGDGPG
FT                   APVGELHEENGGLRLTRVAAESTHCSGRAVVPNVYGKPLDAARKILIAHGWQPLRPREK
FT                   PDAMDGAATLAKHGIIEAEACSGTGVGYCALRYRNAAGVLGVTTVGGEPDRPSENTVID
FT                   YQVACRKQ"
FT   sig_peptide     complement(194933..195034)
FT                   /locus_tag="Bcen2424_3361"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.964 at
FT                   residue 34"
FT   gene            complement(195141..195506)
FT                   /locus_tag="Bcen2424_3362"
FT   CDS_pept        complement(195141..195506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10103"
FT                   /protein_id="ABK10103.1"
FT                   /translation="MAHDRTDGVFSVIQPTEVFKDNLAQLPAIDGIARIDLVGANGDVA
FT                   ATIENQPGKQGSLAVYHYLKQTFGTLDAKAAEHGLAVFAEHTADARNRPGAHPNVDRLL
FT                   AIVAGGDALRIDVVAKD"
FT   gene            complement(195527..196899)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3363"
FT   gene            complement(196922..197656)
FT                   /locus_tag="Bcen2424_3365"
FT   CDS_pept        complement(196922..197656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10104"
FT                   /protein_id="ABK10104.1"
FT                   /translation="MGTDPVNEASTMNAPHCVTEPNILYFGTPVVLVSTLNENGTANLA
FT                   PISSAFWLGWRGVIGIAASSQTTRNLLRTGECVLNLPSSAQADAVDRIARTTGTYPVPD
FT                   GKRAKGYVFEPDKFGTAGLTEAASQTVTPPRALECPVHMEAVVAATYGIGDDTPDLRGR
FT                   IRVFELRIQRVHVHPDLLMDGHPDRIDPDKWSPLIMSFQKFYGLAPRQVHPSRLAEIPE
FT                   RAYRSPDIERSRDAGTLAGSAR"
FT   gene            197834..198160
FT                   /locus_tag="Bcen2424_3366"
FT   CDS_pept        197834..198160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10105"
FT                   /protein_id="ABK10105.1"
FT                   /translation="MDTEQRYTANAPTRAEVDALGGATVIEFGANWCGICAGAQPAITA
FT                   SFSAHPAVRHLKIEDGPGRPLGRSFGVKLWPTLVFLRDGVEVARVVRPADAKQIEADGF
FT                   AALA"
FT   gene            198171..198590
FT                   /locus_tag="Bcen2424_3367"
FT   CDS_pept        198171..198590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3367"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   bcn:Bcen_4801 protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10106"
FT                   /protein_id="ABK10106.1"
FT                   /translation="MQQAITHVGVDTRGSGLVEVTPQVRAFVDQQAIRTGLLTVFCRHT
FT                   SASLLIQENADPSVQRDIERYFATLAPEDDTRYEHDTEGADDMPAHLRTALTQVQLSIP
FT                   VEHGRMVLGTWQGIYVFEHRRAAHRRDIVLHLIGE"
FT   gene            complement(198629..200461)
FT                   /locus_tag="Bcen2424_3368"
FT   CDS_pept        complement(198629..200461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3368"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: bcn:Bcen_4800
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10107"
FT                   /protein_id="ABK10107.1"
FT                   /translation="MTRRRWKNRKIILVLGSLWIMGFAAWAFLLWDLLATSVNEGVLEG
FT                   PREGVFWTAAQYRNVYTRFDRQLILYATREDDDFDHLQMQLDSLSVSFGFLQRPSEVSQ
FT                   YWLRIPRARNEIDALGEFMTRLKREVPLLRDSPKQARQVIDEVNAYWPKVNGLANYFRA
FT                   IEMAQRDFTFHQLKDKQRAILILGIVLGVILCALFLLLFYTMRTRDDLLERQNAALDAE
FT                   RKASDRAFEMIEAKNAFLGMVSHELRTPLQAICGSIEILLARPQSDANLKTIRRLQNSA
FT                   LSLEALVKDLTDYIKLRSTKRVAELDTVGIAPLLAEVLEPLRERIATKRITVTQHVEPA
FT                   GLAICSDRKLLRQVLSNLIENSVKYTTGGSITVAITLADAPAGQQVRIAVRDTGAGIAK
FT                   QHLSKIFEPFYRANDAVGLHVDGIGMGLAVVREIVTTLRGHVDVRSVVGEGSEFVVTLP
FT                   VEVPGVDTAGTVAGDAPALPPVPAHCGRRALIVDDNDNARETLGAMLSALGLEVDLCGT
FT                   GQEGAARFGTGRYDLVVLDLELPDLSGFDVARRIRAMAQPDGNGNGDGRRPAILGVSAY
FT                   ESAALRENQRVFDAFLPKPVHLRELGALVEKLLA"
FT   sig_peptide     complement(200378..200461)
FT                   /locus_tag="Bcen2424_3368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(200463..200966)
FT                   /locus_tag="Bcen2424_3369"
FT   CDS_pept        complement(200463..200966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3369"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   bcn:Bcen_4799 oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10108"
FT                   /protein_id="ABK10108.1"
FT                   /translation="MRVSTIWIKSLLTACLLGMTVAAWAAASFTFTVDGKISKSNQQGK
FT                   MTYVFSEQALMALPQHTIVTSTSWTPKATFTGPRLSDVLKTVGAHGTQIEFRCIDEYTF
FT                   TIPVSDADKYGVILARTMNGKVLGNDNYGPLWIMYPRDQYPDELKTPLGEAKFAWQIIG
FT                   LTVK"
FT   sig_peptide     complement(200889..200966)
FT                   /locus_tag="Bcen2424_3369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 26"
FT   gene            complement(201029..201901)
FT                   /locus_tag="Bcen2424_3370"
FT   CDS_pept        complement(201029..201901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3370"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bcn:Bcen_4798 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10109"
FT                   /protein_id="ABK10109.1"
FT                   /translation="MSTTEQANVDLITANKVRDLLNRNGIPPRSHNTTIANVLGLSFSV
FT                   VTRKMKGLIPWNLSQLQDIATHFGVPPAILLDDKGTQPAAAEMIDATFVIESKRLRCRA
FT                   AISTKATSQIETDFVALQWQGEWIVTEREHAREGRTYPVDVIELRSAQPNVYAARIAVV
FT                   DDSHDVAETVCEYFIEKGVNAIPYFDGASFRKALEVEDFDGYILDWMLGDQTAAELVRG
FT                   IRSSENSGAPIFLLTGKISTGEASEDEIAHIVSHYNARCEEKPVRLPILFAEVARELKL
FT                   TLPAASAAN"
FT   gene            202264..202851
FT                   /locus_tag="Bcen2424_3371"
FT   CDS_pept        202264..202851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3371"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bcn:Bcen_4797 Sel1-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10110"
FT                   /protein_id="ABK10110.1"
FT                   /translation="MYRRLLAPGLLLLLAACAQDPSVTASTVRICDDTGCSDRPKDQVS
FT                   YQKRDDAEERDDPRIAALKQTAKTQPKAAYDLGLRYFRGDGVRQDSYQALKWMREAAER
FT                   GDLNAQKALGSFYLFGLEEMGSDAREAEKWLSIAAARGDKESKKLLDLARKAKKEDEED
FT                   WKWRTQWRDTYYGYWYSGYPYYGVWQQTYWYY"
FT   sig_peptide     202264..202320
FT                   /locus_tag="Bcen2424_3371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.955 at
FT                   residue 19"
FT   gene            202972..203799
FT                   /locus_tag="Bcen2424_3372"
FT   CDS_pept        202972..203799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10111"
FT                   /protein_id="ABK10111.1"
FT                   /translation="MKTNLSQRLTQGALVAALGASVAGCGGVVTPGGQNAGVTGAAAGG
FT                   ASAGADSQLQRCTSPLGTIAVDDGRNADWWGQFGSATKVTSIDPLLRLAVQQSNCFVIT
FT                   SIGNQKSDARLSRITQLQRNSGEYRAGSKQQKGQRVAADYYMEPQIVINDSPIGGIGSM
FT                   IGGLIGNSAVAAVAGHLQTKASVVTLTLFDVRSAVQIAASEGSSTATNYGAALGGFGGG
FT                   VGGALAGFSSTPEGKATVVAFIDAYNKMVVALRSYKAQDVKGGLGRGGQLQVN"
FT   sig_peptide     202972..203082
FT                   /locus_tag="Bcen2424_3372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.586 at
FT                   residue 37"
FT   gene            203930..204943
FT                   /locus_tag="Bcen2424_3373"
FT   CDS_pept        203930..204943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10112"
FT                   /protein_id="ABK10112.1"
FT                   /translation="MKAVALIALTCLALTACGGGDDNSSPAASGGSGTSNNGGSGGTGS
FT                   GGTGSGGNGGSGGSGGSTLTWRYEAQPVAADRASFLTLVNNEGAKGYRYLGDYFYTAGN
FT                   GGTQSIFVNDGTAQTYTYQLQTAPADMTSFVNAANAQGASGYRYEGPLTYGDLYRKDGG
FT                   SSATYTYTTTGLPADANAFLTQANGQGQSGYWFLGPLMVGAVQANVYMKNNASNATYTY
FT                   DALAPTSTVSDFVAQANSEGAKGYRAKGGMAFGTAISWIYVKDQTQSPTFSYESAAIQS
FT                   TGASFVQQANTFGAQGAAYLSDIALGTPAPVTASFYFTPKNCTGFLCTTLNPLTQN"
FT   sig_peptide     203930..203986
FT                   /locus_tag="Bcen2424_3373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.734 at
FT                   residue 19"
FT   gene            complement(205140..206156)
FT                   /locus_tag="Bcen2424_3374"
FT   CDS_pept        complement(205140..206156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3374"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="KEGG: bcn:Bcen_4794
FT                   1-aminocyclopropane-1-carboxylate deaminase; TIGRFAM:
FT                   1-aminocyclopropane-1-carboxylate deaminase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10113"
FT                   /db_xref="GOA:A0AXI7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AXI7"
FT                   /protein_id="ABK10113.1"
FT                   /translation="MNLQRFPRYPLTFGPTPIQPLKRLSAHLGGKVDLYAKREDCNSGL
FT                   AFGGNKTRKLEYLVPDALAQGADTLVSIGGVQSNQTRQVAAVAAHLGMKCVLVQEHWVN
FT                   YEDPVYDRVGNIQLSRMMGADVRLVSDGFDIGIRRSWEEAMESVRQAGGKPYPIPAGCS
FT                   EHPLGGLGFVGFAEEVRAQEAQLGFKFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGI
FT                   DASAKPEQTREQITRIARHTAELVELGRDIVEQDVVLDTRYGGPEYGLPSDGTLEAIRL
FT                   CARLEGMLTDPVYEGKSMHGMIDKVRLGEFEPGSKVLYAHLGGAPALSAYNGIFRNG"
FT   gene            206352..206852
FT                   /locus_tag="Bcen2424_3375"
FT   CDS_pept        206352..206852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3375"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bcn:Bcen_4793 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10114"
FT                   /protein_id="ABK10114.1"
FT                   /translation="MKLDRGSASPADAAPALDRIDRAILRQLQQDASISNVNLAAKVKL
FT                   SAPACLRRVERLKEMGLIRGIVALLDPKPLGAGMLVVIGFVLDRSTPETFAAFEKAAQK
FT                   VSGCVECHVVTGEFDYFMLVRTRDNDSFNRLHAEQLLYLPGVRQVRSFMVLKEILSTHA
FT                   LPV"
FT   gene            207146..208867
FT                   /locus_tag="Bcen2424_3376"
FT   CDS_pept        207146..208867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3376"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: bcn:Bcen_4792 thiamine pyrophosphate enzyme-like TPP
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10115"
FT                   /protein_id="ABK10115.1"
FT                   /translation="MARQTMAEYLAKTLAAAGVERIWGVTGDSLNGLSFSLSQLGSIRW
FT                   MHTRHEESAAFAAGADAASTGRLAVCAGSCGPGNLHLINGLYDCHRNHQPVLAIAAHIP
FT                   STEIGLGYFQETHPQELFRECSHFAELVTNASQFPRVLARAMRTAIEERGVAVIVLPGD
FT                   IALGDGPDEAPAWSESAPPSILPADADLDRLAALLNGSDAVTLLCGSGTQGAHDEVVAL
FT                   ADTLGAPVVHALRGKQFVEWDNPFDVGMTGLIGFSSGYHAMESCDTLLMLGTDFPYRPF
FT                   YPANAKIAQIDWKGSQLGHRAPLALGLVGTVKETIAALLPRLTRKTQRRFLENALKHYA
FT                   AARKGLDDLAVAEPPGRAIHPQYLTKIVDEVAAEDAIFTADVGTPTLWAARYLTMNGKR
FT                   QLHGSFNHGSMANAMPQALGAQGAHPGRQVVSLSGDGGLSMLLGDLLTARQLKLPIKVV
FT                   VYNNSLLGFVSMELKAAGYLDTNVDLSPTDFAAIAKGAGIFSVRVEHSENVEHALRTAF
FT                   EHDGPAVVDVVTSKYELAMPPKIELAHAKGFSLFMLRAILSGRGDEIVELARTNLR"
FT   gene            209336..209926
FT                   /locus_tag="Bcen2424_3377"
FT   CDS_pept        209336..209926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3377"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; SMART: ribosomal RNA adenine methylase
FT                   transferase; KEGG: bcn:Bcen_4790 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10116"
FT                   /protein_id="ABK10116.1"
FT                   /translation="MMWPNAWRVSALFVREWVGRPAAVGALCPSSRHLAREMADAVPDG
FT                   DGLVVELGGGTGAITAALLERGVAPRRLVVVERSPAFVQHLRRRFPGISIVSGDARRLE
FT                   RLLPPGATVDAIVSCLPLRTLPREDVAAIVGQCQRVLSADGVMIQFTYDLRPPGRHPLG
FT                   DSAFVASGSRIVWANIPPARIVTVRCAAAEYAG"
FT   gene            complement(210167..211306)
FT                   /locus_tag="Bcen2424_3378"
FT   CDS_pept        complement(210167..211306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3378"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bcn:Bcen_4789
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10117"
FT                   /protein_id="ABK10117.1"
FT                   /translation="MSAAPRNARIDLLRGVSILLVLLHHFNIAYPLRDTALARVLGWDT
FT                   IHAIVRNGNYGVTMFFAISGYLITSNARRRWGSLSALDVRAFYVSRIARIVPCLLLLLA
FT                   LVNGLAAAGVPIFTNHAPQGIAVSYWLVNLASLTFWMNVLIGAYGWVNYALGVLWSLSV
FT                   EEVFYLSFPLLCIALRRDTRLFAFWLLIAAIGPVYRYTHPGDEGGFLYAYFACFDGIAI
FT                   GCCTALLAERARWQMLAAAPVQWLVAALMTALYLAWPIAQSHVFGVSAMALGTAVLLIG
FT                   AHAEHAPGHGRLLAPLRWSGRLSYELYLFHLIVLGALRTFWPPSSTQGDGKLALLVAYL
FT                   ALSAALSAVIARGYATPLDRFIKRIASRPAARMTDSARV"
FT   gene            complement(211303..212265)
FT                   /locus_tag="Bcen2424_3379"
FT   CDS_pept        complement(211303..212265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3379"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: bcn:Bcen_4788 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10118"
FT                   /protein_id="ABK10118.1"
FT                   /translation="MTGRQPAIRRYTVSHPDGRDRPHRCRPPLRLRTASRFPSAPRIFR
FT                   TLSKELHLKHWHYALFAFAGLLAAASSHAHPVCTVVADAATGKLLVQQGDCSTRVTPAS
FT                   TFKVAIGLMGFDAGVLKDEHTPTLEFHAGYPDWGGAPWREPTDPARWMRLSVFWYSEQV
FT                   TQALGQARFQQYTSAFDYGNADVTSKAGELPGMMGAWVNSSLRISPLEQVAFMRKIVQR
FT                   TLPVSAHAYDMTARITLLDAQRGGWTVHGKTGTGSPGIQYDAAHAYGWFVGWATKGSRT
FT                   LVFANLIQDDERQTPNAGLRSRDTFLAALPTLAAAAPPQ"
FT   gene            212440..212790
FT                   /locus_tag="Bcen2424_3380"
FT   CDS_pept        212440..212790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10119"
FT                   /protein_id="ABK10119.1"
FT                   /translation="MTFIRPFPAFDVAGRRLRAGAPGNVTPFPAPRPRLQLPVTLTADS
FT                   AAAAHARLAALLHSPLGVYVVSARAVRNVIHVHFDIAPEDLDFTLHTLIAQQVDAVIGP
FT                   IARQLCVPAGVR"
FT   gene            212919..213485
FT                   /locus_tag="Bcen2424_3381"
FT   CDS_pept        212919..213485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10120"
FT                   /protein_id="ABK10120.1"
FT                   /translation="MYLTEEVRIARPAARRAHTAALPSGRQLARQLMVTVRTADVLLRQ
FT                   AIRVPDRHQWLVDAERVDAAGGPLTAWDSHVTFRIVKAFAPAFDADTCAADPDQAAVEI
FT                   RLFLPEQAYVAERRIGIFGRRHGQRFSATLSVTAGSQWGGRRNEHVPPAGRHVHGDTLE
FT                   ALVDTVAGIVNAALRVAGHGTTGHG"
FT   gene            complement(213513..214388)
FT                   /locus_tag="Bcen2424_3382"
FT   CDS_pept        complement(213513..214388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3382"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4785 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10121"
FT                   /protein_id="ABK10121.1"
FT                   /translation="MKMLDHDVLATVVAVAETGNMTRAAEAVNRSQSAVSMQIKSLEDA
FT                   IGRPLFVRKPRSIVLTREGEVLLGFARRMLALRDEAWAAVVRPEVTGKVVIGVPDDYAS
FT                   SLLPSVLKKFSATYPKVEIQVMGLPSSALAPLIKEGTVDLVCGTRIKGLSGDFIRHEPM
FT                   AWAAMTNGPRVWEERPLPIAVFMPGSVARENAIRSLERAKVPYRTSYESPSLLGLLSMV
FT                   EAGLAVAPLARCAIPAQLSMLGRSHGLPDLPPLELILARSTKSKRPPCDFLAEQLMEDL
FT                   QRQTGQTGDA"
FT   gene            214551..215870
FT                   /locus_tag="Bcen2424_3383"
FT   CDS_pept        214551..215870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3383"
FT                   /product="uncharacterized membrane-anchored protein"
FT                   /note="KEGG: bcn:Bcen_4784 uncharacterized
FT                   membrane-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10122"
FT                   /protein_id="ABK10122.1"
FT                   /translation="MMDHPLRAALAAELHARPFLRLAEAVSLTHYAIYADGQPDIHETL
FT                   LHALCRDTGIDAPHEGATHYAVQSPCGWHLKWERHTEFSTFTFVAPRRDTGYFDDLAID
FT                   GIPAAWFARLAGIRFVAVRMELLSGDAARRVCGDLRRWIDGPALVGSRVLGGGKVFCDW
FT                   HVRDDGFMRFLVVDEDFREEQGGRLLQRLYEIETYRMMALLALPVARRMSRELDEIHAA
FT                   LHALMQRMDASGADGDDAALLVKLTHLAVRVESLSGSGARFSASRAYEKLVLARIHELR
FT                   EERIEGMPTIAEFMERRFAPAMETCCSVWARHEQIAARIARAVDLLRTRVNLAQEKDVT
FT                   RLLAGMERTARNQLHLQHAVEGLSVAAISYYVLSLATAAFKALHVMNLPVDPELAEGLL
FT                   IAPVVFAVIHITRRTRAQLARAEAVHDSAPVHAAALKQAS"
FT   gene            215905..216108
FT                   /locus_tag="Bcen2424_3384"
FT   CDS_pept        215905..216108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10123"
FT                   /protein_id="ABK10123.1"
FT                   /translation="MTFSQKQAGFYSGFDVAFDEPVVGESGAPEDARVTSYQAVLQEPM
FT                   TSLVGSTIDRPDVAAVAILGYN"
FT   gene            complement(216169..216576)
FT                   /locus_tag="Bcen2424_3385"
FT   CDS_pept        complement(216169..216576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10124"
FT                   /protein_id="ABK10124.1"
FT                   /translation="MPSPRCWQAQPGGSTHRRAPTARIASWGSRGVYSFVVDGFGAGSV
FT                   HARQFGGGGGTVCCMSVPRGKQTWHVRVTYDLTAEEDARNQAPEIVETEVAVPALPNRR
FT                   DGYIEFRFLPGRKIDARWAAYPTMPRMRDGG"
FT   gene            complement(216669..217565)
FT                   /locus_tag="Bcen2424_3386"
FT   CDS_pept        complement(216669..217565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3386"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4781 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10125"
FT                   /protein_id="ABK10125.1"
FT                   /translation="MLLRHIHYFLAVAEHRSFTRAAAALHVSQPALSQQIRQLEDTLGA
FT                   QLFDRTGRVTRLTDAGDVYFRYARQALHDLAEGRRAIHDVQDMSRGSLRVAVTPTFTSY
FT                   LVGPLVEAFHRRYPDVSLSVREMSQERIEALLVDDELDVGIAFDEVQTADIDAQALLVE
FT                   TLALVVNRGHALGSQRKAGLRALHDAPLVLLTAEFATRMQIDRYFREHDLQPRVLMEAN
FT                   SLGAVIEIVRRTNLATLLPATIAVEHDDLVAVALDPAGLRRTAVLLQRKGGYRSAAARA
FT                   FVELALARGAGPVRPAR"
FT   gene            217685..218737
FT                   /locus_tag="Bcen2424_3387"
FT   CDS_pept        217685..218737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3387"
FT                   /product="transposase"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB; KEGG: bcn:Bcen_4780 transposase,
FT                   IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10126"
FT                   /protein_id="ABK10126.1"
FT                   /translation="MILVYRYRVKSLNGLLNKQGRAVNYVWNFCNDTQKHALKWGKKWP
FT                   TGFDLNVLTTGSSKELGIHSGTVNATCEQYAKSRSQRRRPYLRYRGRKSLGWVPLKGRD
FT                   LKREGEAFRFAGNTFRVFNSRPLPEGKIKDRSNFAQDARGNWFLNIVIEMPDVQARPIR
FT                   SGVGIDLGLKDFATLSTGEKLPNDRFGRRAAEKLAKAQRARKHKRHIAKLHAKIANARA
FT                   DFQHKLALDLVRRFDYIAVGNVSAAKLARTRMAKSVYDASWSSFRNKLRYKAIAHGATF
FT                   EEVDESGSTQSCSACGSQDSTTRPKGIAGLRVREWACSRCGVVHDRDINAALNILRCGR
FT                   ASPGVGILCL"
FT   gene            218831..219490
FT                   /locus_tag="Bcen2424_3388"
FT   CDS_pept        218831..219490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3388"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: bcn:Bcen_4779
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10127"
FT                   /protein_id="ABK10127.1"
FT                   /translation="MTDIIEGFLKFQRDAYPARDALFRDLARSQNPRALFISCSDSRLV
FT                   PELVTQREPGDLFVVRNAGNIVPSYGPEPGGVSASVEYAVAALRVTDVVICGHSDCGAM
FT                   TAIATCQCMDHMPAVGHWLRYADSARVVNEARMHRSERERIDSMVRENVVAQLANLKTH
FT                   PAVRLALEEGRLALHGWVYDIESGCIDAYDGASGRFVPLADHPGVRATPATFPVAA"
FT   gene            219521..219991
FT                   /locus_tag="Bcen2424_3389"
FT   CDS_pept        219521..219991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3389"
FT                   /product="cyanate lyase"
FT                   /EC_number="4.2.1.104"
FT                   /note="KEGG: bcn:Bcen_4778 cyanate lyase; TIGRFAM: cyanate
FT                   lyase; PFAM: Cyanate lyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10128"
FT                   /db_xref="GOA:A0AXK2"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AXK2"
FT                   /protein_id="ABK10128.1"
FT                   /translation="MIQSQHSQTARHALAETVVLAKARKNLSFAQLTEGTGLSEAFVTA
FT                   ALLGQHALPADAARVVADKLGLDDDAVLLLQMIPLRGSIDDRVPTDPTIYRFYEMLQVY
FT                   GTTLKALVHEKFGDGIISAINFRLDVKKVDDPEGGSRAVITLDGKYLPTKPF"
FT   gene            220141..220575
FT                   /locus_tag="Bcen2424_3390"
FT   CDS_pept        220141..220575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3390"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_4777 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10129"
FT                   /protein_id="ABK10129.1"
FT                   /translation="MTAHPDVTLQLTDTEQPAARDFISRKLGEFNHAMTGRADTAALDV
FT                   YVTDPATGDVLGGLAGRTSLGVFFIDLFYLPESLRGDGFGSRLLREAEAEAKRRGCARA
FT                   VLYTISFQAPDFYRKHGYETFGEVPCEPAGAARVFMVKVL"
FT   gene            complement(220637..221533)
FT                   /locus_tag="Bcen2424_3391"
FT   CDS_pept        complement(220637..221533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3391"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4776 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10130"
FT                   /protein_id="ABK10130.1"
FT                   /translation="MKIDTLGVQAFVAIADGGSFRQAADTLHVTQTAITQRLRKLEAYL
FT                   GVALVERTTRRTTLTEIGRRFLPQARRLLNELSDALTEIRETGLSQRGDVTIACVPTVG
FT                   VQYLPRILRAFSTHRPHDRVKILDHASASVLQAVLRREAEFGISIAGDQHPELVSVPLT
FT                   HDPYVLVCRDDHPLAKRRRIRWAALQPHPLIFAGEVSGNRGLLDGALKTSGVSLHSFYE
FT                   VQRSSTALGLVAEGLGAAVVPKLAIQKNAYPMIRTIELVEPSVSRTLVLVMRRNAQLSP
FT                   AARALCDMIVERATPGR"
FT   gene            221672..222337
FT                   /locus_tag="Bcen2424_3392"
FT   CDS_pept        221672..222337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3392"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bcn:Bcen_4775 trans-aconitate
FT                   2-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10131"
FT                   /protein_id="ABK10131.1"
FT                   /translation="MTTPLDQYANQYVQFEDERTRPVRDLLAAVPNTPIHTAIDIGCGP
FT                   GNSTEALIARAPDATIHGIDASADMIEAARKRLPALRFDLADVTTWDDPGGYDLILSNA
FT                   VLQWVPAHDTLFPRLVGRLARGGHLAVQMPDNLDEPAHRLMREVAAGGPWADKLKGAAR
FT                   TERFDARYYHALLAPLGSRVDVWRTTYYHPLRGGADAVVEWFKGSALRPFLAALDASR"
FT   gene            complement(222499..223176)
FT                   /locus_tag="Bcen2424_3393"
FT   CDS_pept        complement(222499..223176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3393"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_4774 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10132"
FT                   /protein_id="ABK10132.1"
FT                   /translation="MRRAFIAPTIASRIPSHHRAIAPKTGHRPMDRAEHISIEPALALA
FT                   ADELDGRDFSFDIAWELNAPYQDLLDLRALPARRKDYGFDPAGWARDASGRTALFRATA
FT                   GERLAGFVAIEESWNGMAEIAELAVDRHCRRQGIGKFLLAAAEAWARSHGFGFMRLETQ
FT                   ANNVAACSTYARAGFVLGGHDRFLYADGENAGEVALFWYKDLRDGQTARSRTVDPASVQ
FT                   PMR"
FT   gene            complement(223233..224117)
FT                   /locus_tag="Bcen2424_3394"
FT   CDS_pept        complement(223233..224117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3394"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG:
FT                   bur:Bcep18194_B2786 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10133"
FT                   /protein_id="ABK10133.1"
FT                   /translation="MLLNVNAIHRDNDRINISFKALGELIETVGTPHFVPRLTQLLNEV
FT                   VPLDVAHVERSRVDTTMPTGYRCEWIGSSGIGTASTDISDVMTLYYERFLDSDPLFAGL
FT                   RGKTGTMLVVRDIAAIPPGEFRQRLFDDVHIGHECVLARGTRYSQHSIALERGRDRPPF
FT                   TLAEMNRFRSISDMLFPLLELHASTTAARRIAHATPDVHPLAQFDARLAADGVKLSKRE
FT                   YETCKHLLSGKTVPETADILGVRVASAESYVKRAFAKLGVRTKRELAAWGSATAVLPAA
FT                   GSYDDGAPPAIPR"
FT   gene            complement(224589..225980)
FT                   /locus_tag="Bcen2424_3395"
FT   CDS_pept        complement(224589..225980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3395"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4772 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10134"
FT                   /protein_id="ABK10134.1"
FT                   /translation="MGPSASRTHANPPQRPSAHTGTSSESATRAAAAAAPATPPSRKRL
FT                   LILALLFVTVVINYLDRSNLSIAAPELFKELNIDPVHAGLVFSAFGWTYALMQIPGGWL
FT                   VDKVSPRVLYAGALALWSAATLLLGFAGSFVGLIVLRLAVGALEAPAYPINNRAVTTWF
FT                   PTRERASAIGGYTSGQFVGLAFLTPVLAWLQVHLGWHMVFVATGLAGIAWAAVWYAVYR
FT                   EPRALRGVNAAEIALIRDGGGLVDLEDRIAARSDRAPSTWRDLGVVLGRRKLWGIYLGQ
FT                   FALNSTLWFFLTWFPTYLVKYRGMDFIKSGFLASLPFLAAFVGVLCSGVLSDWLMRRGA
FT                   SQGFARKLPIISGLLISTCIIGANYVSSTGWVIAFMTIAFFGNGFASITWSLVSGLAPA
FT                   RLLGLTGGVFNLVGNLSAIATPIVIGLLVDGADFSRAITYIAAMALAGSLSYGLLVGKV
FT                   ERIDA"
FT   gene            complement(226192..226566)
FT                   /locus_tag="Bcen2424_3396"
FT   CDS_pept        complement(226192..226566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4771 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10135"
FT                   /protein_id="ABK10135.1"
FT                   /translation="MLMELHATVGAATSDLDDDESFANIYCHDAEQDYCFALSRFPDDA
FT                   LIEVMVRDQLNVRVKDLSVQLTDDTIDVEIEPGVAARLDGQTRYVIHLAPGQYDPGTLR
FT                   AALKEIFVGKSGYRDDSTRG"
FT   gene            complement(226584..226964)
FT                   /locus_tag="Bcen2424_3397"
FT   CDS_pept        complement(226584..226964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3397"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type; KEGG:
FT                   bcn:Bcen_4770 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10136"
FT                   /protein_id="ABK10136.1"
FT                   /translation="MKTSATGCSVEEAMRLLGGRWRLLLVSYLLDGPRRFSDLRRDMPG
FT                   ISQRMLTLDLRALEDAGLVRRTVYPEVPVRVEYDLTADGDRLRPVVDVMREFGLWLKAR
FT                   DAHVDAMPDTAAAIETTMHAHK"
FT   gene            227101..227733
FT                   /locus_tag="Bcen2424_3398"
FT   CDS_pept        227101..227733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3398"
FT                   /product="Glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   bcn:Bcen_4769 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10137"
FT                   /protein_id="ABK10137.1"
FT                   /translation="MKLYHAPGSCSQAICIVLREGDIDAEIVKVDARKHVVDGGRDYYD
FT                   VNELGYVPLLELDDGTILREGPVIAQYLADQRPEAALAPAYGTLARYRLMEWLNFLGTE
FT                   IHKGFIPLLYAVQAGRYVEPVRQKLDSRFAWIDRQLDGRTFLTGDTFTVADAYLFALTG
FT                   WGKADWMRSVYNADIDLSRHAHLRAWYERVRERPAVQAALAADNLLR"
FT   gene            227821..228207
FT                   /locus_tag="Bcen2424_3399"
FT   CDS_pept        227821..228207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10138"
FT                   /protein_id="ABK10138.1"
FT                   /translation="MKLLRTFILLLLCAVLPITGLAASGLTGECPMQHTMSMDADTGMN
FT                   MAMSAEMSDCDSMQPPSADHAKAKAKGMACKVTAQCQFGSLYHPAARADVSRPAAFAST
FT                   IVFHYTQSVPARDPNGLWRPPRIS"
FT   sig_peptide     227821..227889
FT                   /locus_tag="Bcen2424_3399"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.584 at
FT                   residue 23"
FT   gene            228299..229591
FT                   /locus_tag="Bcen2424_3400"
FT   CDS_pept        228299..229591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3400"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bcn:Bcen_4767 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10139"
FT                   /protein_id="ABK10139.1"
FT                   /translation="MSFVFRTLRMPRAGRRAPVPWAALLVAGAVHAQPSSLTLDAALQS
FT                   ATDRSASMQAAQASVLARSEAAVKAGQLPDPMLKAGIDNLPVNGGQRFTVGQDFMTMRR
FT                   IGIEQEWVSGDKRRLRTALADEQVGRERAGYLVQLAAVRRQTATAWLDAVYAKQALALQ
FT                   QALLGHMNHELDATQASYRGAKASAGDVVQARAMLAQTQDQVLKAQQAYRTALIALARW
FT                   TAVPVTDVAGTPPAPESFVSSLPPDELRLSQPALVAAADDIAVAEADAAVANSERSPNW
FT                   TWEIAYQQRGGAYSNMVSVGVSIPLPLNRKNRQNRDVAEKAALATKARLMYEDTLRQVQ
FT                   ADIRTQSDTLASGRERIANLGAALLPAADQRVQLATAAYRAGTGSLADTFAARRAQLEA
FT                   QLQVLDLRRDVSQTWAQLEYQVVPSAMAAAQ"
FT   sig_peptide     228299..228397
FT                   /locus_tag="Bcen2424_3400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            229603..231126
FT                   /locus_tag="Bcen2424_3401"
FT   CDS_pept        229603..231126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3401"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bcn:Bcen_4766 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10140"
FT                   /protein_id="ABK10140.1"
FT                   /translation="MTRQSLMRAVLIASAGAVLVGAGYFAGVRRATNGAATASVPAAAP
FT                   SGMPAQQAARKVLYWHDPMVPNQHFDKPGKSPFMDMQLQPVYADEGGAAAGIRIDPGLQ
FT                   QNLGIRYATVRRQQTAAGFDAVGTTQFDEARVEVVQSRVTGYIDHLYARAPMQRIAKGA
FT                   PVASLFVPDWLAPQEEYLALKRGGMDGNLLDAARARMRALSIPDGMIANLDRTGRAQTH
FT                   VVLSAPETGVVSELNVRDGAMVAPGQTLAKIAGLATLWLVVEVPEALALNVQPGMSVDA
FT                   TFAGDPARHFSGRIREVLPGISTGSRTLQARVEIDNASLKLTPGMLMRVRVAAKETVSR
FT                   LLVPSEAVIATGQRTIVIAKLGDGRLQPVSVTVGNDVGGDTEVLGGLNEGDTVVASGQF
FT                   LIDSEASLKSVLPRLERAAGASSAASSATASAPVYETTGKVENVTADDITFSHQPVPAL
FT                   GWGAMTMAFGKPSAHAFPDVKPGQTVRFAFTQADDGYRLTKVEPQGGER"
FT   sig_peptide     229603..229683
FT                   /locus_tag="Bcen2424_3401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.403 at
FT                   residue 27"
FT   gene            231123..234329
FT                   /locus_tag="Bcen2424_3402"
FT   CDS_pept        231123..234329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3402"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: bcn:Bcen_4765 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10141"
FT                   /protein_id="ABK10141.1"
FT                   /translation="MIARLIHWSVHHRFLVLLATVLLAAWGVHSLRQTPLDALPDLSDT
FT                   QVIVKASYPGKAPQVVEDQVTYPLTTTLLGVPGAKTVRAYSSFGDAFVYVLFDDRTDQY
FT                   WARSRVLEYLSQVQSRLPAGATVSLGPDATGVGWVYEYALVDRTGRHDLGQLRALNDWF
FT                   LKFELKAVPDVSEVASIGGMVRQYQVVLDPDKLRAYGITQAAVAEALGKANQASGGSVV
FT                   ELAESEYMVRSSGYLRTLDDFRHVVLRTDDTGTPVLLGDVARIQVGPAMRRGIAELNGQ
FT                   GEVTGGVVVMRSGKNALTTIDAVKAKLADLKRSLPAGVEIVTTYDRSQLIARAVDNLTD
FT                   KLIEEFVIVGVVCAVFLFHLRSALVAILSLPLGVLAAFIVMRYQGVNANLMSLGGIAIA
FT                   IGAMIDAAIVMIENAHKHLEAYDHAHPGEPLTAARRWELVAASAAEVGPALFFSLLIIT
FT                   LSFVPVFSLEGQEGKLFAPLAFTKTYTIAAAAGLSVTLVPVLMGYLVRGRIPHEHANPI
FT                   NRVLIRLYRPLLEATLRRPWAAIGVAVVALVLTAVPLSRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISADKASELLQQTDRLIKTVPEVDTVFGKSGRADTATDPAPLEMFETTIRFKPRST
FT                   WRPGMTPEKLVDELDRTVRVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKISGPDLTGID
FT                   AIATQVEAAVKRVPGVTSALAERLNGGRYVDVDIDRLAAARYGLSVADIQSVVSSAIGG
FT                   EDIGEVIAGRERFPINIRYPREIRDSLENLRQLPVVTARGAQIRLGDVARVAIADGPPM
FT                   IRSENARLSGYVYVDLRGVDLSTAVRAMQQAVARQVALPPGYSIAWSGQFEYLERAAAT
FT                   LRTVVPVTLVVIFVLLFVTFDSAADALLLMSTVPFALVGGFWLVWALGHAVSVATSVGF
FT                   IALAGVAAEFGVVMLLYLKGALQRRLDAGEPLTDALLLDTIREGAVLRVRPKAMTVAVV
FT                   LAGLVPIMIGHGAGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWLLLQRRRARSASRAR
FT                   HSDAVPSGTNVPSLPTGESR"
FT   sig_peptide     231123..231215
FT                   /locus_tag="Bcen2424_3402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.621 at
FT                   residue 31"
FT   gene            234326..234694
FT                   /locus_tag="Bcen2424_3403"
FT   CDS_pept        234326..234694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3403"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: bcn:Bcen_4764 efflux transporter, RND family,
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10142"
FT                   /protein_id="ABK10142.1"
FT                   /translation="MKMNQLIAAVTAVVALSAFAVPALAAGEMSNMDMSGMKMSSDGAT
FT                   ESNAALTDAEVKKVDAASGKITLKHGALQNVGMPPMTMAFKAKDAAMLAQAHAGDKVKV
FT                   RIEKVDGTLTIVKLVKGS"
FT   sig_peptide     234326..234403
FT                   /locus_tag="Bcen2424_3403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 26"
FT   gene            complement(234789..235799)
FT                   /locus_tag="Bcen2424_3404"
FT   CDS_pept        complement(234789..235799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3404"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: bcn:Bcen_4763 sodium/calcium exchanger membrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10143"
FT                   /protein_id="ABK10143.1"
FT                   /translation="MTFMFVELAFMLIVILVAAEVFTNALEHLGERLKISEGVTGSLFA
FT                   AVGTALPETMVPLLALAGGTSSQAVNEEIGVGAILGAPLMLATLTTFLMALAVIRSRGP
FT                   RGTIAPERTGFVRDMNTFLAAFSLATVAMFVPHHNWAVRALLAAMLVGLYVMYVVLTFR
FT                   ASTRLVDAGHGTEAPHAMLLSRIGLPTNLATIVLQLLIGVALLVGGAKGFIHGVEGVSH
FT                   VLGVSALLLSLIIVPIATELPEKVNSVLWIRRGKDTLAFGNITGAMVFQGTLLPAIGIM
FT                   LTPWEPRPEVLTGVIITLAAAAWLRVNARTRGLAIWALLANGAGYAGYLAVTLAR"
FT   gene            236154..236429
FT                   /locus_tag="Bcen2424_3405"
FT   CDS_pept        236154..236429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3405"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bcn:Bcen_4762 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10144"
FT                   /protein_id="ABK10144.1"
FT                   /translation="MSHTVREKQKLLNRVRRIKGQVEAIERALEDERGCNDVLQLITSC
FT                   RGAMNGLLAVVLEDHIRSHLVDADTPDAHEGSATEQLIEVVHSYFK"
FT   gene            236442..237455
FT                   /locus_tag="Bcen2424_3406"
FT   CDS_pept        236442..237455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3406"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bcn:Bcen_4761 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10145"
FT                   /protein_id="ABK10145.1"
FT                   /translation="MNEFKSPAAGGAHSHAFLGAAHARNERKTWMVIGLCTAMMIAEIV
FT                   GGTLFGSLALVADGLHMSTHAGAMLIAALAYTYARRHADDPRFVFGTGKLGDLAGFTSA
FT                   IVLAMIALLIGYEAIARLLAPVPIHFDEAIPIAVLGLAVNLASVWLLSGDHHHGHDHGH
FT                   HHAHGHDDHHDHDHDDAHHAHHAHGSHSAAHRDHNIRSAYVHVIADAAVSVLAIVGLLL
FT                   ARAFGWVWMDPLAGIVGALVIANWAYGLMRDTGGILLDVNVDRKLTDNVRRAIEALGDK
FT                   VNDLHVWRVGPGHMSAIVSVESGDAARDARFYHALVAGFDGVSHVTVEVLTPAKAA"
FT   gene            237458..237643
FT                   /locus_tag="Bcen2424_3407"
FT   CDS_pept        237458..237643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3407"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   bcn:Bcen_4760 protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10146"
FT                   /protein_id="ABK10146.1"
FT                   /translation="MAVKSPCIELCAFDGRTGFCVGCLRTRDEARDWKKLTDHRRHQIL
FT                   NDRTRRQAKLRRDAAE"
FT   gene            237735..238943
FT                   /locus_tag="Bcen2424_3408"
FT   CDS_pept        237735..238943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3408"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4759 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10147"
FT                   /protein_id="ABK10147.1"
FT                   /translation="MQTDSSTGILRQIPRSVWVLGCVSLLMDVSSEIIHSLLPMFLMAG
FT                   LGASATTIGLIEGIAEATSPVVKVFSGTLSDYLRNRKWLAVAGYALGALSKPLFAIAPT
FT                   IGVVVTARIVDRVGKGIRGAPRDALVADVTPVHLRGAAYGLRQSLDTVGAFLGPLLAVV
FT                   IMLMWRDDFRLAFWLAVIPGVLAVALLAVGIDEPARAPGEKRVNPVRREVVAQLGARYW
FT                   WVVAVGGVFALARFSEAFLVLRAMSSGVPVALVPLVMVAMNVVYALSAYPFGKLADTTS
FT                   HTKLMVVGLALLIVADIVLAHGAHWPTVLVGVALWGLHMGMTQGLLATMVAQAAPAELR
FT                   GTAFGVFNLISGIVTLVSSVVAGALWDQMGAAATFYAGAVFSAATIVLLVCVRTSFGAV
FT                   QDR"
FT   gene            complement(238967..240376)
FT                   /locus_tag="Bcen2424_3409"
FT   CDS_pept        complement(238967..240376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3409"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: bcn:Bcen_4758
FT                   heavy metal sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10148"
FT                   /protein_id="ABK10148.1"
FT                   /translation="MTARPASYSLLRRLTLAFAAVAALVFALTGAYLYRSLSAELTRRD
FT                   DIEISAKLNQFLQLARASGSTAALRADPAVFHDVLLSHPGVYLGIYDAQHRPLVEHSDE
FT                   AGNTLASVISASHPAGNAGSPFTCAPPGIGTSRCVYARETLPSGEAIQVALARTATDRQ
FT                   SLLESYRVDIWLAAAVGALLVGALGYAVASRGLRPVESLGRQTSRIEAHNLNARLDARG
FT                   GPVELRELATSVNRMLDRLERAFVRLSQFSSDLAHDMRTPLANVISSSQITLSRARTTD
FT                   EYEALIESNIEECERLQRMIENMLFLARTDNARQHLKTAELDAGSELRRLASYFQALAD
FT                   EAGVRIDVHGEAPVVADATLFRRAVSNLASNALEHAQAASTIELAVSVQGSYAVVEVTN
FT                   RGVAIPPEQVERIFERFYRIDSSRHGAARNAGLGLAIVKSIMELHRGKVEVASRDGRTT
FT                   FALYFPRGTDS"
FT   sig_peptide     complement(240293..240376)
FT                   /locus_tag="Bcen2424_3409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.562 at
FT                   residue 28"
FT   gene            complement(240373..241044)
FT                   /locus_tag="Bcen2424_3410"
FT   CDS_pept        complement(240373..241044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3410"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bcn:Bcen_4757 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10149"
FT                   /protein_id="ABK10149.1"
FT                   /translation="MRILIVEDEPKMASYLRKGLTEASYTVDVTENGQDGLFLALHEDF
FT                   DLIVLDVMLPALDGFEVLRRLRAQKQTPVLLLTAREAIEDKVAGLELGADDYLLKPFAY
FT                   AEFLARIRSLLRRAPRNVRDILHVADLEIDLLKRRVRRADTRIDLTAQEFALLQLLAER
FT                   EGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKIDNAYEKKLIHTIRGMGYVLEDR
FT                   S"
FT   gene            241208..241633
FT                   /locus_tag="Bcen2424_3411"
FT   CDS_pept        241208..241633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10150"
FT                   /protein_id="ABK10150.1"
FT                   /translation="MSPERAVVRRAGPNDRCLPDLASMSYWRTFLVVVLLALSLSIPSF
FT                   AAVSMQCPGAAVPQEEKASHAMPAAQGGHHDHGDHARHASSCAACVSCCFGTGMSSAPA
FT                   VPAAASVGVTIVAPPRSAGGVSFLTGGIDRPPRRMPA"
FT   gene            241650..241991
FT                   /locus_tag="Bcen2424_3412"
FT   CDS_pept        241650..241991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10151"
FT                   /protein_id="ABK10151.1"
FT                   /translation="MRRDPPSAPAAASGAPDDLRRDMFMRLIIAALLGVAALVPSLAPA
FT                   QTPFPDPADAAASVPDVTVTSAFDGYRPYRDDAGPGWKQLNRDVMERPAKGRTTGNAAP
FT                   HSTHGGATR"
FT   gene            241988..243490
FT                   /locus_tag="Bcen2424_3413"
FT   CDS_pept        241988..243490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3413"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bcn:Bcen_4754 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10152"
FT                   /protein_id="ABK10152.1"
FT                   /translation="MTTLAISPRIGAAAIALAFLVGCTTFSKDGGFDAVSSAASERIGK
FT                   DAVVVRTDADREAVDQRTKELLGKPLSMDDAVQVALLNNRGLQASYAELGLSEADLVQA
FT                   GRLPNPRFAFSRTRAGDGELTLGRTFSANVFALLTMPLATKIERRRFEQTKLETADAML
FT                   KVAADARRAYVEAVAAEQAAHYAQQVRDAASAAAELALRMRQAGNFSRLDYAREQAFHA
FT                   DAVAQHAKTRQQAIAAREKLTRAMGLWGERTRYALPERLPDLPKARPNLPDLERFAMGN
FT                   RLDVQAAKLQTQGVASSLGLSKATRFVNAVELGYVNDYETGKGHEHGYEISVEIPLFDW
FT                   GGAKVARAEAIYMQSANRLAKTAIDARSEVRESYAAYVTSYDVATHYRDEVVPLRKTIS
FT                   DELLLRYNGMLASVFELLTDAREQVGAVNGYIDALKDYWLAETDLQMAVGGRLPLPGAV
FT                   PSATHSAESAPQSPSSADAAPQPASTPAAPSAPATQPHPEGH"
FT   sig_peptide     241988..242071
FT                   /locus_tag="Bcen2424_3413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.960 at
FT                   residue 28"
FT   gene            243492..244787
FT                   /locus_tag="Bcen2424_3414"
FT   CDS_pept        243492..244787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3414"
FT                   /product="multicopper oxidase, type 2; multicopper oxidase,
FT                   type 3"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: multicopper oxidase, type 2; multicopper oxidase,
FT                   type 3; KEGG: bcn:Bcen_4753 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10153"
FT                   /protein_id="ABK10153.1"
FT                   /translation="MVSRRQFLSGSGAALLGAAMVSKAGAASLPDAPTMAKAGTQPPLV
FT                   PPNGRPYTPVATLNGWSLPWRMKNGWKEFHLTAEPVVREMAPGMNANLWGYNGQSPGPT
FT                   IEAVEGDKVRIFVTNRLPEHTTIHWHGLRLPNGMDGVGGLTQPHIPPGKTFVYEFQLEA
FT                   HGTFMYHPHADEMVQMAMGMMGMFIVHPKDRGTMAVDRDFVFLLAAYDIDPGSYTPRVN
FT                   EMTDFNMWTFNSRVFPGIDPLPVRAGDRVRIRFGNLTMTNHPIHLHGYSFEVAGTDGGW
FT                   IPPAARWPEVTADVAVGQMRAIEFTADRPGDWAFHCHKSHHTMNAMGHQVPNLIGVPQK
FT                   DLAKRIGKLVPDYMAMGSTGGAMGGMEMPLPDNTLPMMTGTGPFGPLEMGGMFTVLKVR
FT                   QGLGRNDYRDPGWFRHPKGTVAYEYTGELPDG"
FT   sig_peptide     243492..243572
FT                   /locus_tag="Bcen2424_3414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            244854..245198
FT                   /locus_tag="Bcen2424_3415"
FT   CDS_pept        244854..245198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10154"
FT                   /protein_id="ABK10154.1"
FT                   /translation="MKKGLVLMATGCALAFSAASYAAGDMAGMDMSANAKQGAAASRMS
FT                   HGEIRKVDTAAGKLTIKHGPLENLGMDAMTMVFKVKDPAMLAQVKVGDTIDFVAEDVDG
FT                   ALTVVELKKP"
FT   sig_peptide     244854..244922
FT                   /locus_tag="Bcen2424_3415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 23"
FT   gene            245215..245595
FT                   /locus_tag="Bcen2424_3416"
FT   CDS_pept        245215..245595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3416"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bcn:Bcen_4751 copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10155"
FT                   /protein_id="ABK10155.1"
FT                   /translation="MTISMLKRLAGFAAATAIFAGAPVAASAHGKLERAVPAAGSTIDA
FT                   APDTVRLTFNEDVEPAFSSVKVSDASGNAVTQDKAKVDASNPRVMTVAIPKLAAGAYTV
FT                   QWAAMTADAHRTKGAYTFRVKE"
FT   sig_peptide     245215..245301
FT                   /locus_tag="Bcen2424_3416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.613 at
FT                   residue 29"
FT   gene            245592..246533
FT                   /locus_tag="Bcen2424_3417"
FT   CDS_pept        245592..246533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3417"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   bcn:Bcen_4750 copper resistance D"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10156"
FT                   /protein_id="ABK10156.1"
FT                   /translation="MNDGIVGLLRLVAVAIQNAGFAVVVGALLGRHWLARGVSAWQHDV
FT                   GRRLAATLRIASVVSLLASVAAFWAHCALMSEVSLLDAGLAVCSMLARTGFGHAWLAGA
FT                   AFMLVVVLLSFVGRTDDTRFPFAMVAALACVALARSNGGHPVDAGLFSVPVWIDWLHLL
FT                   AISAWVGLVLVTAFGVMSRLARMPASERATGASFVQSLSDASTYALVVLFATGAYNGWR
FT                   GVDTPANLFASTYGQILLLKLVLVLIAAMLGGHNRFFGMPELLAALKDPAAAIPVRALR
FT                   RFGMVLRVEAVVLGGVLMVAAVLVSSALPGTA"
FT   gene            246703..248517
FT                   /locus_tag="Bcen2424_3418"
FT   CDS_pept        246703..248517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3418"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bcn:Bcen_4749 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10157"
FT                   /protein_id="ABK10157.1"
FT                   /translation="MRSPICLFAPLLLLPTLAAPVFAATAAPVSANCGGSTTPIADIQG
FT                   AGAPSPLAGQNASIEAVVTADFGGTDGFGGFFVQQADAQRRNQPGVSEGLFVYAPKARA
FT                   KAGDLVHVTGKVEEKYGQTQLTLQGAIAVCANGQTVTPATLTLPVDSPSAFAAYEGMLV
FT                   RLPQTLSVTDNYELGRYGSVMLSNGRLRTPTSVVPPAQAQTQIDANARNRLILDDGSNK
FT                   QNPATVPYPAPGLSAANTLRAGYTVRDVEGVLEVRYGAWRVQPLPGAAVPAFDARSNPR
FT                   TIAPARDPKSNLRVASFNVLNYFNGNGLGGGFDDPNNRGAKTFQEFQRQEAKIVSALKA
FT                   IDADVIGLMEIQNNGYGELSAVRQLAAKLGNHWRVVDPGTSRLGGDAIAVAMIYDSRKV
FT                   EPVGRAATLAIDDKNRQPLAQSFRLVNGNKQALTVAVNHLKSKNCPDAANDDLDQGDGQ
FT                   GCWNPTRTRAAAKVADWLAGNPTGVKSQGVLLIGDFNSYTYEDPIRTLESRGYRNLVAR
FT                   WIGANAYSYVYNGEAGYLDHALATLPLASHVKAVHEWHINADEPLALQYTLAYKSAEQQ
FT                   KTFYAADAYRSSDHDPVLIDIALPGGGK"
FT   sig_peptide     246703..246774
FT                   /locus_tag="Bcen2424_3418"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.941 at
FT                   residue 24"
FT   gene            complement(248696..248977)
FT                   /locus_tag="Bcen2424_3419"
FT   CDS_pept        complement(248696..248977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10158"
FT                   /protein_id="ABK10158.1"
FT                   /translation="MLRRVVKDHSDIKNPAMMRRLDSVWYLKENGIIRARRALSAMSRR
FT                   IFYFFGITRKPFLHWRNASKAFRSTGLFFQFYYRQSIKTMQQHAHVIR"
FT   gene            249216..251063
FT                   /locus_tag="Bcen2424_3420"
FT   CDS_pept        249216..251063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3420"
FT                   /product="peptidase S10, serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10, serine carboxypeptidase; KEGG:
FT                   bcn:Bcen_4747 peptidase S10, serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10159"
FT                   /protein_id="ABK10159.1"
FT                   /translation="MKPDRSSTGSRRVRRGRLAGLGALTAMTLALAACGGDDSSSVGAS
FT                   SLAQATASQQASAQAAGTQAPATNQPYVDPVAYSMNATDGLAPSQVSEKAAVMHYQWKG
FT                   GGKTIDYTTTTGHLTAQDANGNPEASMSYVAYTAPSTNGKPRPVTFVYNGGPGSSSIWL
FT                   RLGSFAPTRVATPDPLFGNNWPNYPLVDNAESLIDTTDLVFIDPPGTGLSEAVLPNTNQ
FT                   KYWGSDVDVNIMRDFIQRYLNVNSRGTSPIYLYGESYGTPRTDMLALALESAGVHLTGI
FT                   VLQSAILNYFADAVEAVAITQSTEGLLLDTDTVAGYLPGYAAVAAYFNQVSPAPVNQDL
FT                   YALQTELFTTLIYSQLQKYSQSWVLSQLGIPDALGTPVFPSDATLRLWSIPSSLTQQAL
FT                   RGYFNANPFGTSLLPGTTIGRYDGRVSLPNSDPRLQNDGDPSDILISQPFTNALATQMP
FT                   DYLGYTAPNATYLPLNDNIIEVWDFSHDGQPMPDTIPDLLGALQLNPKLRVLAENGFHD
FT                   LATPFFNTEKQLARLQTVKGLNPKLQVNFFQGGHMIYLDDVARPQMKRDLQTFYKGARI
FT                   PTALTLHTLPPPWPDENPPSVPTGSTPGATAATTLAATP"
FT   sig_peptide     249216..249323
FT                   /locus_tag="Bcen2424_3420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.483 at
FT                   residue 36"
FT   gene            251107..251538
FT                   /locus_tag="Bcen2424_3421"
FT   CDS_pept        251107..251538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10160"
FT                   /protein_id="ABK10160.1"
FT                   /translation="MRAIMSLIQLMRRMSPLIVLGAVMSSAHALPPQAVAPVKLPHGGR
FT                   GVDGPFFPATRAAPVLPSTGAALQQQAQQRVDARLGGNTVLSNGAAVTKAQAQSSGLGF
FT                   VSKHFDEIDAKHTGRVTMSDVRQFIRQRQVQAQQEQQDE"
FT   sig_peptide     251107..251196
FT                   /locus_tag="Bcen2424_3421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 30"
FT   gene            complement(251628..252638)
FT                   /locus_tag="Bcen2424_3422"
FT   CDS_pept        complement(251628..252638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3422"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bcn:Bcen_4745
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10161"
FT                   /protein_id="ABK10161.1"
FT                   /translation="MSQSTCSARDIVVVGFEGVQSLDITGPMEVFAVANRHLPAHAAPY
FT                   RLTLASQHGDDIVTHAGLRLAGAAALAALPARIDTIIVAGGDEAALRHAASEAGVLPWL
FT                   RTRIADTRRIASICTGAFVLAAGGWLDGKRATTHWNQCATLQALCPDARIEPDALYVSD
FT                   PPFHTSAGVTAGIDLCLALVEADCGAPTALAVARELVLFMHRPGGQAQFSVGLDIQARA
FT                   TPRMRSLLADIADDPAGDLGVAALAARMHMSERTFARNFFRETGVSPAQYVLAARVERA
FT                   KALLERADWPLERIAERAGFGSVDALQRAFAKRVGASPRDYRARFGPRREKRRRE"
FT   gene            252727..253827
FT                   /locus_tag="Bcen2424_3423"
FT   CDS_pept        252727..253827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3423"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: bcn:Bcen_4743
FT                   ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10162"
FT                   /protein_id="ABK10162.1"
FT                   /translation="MRERKTGSAVLLVCGLLGAWALGGPTRAMAEDAPAAARTLTIAMP
FT                   KAGRTRPLVVIVADNAGTETTDFIVPYAILKRSGAVDVVAVSADEGTVELMPALRMLAD
FT                   TTFDRFDATVPAGADVVIVPALHRADRPAVLAWLRRQAAAGATMVAICDGAEVLANTGL
FT                   LRQRTATSHWYSREGLRRRFTETKWVDDRRYVMDGNVMTTTGVSASIPASLALLGVLAG
FT                   PNAARETARGLGVQAWSDDHDGGRFGLTARAVAIALMNRLAFWRHETFDLPVESGFDEL
FT                   TVALTADAWARTWRSDVVATADASVVESRHGLRLLAQPADVRHARVAMSAGRRGDSALP
FT                   GVLADIAARYDDATSSWVALQLEYPK"
FT   sig_peptide     252727..252819
FT                   /locus_tag="Bcen2424_3423"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 31"
FT   gene            complement(253843..254922)
FT                   /locus_tag="Bcen2424_3424"
FT   CDS_pept        complement(253843..254922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3424"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: bcn:Bcen_4742 alcohol dehydrogenase GroES-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10163"
FT                   /protein_id="ABK10163.1"
FT                   /translation="MKAAILKSLGQPLAIETIPDPVLGTGEVVVDVVATPVLSYAREVF
FT                   SGERRYPIELPMVPGCGAIGRVRQTGPDATQLQPGDWVFCDPTVRSRDDARMPDIVLQG
FT                   WSARGEGGKQLQRYFHDGPFAERLRVPTENAVRIGAIAPADAARWCALNTLLVPYGGLL
FT                   ASDLRAGEILLVSGATGNFGSACIAVALAMGAQCVVAPGRNARVLAELERRFGERVRTV
FT                   GLTGDETADRIRMQQAAPGPIDCVIDLMPPSVPATTVRAAVMAVRPYGRVVLMGGVGML
FT                   GGAGLELPYPWIMRNDITLRGKWMYPTEAVTLMTGLVRGGLLDLGHFDVTVFALDDAND
FT                   AVAHAAEHGGPFRMTVIAP"
FT   gene            255032..255823
FT                   /locus_tag="Bcen2424_3425"
FT   CDS_pept        255032..255823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3425"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   bcn:Bcen_4741 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10164"
FT                   /protein_id="ABK10164.1"
FT                   /translation="MTVTTRTPFGDFLRSRRKKLRPDAVGLHDGPRRRTPGLRREEVAE
FT                   RAGIGVDWYVRLEQGRDVNPSDATLDALARALRLDKAEAAHLRTLARRDGARAFVPEHV
FT                   PPAIARLVAHLQQPAYVTGRRWDILAWNAAAADLLGFDRLAPADRNILVYMFEAPYARA
FT                   LFAASWADEARRMIALFRANHDLYASDPAFVALVARLRTGSGEFAQWWDAHDVRSGVSG
FT                   EKVLVHARRGTQRYEYATFQANDDPALKLAIYTPVNGDEQT"
FT   gene            complement(255920..257398)
FT                   /locus_tag="Bcen2424_3426"
FT   CDS_pept        complement(255920..257398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3426"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; protein of
FT                   unknown function DUF442; KEGG: bcn:Bcen_4740
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10165"
FT                   /protein_id="ABK10165.1"
FT                   /translation="MSDTTPLHYLDYAATTPADPRVIEAMTACLGFDGIFGNPASSSHA
FT                   AGRLAKDKVEHARAQVASLIGADADEIVWTSGATESNNLALKGYAEHATGKRHLITSRL
FT                   EHKAILDTMANLAKHGTQVTFLTPDAHGEITADAVAAAIGPDTGLVSLMLVNNEIGTLT
FT                   DIGAIARIVHAAGALLHVDAAQALGKTPIDVRALGIDMMSMSAHKVYGPKGIGALFVRR
FT                   EIASRIAPQIHGGGHERGLRSGTLATHQIVGMGVACALAAEKLDGEAARIAALGARLTR
FT                   ALFALGDVTQNAAAARRIPHTLSLTVHAPGFFPFMLGDALAVSSTSACNSTSGAPSHVL
FT                   TAIGLDAETAGRTVRISFGRFSTEQDVDFAIGCFARAIEQCRAAAATGFTASRQITPAD
FT                   LKAIRNAGFRAVICNRPDGEGDDQPAFEEIAAAARELGMDARYLPVERDRIGDAEVDAF
FT                   GALVDALPKPVLAYCRSGSRSGLLWNRLSARRTA"
FT   gene            257901..259289
FT                   /locus_tag="Bcen2424_3427"
FT   CDS_pept        257901..259289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3427"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_4739 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10166"
FT                   /protein_id="ABK10166.1"
FT                   /translation="MRRIRTPAGTSSRSSRFASHTKTIGPGPCAGAAAHAGEPASTETD
FT                   MQANEWDTSYEWKAVTLLALGFGLVGLDRWLIAPLFPSIMKDLDLTAQDVGNCIGVLGL
FT                   SWGIFAALMGGISDKIGRRKVLIPAIIAFSLLSGFSGLAGGLLGLMAIRGLMGVAEGSF
FT                   CPTSFAATADASHPRRRGLNLGLQQSGFALFGLALSPIIATQLLGFVSWRWVFALVAVP
FT                   GLILGAIMFFVIREPKVAKEVASEHAPASLGHVLRSRNILVAMAALCCAMTGVFVLGAL
FT                   LPLYLTDYLSLGTQKMGLVVSAIGFGGFLGQFGLPGLSDLVGRRIASIVGFAGTAVMLY
FT                   VFRGLGPQPLALFGVLFVASFFTLGLVSLLSGPVATEAAPVGLVSTSIGVVVGVGEIFG
FT                   GGIAPAMGGYVAAHFGIQNILWLPMGSVLLGIVVSLLLKETAPAVLQRRAAVQPGLAAG
FT                   EQSR"
FT   sig_peptide     257901..258011
FT                   /locus_tag="Bcen2424_3427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.965 at
FT                   residue 37"
FT   gene            259450..260379
FT                   /locus_tag="Bcen2424_3428"
FT   CDS_pept        259450..260379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3428"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2741
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10167"
FT                   /protein_id="ABK10167.1"
FT                   /translation="MDRFLSIEAFVRVAEASSFAEAARQLGVTSSVVTNRIQQLEKFVN
FT                   APLFHRSTRHVRLSEVGETFYRECAEVVGRVNELTDQMRELRATPTGRLRIQMLPGFAL
FT                   DHFGAPLAAFNQRYPGIQLDIIVNDRVVDPVEEGFDIAFQIFPPISESLIERRLFTVRR
FT                   LFCAAPAYVDAHGAPQHPRDLLQHTTALYSGYPSRNRWTMTRGDEVVEMELPGMIRSNS
FT                   VHLLREYALTGGGVVCLPTLVASDALVAGRLVPILTDYQLAPLSFAAVYPATQRQALKV
FT                   RALVEFLAEYIGDESPWDLPLLARGWVR"
FT   gene            260495..260989
FT                   /locus_tag="Bcen2424_3429"
FT   CDS_pept        260495..260989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10168"
FT                   /protein_id="ABK10168.1"
FT                   /translation="MTSTAFHTVFGSLDGYRKGEIEITSGSAQHYAFSNVFEVASKSAP
FT                   YEKVVAGKNLEYVIEVLRTDGQSPWFACAHDEFAIQMDGEVRIDFIKLDDPPQSGRGTV
FT                   RAGAHPAGRNMGYVVLRKGHQALLPAGCAYRFTASRPGVALVQTVLGELSVEKWAEICL
FT                   H"
FT   gene            261027..262046
FT                   /locus_tag="Bcen2424_3430"
FT   CDS_pept        261027..262046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10169"
FT                   /protein_id="ABK10169.1"
FT                   /translation="MATLETLDLSTGFAADLVRSTEADAVTGYRRFQLGEFAFQRDEYF
FT                   VKISWPAKGQTRTHAMPADAFLRAMMRDVAWGFFYGWVNFDHVFGTRNHYGKVDMYAGT
FT                   FNGILKDAGVDYTETFDTPTIMATFKAMLHDWTNEGFDPFAAPEETGTAFGRKHGENGA
FT                   AIERTRIATRRMPGLEGDSPLRDELPVNRAFLDVTQDEPEVHVEPGFDGELHAFNLFKY
FT                   LSRSDVTWNPSVTSVCGRSLFCPTTEEFILPVFHGNDRVEWFLQLSDEIVWDIGDKNTG
FT                   APRARITMRAGDICAMPADIRHQGYSTKRSMLLVWENATPDLPQRYESGELAPYPIAF"
FT   gene            262103..263569
FT                   /locus_tag="Bcen2424_3431"
FT   CDS_pept        262103..263569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3431"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.99.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B2738 betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10170"
FT                   /protein_id="ABK10170.1"
FT                   /translation="MQTQLFIDGRFVDAVDRGTIDVLNPHDGSVITKIAAATAADVDLA
FT                   VEAAARAFPTWSAMPAAERGRLLLRLADAIEANADALAQLESLDTGHPIRDSRALDVPR
FT                   TAACFRYFGGMADKLQGSVIPVETGFLNYVQRAPIGVVGQIVPWNFPLMFTSWKMGPAL
FT                   AAGNTVVLKPSEITPLSTLRIVELMAEVGFPAGVVNIVPGYGHTAGQRLAEHPGVGKIA
FT                   FTGSTATGRRIVEASQGNLKRVQLELGGKGANIVFDDANLDAAINGAAWAIFHNQGQAC
FT                   IAGSRLVLHERIADAFLERFVALASSIRIGNPLDPDTEMGPLTSKQHLDRVLSYVDVAR
FT                   EQGGRVLTGGSAPQDPALANGYYVRPTIIEAKRATDRVAQEEVFGPFVTVLRFGSDDEA
FT                   LAIANATEYGLGSGLWTNDLSRAHRMAARIDAGMCWINCYKRVNPGSPFGGVGKSGYGR
FT                   EMGFEAMHDYTEARSVWVNVDGNVPPHFKR"
FT   gene            263577..264644
FT                   /locus_tag="Bcen2424_3432"
FT   CDS_pept        263577..264644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3432"
FT                   /product="maleylacetate reductase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bur:Bcep18194_B2737 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10171"
FT                   /protein_id="ABK10171.1"
FT                   /translation="MERFVYQGTPSRVVFEWGALARLPDELSALGARRALILSTPEQQP
FT                   LADRVKDVLGERAAGVCAQAVMHVPVEVARAACETAAELGADCCIAVGGGSTIGLGKAI
FT                   ALQSSLPILAVPTTYAGSEMTPIYGLTEDRLKRTGRDARVLPRTVIYDPSLTVSLPPAI
FT                   SAASGVNAMAHAVEALYAEDANPVISLMAEESIRALGEALPVVVRDPQDRAMRSRALYG
FT                   AWLAGTCLGAVGMALHHKLCHTLGGTFNLPHAQTHAAMLPHTAHYNHAAAPDALRRVAR
FT                   ALGGRDAAEAGPLLFRLNAQLGIAPALADIGMPQQGLDEAADLACRNPYANPRPIERAA
FT                   IRALLQHAWEGRAPH"
FT   gene            264753..265064
FT                   /locus_tag="Bcen2424_3433"
FT   CDS_pept        264753..265064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3433"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: bur:Bcep18194_B2736
FT                   conserved hypothetical protein, YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10172"
FT                   /protein_id="ABK10172.1"
FT                   /translation="MARFFAVFATDQPGMRDVRDRMRPIHRSYLRSAAEHGVYVRLGGP
FT                   TLDPQGDAMNGTLLVIEADDIHAVMRFVGNDPYVKEGLFSHVEVRPWDWSLGNPEQRV"
FT   gene            265068..265403
FT                   /locus_tag="Bcen2424_3434"
FT   CDS_pept        265068..265403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3434"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bur:Bcep18194_B2735 Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10173"
FT                   /protein_id="ABK10173.1"
FT                   /translation="MEAKQLCRVADVPDGGARVVDAACIGQPIIVVRRGAQVWAYVNRC
FT                   PHFSVPLDFVPGTVSCYRSQVLMCAHHSALFRFDDGVCIDGPCTGAGLETVAVEVDASA
FT                   WIVFRGA"
FT   gene            265596..266684
FT                   /locus_tag="Bcen2424_3435"
FT   CDS_pept        265596..266684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3435"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B2734 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10174"
FT                   /protein_id="ABK10174.1"
FT                   /translation="MKLRLGVLAMLAVAQGAWAQSSVTMFGLIDSGITYVSNEGGGKNV
FT                   KFDDGIFAPNLFGLRGTEDLGGGYRATFALVNQFSMANGSIVGTGIFGRNAYVGIESDR
FT                   FGSITLGNQYDFMVDALFSRGNAISRDISGLYGFRNGPFQRLALPGNPTGAFDWDRTAG
FT                   SKPIANSVKYSSPTVAGFSGGVMYAFGGVAGSVGADNAVSAGVNYELGAFGVGAAYTNE
FT                   KYGPAPGVPSTSVRNWGVGMHYDFGVVTAKALMTTVRNSFNDAGVWMAEAGGLWRIRPD
FT                   IVLGAKYMYMKGNEAVNDNHAHQISVALQYLLSKRTMVYVSADCQRANGGANAQVNGVL
FT                   DPNGASSSATQAVARMGLHTVF"
FT   sig_peptide     265596..265655
FT                   /locus_tag="Bcen2424_3435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(266825..267076)
FT                   /locus_tag="Bcen2424_3436"
FT   CDS_pept        complement(266825..267076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10175"
FT                   /protein_id="ABK10175.1"
FT                   /translation="MSKLGIAEGIKLRGNVNRITEIMKQGTLEDAVACFALGGMTLQAS
FT                   GGDVPLLRNLSELTRTALPKRVVKDYFGASNGVVMSLA"
FT   gene            267173..267976
FT                   /locus_tag="Bcen2424_3437"
FT   CDS_pept        267173..267976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10176"
FT                   /protein_id="ABK10176.1"
FT                   /translation="MVDKLKARTEPLFARIPVSLKRNLVASAKARGASVGQELARLLEE
FT                   RFDSGLSASLQRRVDEFGQAQRAERAVWLEKYQIFLEAHLLECVTAAQKGDISALVKLG
FT                   NDVRAARRNRQRGLAGLNSRIEARKRESLQEQAAKDEVARVRQNFAFDTGGPIEDFQLP
FT                   PEERRRRNLIAQLEKMPVGTKKDLALRLGWRSMSRVSHILTPKGKKGHRPISAALAKEI
FT                   AEILEIDVEVLNKIERDRDLAEITHHVSKLEKLVDDIAKVGPRSK"
FT   gene            268225..269040
FT                   /locus_tag="Bcen2424_3438"
FT   CDS_pept        268225..269040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3438"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   bur:Bcep18194_B2733 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10177"
FT                   /protein_id="ABK10177.1"
FT                   /translation="MKIASRRARPLWLIAASFALSSASAWADEGASPPDPDNTGLTILN
FT                   NATNVTHWGLGAGVGIEPSAYRGDGTRVLPFPLVYFDNKWVQAIGTTVDLKIGSWSGVN
FT                   LAFRGQFSLFDGYKGSDAPILNGMENRKGAFWYGPALSWSTGFGTLSGSFLLGGNKGER
FT                   AKIGFEKAFAVGAFSIAPHVGVEWLSNKYVDYYYGVRPSEARAWRAAYSAGSAVNVSAG
FT                   TRVDYRLTKQQTMFVDVGVSRLGDGITDSPLVGRRFIPEARIGYMYRFK"
FT   sig_peptide     268225..268308
FT                   /locus_tag="Bcen2424_3438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            269049..269723
FT                   /locus_tag="Bcen2424_3439"
FT   CDS_pept        269049..269723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3439"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bur:Bcep18194_B2732 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10178"
FT                   /protein_id="ABK10178.1"
FT                   /translation="MPRVAIVEDHERLAGLLSQALAAAGIESDRFGNAREAAYGVDRAD
FT                   YALLIIDRGLPDGDGLAFLRTLRAAGRMMPCLMLTARDALHDRIDGLESGADDYVTKPF
FT                   EMSELVARVRTLMRRPALLTTLVASFADVTVDPPQRAMRCGDRTVLLAPAELQIMLCLI
FT                   EAAGRTVRHSNLEHAAWGLAEAVTPNALEVTVHRLRKKLTAIGATMRLTNIRGAGFALR
FT                   DA"
FT   gene            269775..271160
FT                   /locus_tag="Bcen2424_3440"
FT   CDS_pept        269775..271160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3440"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: bur:Bcep18194_B2731 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10179"
FT                   /protein_id="ABK10179.1"
FT                   /translation="MFRHWVLRLSTRLWVTNVAAFAISLALLSALSVYFLDRYPEFLGR
FT                   RQQMESIRHIVAGMRFDAAGRPASVRLGEHPAVMFRLLPADVKYRVLDATGKVLLASVP
FT                   SSDDRPWLTEDLATVAGKVLPTTIDGKAYAVATQRALNGSVVYYVQVAHSDQLVDALVR
FT                   TRIDPIPKTVVYVLVIATVIFGLTLPLTISHVLKPLREVSRAAREIEPRNLKTRLSSAG
FT                   IPSEIKPLIDAFNDALTRLENGFAVQQQFLADAAHELQTPLTLVRGQIELQPDISQKAL
FT                   LLREIDLMARQVKQLLHLAEVSEAQNFSFGDVNGADVARDVVSLLAGKADAKQVTLHIE
FT                   ARDSASPIRADGGALFILLKNLLENAINASPSGGVVVLTVLDTAIHVEDEGPGIRREHL
FT                   PLVFDRYWRAPDSRYDGAGLGLAICKEIAEAHQWKLTVDVLATGTRFSVWFSSDMTGFR
FT                   PSY"
FT   sig_peptide     269775..269873
FT                   /locus_tag="Bcen2424_3440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.444 at
FT                   residue 33"
FT   gene            271168..271764
FT                   /locus_tag="Bcen2424_3441"
FT   CDS_pept        271168..271764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10180"
FT                   /protein_id="ABK10180.1"
FT                   /translation="MEVGRAGAPVPPKCCFSQTPCSPSIFRYNESTFGMSNVRNQASRV
FT                   GFPDANLPSRARWTPSRRCGRLTATKREQHGWHRFDNHSSGATMSQVSSASHQTVCEDW
FT                   SHFLPGFTLTHTVHLVSRRNPGIVSTAAAVLEGETATVDRWAITRCGDVLEQKIVLGEM
FT                   TEGQAVRLRERLAAVEGVLRTRVEHHFVRGRSAAA"
FT   gene            complement(272147..272947)
FT                   /locus_tag="Bcen2424_3442"
FT   CDS_pept        complement(272147..272947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3442"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: mca:MCA2689
FT                   prophage LambdaMc01, ISMca4, transposase, OrfAB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10181"
FT                   /protein_id="ABK10181.1"
FT                   /translation="MAKHAVSSRGVSIRLACEAFGISQTCYRYANVRDAENDEIANWLL
FT                   RLTDNHRNWGFGLCFLYLRNVKGFGWNHKRVYRIYRELELNLRIKPRKRLVRQVPEPLA
FT                   VPSAVNQVWSMDFMHDQLADGRSIRLFNVIDDFNREALGIEIDFSLPSERVIRALRQII
FT                   RWRGRPKAIRCDNGPEYLSAAITEWARQYDIKLDYIQPGKPQQNAYVERFNRTVRYEWL
FT                   SQYHWEDLDHVQRFATDWMWTYNHDRPNMALGGFTPKQRLAMAA"
FT   gene            complement(272968..273234)
FT                   /locus_tag="Bcen2424_3443"
FT   CDS_pept        complement(272968..273234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3443"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bte:BTH_II0356 IS407A, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10182"
FT                   /protein_id="ABK10182.1"
FT                   /translation="MKKSRFTDSQIMDALKRVEAGLAVPDLCRELGISTATFYKWRSKY
FT                   GGMDVSLIARMKELEAENARLRKMYVEEKIKAEIVAEALAKKD"
FT   gene            273312..273596
FT                   /locus_tag="Bcen2424_3444"
FT   CDS_pept        273312..273596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecs:ECs5245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10183"
FT                   /protein_id="ABK10183.1"
FT                   /translation="MLEQLVLKHENIKIKMYQEKQHARAHFHVDYGKNNHVATYAIDTG
FT                   ERIEGTLDRKYDKSVSAWAAANRENLMAVWRALQSGTPESPFIQSLSAM"
FT   gene            complement(273807..275636)
FT                   /locus_tag="Bcen2424_3445"
FT   CDS_pept        complement(273807..275636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3445"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS); KEGG:
FT                   bur:Bcep18194_B2724 glucosamine-fructose-6-phosphate
FT                   aminotransferase, isomerising"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10184"
FT                   /protein_id="ABK10184.1"
FT                   /translation="MCGIVGAVAQRDILPNLVDGLKRLEYRGYDSCGVVVYRDRALARA
FT                   RSVDRVANLQREIADQALSGYTGIAHTRWATHGAPVTLNAHPHFSPSDANARIALSHNG
FT                   IIENCDQLRAELQTHGYVFASQTDSEAIAHLIDHLYDGDLFEAVRRAVARLRGSYAIAV
FT                   MCRDEPHRIVGARDGMPLVVGVGEGENFLASDAIALSGITDRIAYLENGDVADIQLHRY
FT                   WIVDAAGQRVERAVQRVAAHSGAADLGSYRYYMQKEIFEQPQAVADTLLDVSSIMPELF
FT                   GDGAWRVFNDVDSVLLLACGGSYHAALTAKYWIESIAKLPASVEIASEFRYRDSVPNPR
FT                   TLVVAVSQSGETADVLGAVHVAKRSGMMHTLAICNVATSALMRECALQFVTRAGVEIGV
FT                   ASTKAFTTQLVALFLLTLSLAQVRGRLSDDEEKEHLRALRHLPDAMSKVLALEPQIMAW
FT                   SELLARRDNMLFLGRGMHYPIALEGALKMKEISYIHAEAYPAGELKHGPLALVSNEMPV
FT                   IAVAPNDMLLEKLRSNMHEVSARNGRLFVFADVDCGIVPSEGIEVIRLNEYYGPLSPIL
FT                   HTVPMQLLAYHAALARGTDIDKPRNLAKSVTVE"
FT   gene            275793..276284
FT                   /locus_tag="Bcen2424_3446"
FT   CDS_pept        275793..276284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3446"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bur:Bcep18194_B2723 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10185"
FT                   /protein_id="ABK10185.1"
FT                   /translation="MAGITLDELDLRILAILQDDASVSNLQLAERALSSPPTCMRRVRR
FT                   LTEAGVIRRQVAVLDPVAIGTAVTALIEISLDRQTAEDYDAFEAYVCAEPAVTQCYRVS
FT                   PGPDFVVIADLADVAEYDEFARRLFTGASNVRNVRTFFSTHRAKFEANARVAHAMRKRT
FT                   "
FT   gene            complement(276314..277168)
FT                   /locus_tag="Bcen2424_3447"
FT   CDS_pept        complement(276314..277168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3447"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: bur:Bcep18194_B2722 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10186"
FT                   /db_xref="GOA:A0AXR0"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AXR0"
FT                   /protein_id="ABK10186.1"
FT                   /translation="MSAHTRITRKTVTAIRSTKGIGSLVSLTAYSAPMAKLVDEVADVI
FT                   IVGDSVGMVLYGMPDTLRVTLDMMIAHGAAVVRGAAQACVVVDLPFSTFQESPAQAYRS
FT                   AARLLAETGAQAVKLEGGCEMTDTIRFLTDRGIPVMAHVGLMPQQANAAGGFRAQGMDP
FT                   RSAAQVFDAACAAERAGAFSVVIEGTAEALARHLTETLTIPTIGIGASPACDGQVLVTE
FT                   DMIGAFDAYTPRFVKRYADANAVMRDAIRQYAHDVRQRVFPEPAHCFGYGKPLQLADAA
FT                   TAA"
FT   sig_peptide     complement(277061..277168)
FT                   /locus_tag="Bcen2424_3447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.618 at
FT                   residue 36"
FT   gene            277247..278065
FT                   /locus_tag="Bcen2424_3448"
FT   CDS_pept        277247..278065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3448"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bur:Bcep18194_B2721 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10187"
FT                   /protein_id="ABK10187.1"
FT                   /translation="MLLAGQPGDPYAVPPMTRLPRPLYVRAFGIPGNVSVDAHSHPWAQ
FT                   LMYATSGVLEVSTPSGRQLLPPHYAMWIPPHVPHAVSTRDCVAFHSLYLDAALARGDVN
FT                   DDCTILCMTPLLRELVIATGELPVNYDEAGPDGALVCLIADRIARMQPAPLTVPLPRDP
FT                   RLLKIARALHAAPGDTRSLDEWGHQVGATRRTLSRLFRQDTGLSFTEWRQGVRLLASLP
FT                   LLDAGEPIGTVAAQLGYDSTSSFIALFQAKFRMTPGAYAKREARRPVLPA"
FT   gene            complement(278079..278612)
FT                   /locus_tag="Bcen2424_3449"
FT   CDS_pept        complement(278079..278612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3449"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: bur:Bcep18194_B2720
FT                   methylated-DNA--(protein)-cysteine S-methyltransferase;
FT                   TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10188"
FT                   /protein_id="ABK10188.1"
FT                   /translation="MTPAHLIPSPLGDIAVRIEDDALTGLYFVGQKYFPSLAILNDAHT
FT                   LATSPIARRVAEEIAEYFTGARDTFSVPIHLRGTAFQRRVWQELLAIPFGELVSYGDIT
FT                   ERVGLPMSGARAVGGAVGRNPVSIIVPCHRVVGASGSLTGYAGGIERKRALLSLEGAEL
FT                   SRGAHHPMQQALAF"
FT   gene            complement(278609..280087)
FT                   /locus_tag="Bcen2424_3450"
FT   CDS_pept        complement(278609..280087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3450"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; Ada, metal-binding domain protein; AlkA domain
FT                   protein; KEGG: bur:Bcep18194_B2719 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10189"
FT                   /protein_id="ABK10189.1"
FT                   /translation="MVYSRPMRLDPDTCYDALLSRNRRFDGWFFVGVATTGVYCRPVCP
FT                   VKPPKAQNCTYYPTAAAAEKAGFRPCMRCRPELAPGHGLLDLSGNLADAAATLIDDGFL
FT                   NAHSVAALARRVGVTERHLRRIFGAQFGVSPVEFAQTQRLLMAKRLLTDTALPVAVVAS
FT                   TAGFGSVRRFNDLFRQRYGLNPLRLRKGAGASADGDMTFPLPYRPPFAWADLMRFLAQR
FT                   QIDGVERIDAKGYARIVELPNRHDGGRVAGWLSVTHVPQRFALAVTVSPALTPAVPAVL
FT                   ARVRRLFDLDSRPDVIDAHLGDLASGSPGLRVPGAFDGLEIAIRAIAGEQLAAAQADTP
FT                   LLARIAERFGHSVDGAPPGLTHALPCAATLAALPPSALETIGIERDMAHAIVSLARAVD
FT                   DGTLALEPMAPLDATLAALRALPGFDERAVQYVAMRAMAWPNAFPADDALLPARPERTD
FT                   RTRVPSSAPHAARWAPWRAYAALHVWRLHGDGLR"
FT   gene            280410..281702
FT                   /locus_tag="Bcen2424_3451"
FT   CDS_pept        280410..281702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3451"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B2718
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10190"
FT                   /protein_id="ABK10190.1"
FT                   /translation="MQSAVVGAVRAAASRYRWTVCALLFFATVINYMDRQILGLLAPML
FT                   QHDIGWSQVQYGRIVMAFSAFYALGLLGFGRIVDWLGTRVSYAVAMLVWSIAAMLHAAV
FT                   GSVTGFAFVRALLGIGEGGNFPAAIKTTAEWFPRRERALATGIFNSGANIGAVFAPAII
FT                   PAIAVAYGWRAAFVIIGAIGIVWLAVWLVMYRTADTRALAAEYDEPRDEAEALDAANAN
FT                   AGAPRWGELIRKRETWAFLIGKFLTDPVWWFYLFWLPKWLNESRGMDMQHIGLPLVCIY
FT                   ALTTVGSIGGGWLSSMLLRAGWSVNRARKTAMLICACCVLPIAFVSQVQSLWIAVLIVG
FT                   LAAAAHQGWSANLFTTASDLFPRRAVASVVGIGGMAGSIGGVLFSEVIGQVLQRTGHYW
FT                   VLFAIGASAYLIALAVMHVLTPKMKPAKLDA"
FT   gene            complement(281779..282888)
FT                   /locus_tag="Bcen2424_3452"
FT   CDS_pept        complement(281779..282888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3452"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bur:Bcep18194_B2717 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10191"
FT                   /protein_id="ABK10191.1"
FT                   /translation="MVESARSHPHFPDIDGWLRAVFFCHNPALSNENVTLPMKKVSSTI
FT                   RDVAAEAGVSVATVSKYVNGTQRFSPTVEARLKEAIERLGYRSNPLARSMITGRTRTIG
FT                   LVILDISNPHFTNVVKGANRVALQHDYTLLLVDTEESQARERSLIEALAQRVDGLIVST
FT                   RMPDEEAGWMLDLNKPLVLLRRSPGLPIPSVGIDNRLSTYMLARHLLNLGHTRIAYLGF
FT                   GTARVNDERIQGARDCLAEAGLTLDVHDAHAPTAEAGERACSRVMLGPQRPQAVICYND
FT                   LIALGFMKEAASLGFRLPQDVSVAGIDNVPYGAYAAPALTTVDIQSENMGELAMQKLID
FT                   ALAGRTDASYSTFEPRLIMRASTASAAAG"
FT   gene            282959..283795
FT                   /locus_tag="Bcen2424_3453"
FT   CDS_pept        282959..283795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3453"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: bur:Bcep18194_B2716 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10192"
FT                   /protein_id="ABK10192.1"
FT                   /translation="MNASSTAARKPFGRLLLTGAAGNLGRQLRGALADWADVVRVSDIA
FT                   ALGDAAAHEELRVVDLADRPAVMQLVDGVDAIVHLGGISVDAPFDDLVGANITGTYNLY
FT                   EAARKHGVKRVVFASSNHAIGFHPVTEVLDADAPLRPDSLYGVTKCFGESLSRYYFDRF
FT                   GIETVCLRIGSSFEVPKNPRMLVTFLSYRDFIELVRCSLLTNRVGHAIVYGASDNPVKW
FT                   WDNTKVGFLGFRPRDSSEQFAGLFPVTAPTAEYDDPAQRFQGGGFVVGEPMERNVK"
FT   gene            complement(283825..284145)
FT                   /locus_tag="Bcen2424_3454"
FT   CDS_pept        complement(283825..284145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3454"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   bur:Bcep18194_B2715 protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10193"
FT                   /protein_id="ABK10193.1"
FT                   /translation="MTAYAIAHLHDVEMCDDIVEYLERIDGTLAPYDGHFVIHGARPEV
FT                   REGVWRGDLIAIAFPDLDMARAWYDSDAYRQIQPLRERHASGPLILIDGVDERHKATDI
FT                   LR"
FT   gene            complement(284336..284794)
FT                   /locus_tag="Bcen2424_3455"
FT   CDS_pept        complement(284336..284794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3455"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG:
FT                   bur:Bcep18194_B2710 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10194"
FT                   /protein_id="ABK10194.1"
FT                   /translation="MKIGELAKASGLAASRIRFYEASGLLEPARRQANGYREYGPEALT
FT                   RLAIIDRAQCAGFSLDEIRAVLPPDLGAWPHDELLVALRHKVDEIALLERRLAQNRQHL
FT                   ETLIDEIENKPAGEDCAGAAQRMLDRLCEQAAEPLEATPVVRPARKRA"
FT   gene            284874..286118
FT                   /locus_tag="Bcen2424_3456"
FT   CDS_pept        284874..286118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3456"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bur:Bcep18194_B2709 NADH-flavin oxidoreductase/NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10195"
FT                   /protein_id="ABK10195.1"
FT                   /translation="MNLFAPLTLPNGAVIPNRLAKAAMEENMADADHAPSDALLRLYQA
FT                   WADGQAGLILTGNVMVDGRAMTGPNGVVLENDAHLDRFRRWAQIARSNGAHVWMQINHP
FT                   GRQMQAALGQTTLAPSAVPLALGALSKQFPVPKEMTAADIADVQQRFVRAAQLAEQSGF
FT                   TGVQVHAAHGYLLSQFLSPLTNRRQDQWGGSIENRARLLLDIVKAVRAAVSPAFVVAVK
FT                   LNSADFQRGGFSADDAKRVVELLNPLGVDLVELSGGSYEVPAMQGEARDGRTLAREAYF
FT                   LEFARDITAVARMPLMVTGGIRRRAVAEQVVNSGVAMVGIATALSIDPNLPRDWRAGKD
FT                   SAPVLQPIRWKNKALGALANMAVVKFQLTRLSEGRRTHPQVSPLRALVRQQLAAQCQTR
FT                   RYRKWMAGRAAGTRA"
FT   gene            complement(286207..288330)
FT                   /locus_tag="Bcen2424_3457"
FT   CDS_pept        complement(286207..288330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3457"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: bur:Bcep18194_B2705 TonB-dependent siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10196"
FT                   /protein_id="ABK10196.1"
FT                   /translation="MKFRLMLPAAVLAALSPAGQAQTQERSVDGAGAMLAPIRVDAQKA
FT                   PALTQPLDTGSHLGLSPLETPASVEQINRATLDTRGDSSIIDAVSRAAGISASPHPGNG
FT                   NSELAARGFVGASSVTQLYDGVRPYGAIGVTFPFDTWSVDHIDVLRGPASVIYGEGAIG
FT                   GVVNIVPKKPTRTPIRNELQVGGGTEGTARAAFGSGGAINDKLSYRFDISGNRSSNWVD
FT                   RGDSRNLSVSGALRYDVTPDLYVTASYAQGFMHPMQYFGVPLVNGARDRALDKKNYNVG
FT                   DADIAFRDSWATVSANWQPSDSLNVTSTLYRMKSNRHWKDAEYYTYLPSSAQVRRSSYT
FT                   EIFHDQEQYGNVTTATVGGALLGMRNTFSAGVEFNHTTFQHDNNSPYAGTSTVDPFNFD
FT                   PGSFINTAGTFPKYRSQSNQYALFAENRLEITPRWSVIGGLRYDHASVNRDDLVNGGAF
FT                   TKVFANTGWRIGTVYDVRPGLAVYGQYSVAADPVSSLLSLNASKANFTLATGRQIEIGV
FT                   KQSFLDGKAEWTLAAYRIVKSNLLTADPVNPNQSIQVGQQSSRGLEATVGAEIAKDWRV
FT                   DANVSILRAKYDDFQQSSGGTTVSRAGNVPVSVPQRLANLWVSWRFAPDWTGIAGVKYV
FT                   GKRFADTANQLVMPSYTTVDLGLAWKPRKDTTITARAYNVFNRRYVQSAYYNETQYLLG
FT                   NDRRVEVLANYRF"
FT   sig_peptide     complement(288265..288330)
FT                   /locus_tag="Bcen2424_3457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.795 at
FT                   residue 22"
FT   gene            complement(288371..289846)
FT                   /locus_tag="Bcen2424_3458"
FT   CDS_pept        complement(288371..289846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3458"
FT                   /product="Propeptide, PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide, PepSY amd peptidase M4;
FT                   PepSY-associated TM helix domain protein; KEGG:
FT                   bur:Bcep18194_B2702 propeptide, PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10197"
FT                   /protein_id="ABK10197.1"
FT                   /translation="MSTTVDRAISPARSASAGYRTLWRWHFYAGLFVMPFLVILAITGT
FT                   LYCFQPQIEPLLYPHRLVVEPRATPRLDADTLLARARTAMPADATAVSVQVSTAPDRSA
FT                   EYVFRLRDGSRESVYVNPYDGSVLGTLSVENRFMQVDRMLHRKLLLGKTGELLMELAAC
FT                   WTFVMIGTGIALWWPRGAARVGRALRPDLSLRGRPLWKSLHATAGIWLAAGTIAFILTG
FT                   LPWSGSWGKNFKALAATVNLGAPEGAWGGASMRSTRPGAAATAAHAPAQATAPSGHHHD
FT                   SDESMPGMVMDDLPLPQTPWAVGNVPVPHSPAAPTPTPAPLPLARAIAIVAGLGVTSGY
FT                   TLALPSGPDGVFTASYFPADPKAERTIYVDQYSGAVLKDIRYGDYGAVSKAVSYGTSLH
FT                   MGRYFGLANQIICAVLSLGLAAMAVTGTVMWWKRRPAGTLGAPSRERGTPPMRGWLAGL
FT                   VLLGLVFPLMGLTIVAVWLLDRLLFGRAARAAA"
FT   gene            complement(290088..290573)
FT                   /locus_tag="Bcen2424_3459"
FT   CDS_pept        complement(290088..290573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10198"
FT                   /protein_id="ABK10198.1"
FT                   /translation="MNALRRFLLRPGVARQWLWGFLLVTLLSRALMSGAVMLDPDGPDA
FT                   GSVVLCSGQGPLIVTAAALAARFDASAPITPANDALALVDALKHDAHADKAASSGNGDS
FT                   LCAFGAALFTAIASFVLLVLLFPAAPPRRFRVHFDSLPFVRSVFDDRPPSRAPPRFC"
FT   sig_peptide     complement(290457..290573)
FT                   /locus_tag="Bcen2424_3459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.657 at
FT                   residue 39"
FT   gene            complement(290939..291262)
FT                   /locus_tag="Bcen2424_3460"
FT   CDS_pept        complement(290939..291262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10199"
FT                   /protein_id="ABK10199.1"
FT                   /translation="MDAQPNSSDTSFQLFLAKVLEQPLPDWTEKQQMELEMARTLSTQM
FT                   VTLAEDMRGRTPDLARCLVLLRYAKVLDFMLTSLAAHRDIHPQTLRTLFRLANLKVDDA
FT                   YPV"
FT   gene            291852..292484
FT                   /locus_tag="Bcen2424_3461"
FT   CDS_pept        291852..292484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3461"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B2697 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10200"
FT                   /protein_id="ABK10200.1"
FT                   /translation="MNVHTFFSANLLLAYTAYFIGTASPGPSNLAIMSVAANQGRKAAL
FT                   AFALGVISGSMCWATVAALGISAALLAWSKLLVAIKVFGGLYLLWLAFKSGRTALAGPP
FT                   AAAANAAREQRLSRFYVRGAMLHLTNPKAILVWVSIVALSSNGAGGAHGAVVPGCLAIG
FT                   CLVFGGYALVFSMDGARRLYVRGRRAMEACLAVVFGVAGVRLLVTNV"
FT   gene            complement(292559..294187)
FT                   /locus_tag="Bcen2424_3462"
FT   CDS_pept        complement(292559..294187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3462"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B2693 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10201"
FT                   /protein_id="ABK10201.1"
FT                   /translation="MPDSASLQHLFPALQEIPAEFRLASPIHQRVSLVDGELRPWDGAT
FT                   KTVLSPVCVRQADGSVEQVEIGSYPVMGETESDAALDAAVRAYDAGRGEWPTMKVEQRI
FT                   ACMQDFIKRMVAQRELVVNLIMWEIGKSLADSQKEFDRTVTYMTQTIDALKELDNANSR
FT                   FVIAEGTIGQIRRTPLGVVLCMGPYNYPLNETFATLIPALLMGNTVVFKPPQYGTLLFE
FT                   PLLEAFRDAFPKGVINTIYAPGAVVVPHMLASGKINVLALIGSSKVADHLKKQHPKSHR
FT                   LRAILGLDAKNAAIVLPDADLDLTVKECLLGALSFNGQRCTALKMLLVHRSIVDEFLKR
FT                   FTAALEQLKIGMPWEKGVSITPLPGMHRTAYMTDAIDDAKAKGAQVVNHQGGEFSKTLF
FT                   YPAVVYPVSEGMKLYREEQFGPIIPVAPFDDVETALDYVTTSEHGQQVSIFGSDPAQIG
FT                   ALVDPLVNQVCRVNINCQCQRGPDVFPFAGRKDSAEGTLSVSDALRAFSIRSMVAAKQT
FT                   DSSKQLLDSIVSDHHSKFINTGFIF"
FT   gene            294790..295827
FT                   /locus_tag="Bcen2424_3463"
FT   CDS_pept        294790..295827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3463"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: bur:Bcep18194_B2692 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10202"
FT                   /protein_id="ABK10202.1"
FT                   /translation="MRSRTKKAATVLARGVACLCAGMALSSASYALEGKEWKLMVAMGD
FT                   YAADKTPRNLARVSALLKQGARPYDKTAKQRYAMPDAELTPMGLAVVSQVPDVVALFIA
FT                   SGVAINMPMSPKGWTLLTYAISNATLGELKPDQLETIRLLIGAGANVNAIAPSGEPPLA
FT                   MAANAYTPSPELVRMLLKSGADARATDPNGYTVLTGRAASDLDILKLLVDAGADPYAHA
FT                   KTGQTPLSFVCERRYELDGQPDPTAAERIAILHEPGTPIEPRLGEQRVRWGETPLLRAA
FT                   IVHNPDCVKALLDAGADPDAPALIGAGKDDATGSVREAVARGAKATPDVYDRRAVALIE
FT                   AAPRK"
FT   sig_peptide     294790..294885
FT                   /locus_tag="Bcen2424_3463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 32"
FT   gene            295968..296333
FT                   /locus_tag="Bcen2424_3464"
FT   CDS_pept        295968..296333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10203"
FT                   /protein_id="ABK10203.1"
FT                   /translation="MKRIALAALALTIVSGAMAAKGELKVSAAQMIEAYTGSGGDKYFD
FT                   QPVALTGTLLGLEKGFTGKTLAEIGEDVDADQAVRASFVDAAAEQKAQRLVGKRVTLHC
FT                   VGDFASGIATVRDCRLK"
FT   sig_peptide     295968..296027
FT                   /locus_tag="Bcen2424_3464"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 20"
FT   gene            296774..299047
FT                   /locus_tag="Bcen2424_3465"
FT   CDS_pept        296774..299047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3465"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: rso:RS02469 probable ferrisiderophore receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10204"
FT                   /protein_id="ABK10204.1"
FT                   /translation="MPAGATRRFSVRRPLCVDTRSPVESPADDLASAARVCAHHFPSAF
FT                   TSTMKFNKSACHVLLIASSLAGTRAACAQAADAAATLPAISVNAAAEHASYDGGHSRAA
FT                   TKTDMSLMDVPQTVNVVPHAVIEDQNATSLQDALRNVPGVGFSVGDGQRDQITIRGFNS
FT                   ITDQYVDGIRDDALYYRDLSNVDRVEVLKGPAAVLYGRGSAGGIVNRVLKRPLANPVND
FT                   VGVTLGTRGERRGEFDLGWNANDAARFRMTGAAENSNSFRDQFQLNRQAIAPSAQFKLD
FT                   RDTVLNVEFDYLHDRRTSDQGIPAYRGRPVDVPINTYYGSADGVNSSYNDVSAKSATVS
FT                   LDHRFNDSLSFHGAIRAYDFSLERKNYVTYEPIKTAAHPVVTLDQSTRQRTDHGIDGLF
FT                   ELTQKTSLFGMRHELLYGLELSQQQKFDTIYSVSKVATYDLFNPQPVVLPGVPTGTRAK
FT                   TNASTVVGLAGVYAQDLISLTEHWKVLAGLRFDYLNQIRHDYTSSNVNLDRTDHAWSPR
FT                   VGLIYEPLDWLTLYGSFSQSFSPLADTLISSGAFTNGAALAPQKTTAYEVGSRFDLGGK
FT                   ATASVALFDMRQTNQQIGDPANPGYALPIGTQHVRGMELGFTGEIAPKWSVYAGYAYLN
FT                   GTVDGSAQSTAAGLAVSSNTPGLMPRHSANLWLKRELPYGFYAAAGMQFQSARYTSASD
FT                   LVTLPSFTVFNLGAGYRSKKVDVTLTLDNLFNRRYFIAAHGNADLYNMPGDPRTLTATV
FT                   KWHM"
FT   gene            complement(299241..300188)
FT                   /locus_tag="Bcen2424_3466"
FT   CDS_pept        complement(299241..300188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3466"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2690
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10205"
FT                   /protein_id="ABK10205.1"
FT                   /translation="MRKFKIPNMGALVAFEAAARHESFTHAAKELFLTESAVSRQIATL
FT                   EASLGVRLFARVKQRVVLTRAGKLYGTQVRRALETLDRDTLSIIAHGSGGGYLELAVLP
FT                   TFASHWLIPRIKSFYDRTPDVRVNMGSRTDLFSFEDTHFEAAIHYGKPTWPGTSSDYLF
FT                   GEEVVPICSPALLNGPVERVEDLLAYPLLHSTTRPGAWAQWFETHGVEDIRTMQGVRYE
FT                   LHTMLISAAAAGLGVALVPKFFVEEQLQQLGLVVPCDAATVGDSAYYLVYPTEFSHSKP
FT                   LESFRGWLLEQASAYAAPERDVQDADEEDDEDVE"
FT   gene            300413..301441
FT                   /locus_tag="Bcen2424_3467"
FT   CDS_pept        300413..301441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10206"
FT                   /protein_id="ABK10206.1"
FT                   /translation="MRNPNIDSLLTKLLGQAKTDALFSTLNMPAILEEWEDGVVTRAEI
FT                   AQAMNMALFEGLLERSANGRAYTAEAIENGGSVYFDHGALRTVRWPHTGALPPGEAAFT
FT                   RILRPLGFRLNGRYPLDKLGMTGRAYAHEDAPDEIAQFFVSELHPERFSKEFQQAVTNV
FT                   VGASRDPLSPAAVARLWEVEREGWLSLEDAHALLPEIVGAFARQHDVPNELDYETLLME
FT                   SAEMAWIATEGNAFNHATDRVADVFKLSDDEKAKGRPMKPEVERSRSGRVFQTAYRADT
FT                   VEREFRTRDGGTVKRNVPGSFYEFITRKRTFDQAARRWVTDLRFDAGNAQGIFKMTANA
FT                   AK"
FT   gene            complement(301680..301877)
FT                   /locus_tag="Bcen2424_3468"
FT   CDS_pept        complement(301680..301877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3468"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: bur:Bcep18194_B2683
FT                   conserved hypothetical protein, CsbD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10207"
FT                   /protein_id="ABK10207.1"
FT                   /translation="MNEDKIKGQWKQLTGKLKAKWGKLTDDDLQVAEGNRDYLAGKIQE
FT                   RYGIARDEAEKQLKEFDREL"
FT   gene            complement(301931..302281)
FT                   /locus_tag="Bcen2424_3469"
FT   CDS_pept        complement(301931..302281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3469"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG:
FT                   bur:Bcep18194_B2682 transport-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10208"
FT                   /protein_id="ABK10208.1"
FT                   /translation="MNKTSHLSTLLAVSAAFLLSAAPLTNAHAQASSTDSGMASESNQP
FT                   VTDTWITTKVKGELATTDGVKSTDISVKTVDGVVTLTGVLPTKVAVKKAVAVTRAIKGV
FT                   KHVDASGLKAKA"
FT   sig_peptide     complement(302192..302281)
FT                   /locus_tag="Bcen2424_3469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.765 at
FT                   residue 30"
FT   gene            complement(302311..302730)
FT                   /locus_tag="Bcen2424_3470"
FT   CDS_pept        complement(302311..302730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10209"
FT                   /protein_id="ABK10209.1"
FT                   /translation="MVRCGQRACRAALPGSWCMSLPTVCSVPQCKRTNRSGEFARCPLA
FT                   FASVRWYCIGAHALPFHTAEGGHTDEIASDTRSDAARTAPGPSARTGARHRPAGTAAAR
FT                   RTAPGHAAARARLRHADRALNARAPHGNAPCSPTD"
FT   gene            302920..304452
FT                   /locus_tag="Bcen2424_3471"
FT   CDS_pept        302920..304452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3471"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: bur:Bcep18194_B2680 transcriptional regulator,
FT                   LuxR family; TIGRFAM: PAS sensor protein; PFAM: regulatory
FT                   protein, LuxR; Sigma-70, region 4 type 2; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10210"
FT                   /protein_id="ABK10210.1"
FT                   /translation="MNEPVDEQALKSHTDRRQLHQIIAGLTEGVILIEPDQRIVWANEA
FT                   ALAMHGVTELKALGADVTEYRERFRLRYRNNHPVRDGHYPMDRVIAGEEFSDVTVEVES
FT                   AADESVSWVHRIRSLVLTNAAGAPDCLALVLHDATEWASAEERFERTFNANPAPAVICR
FT                   LDDLRYVKVNQGFLDMTGHARDDVLGRSVYEIDVLEQAERRELAIERLGEGATIPQMEA
FT                   VLKLADGSTKAVVVAGQPIDMNGEACMLFTFMDLEPRKQAERALMQSEERFATAFRMAP
FT                   VAMAIVTADRFELLDVNDGFAAMTGHAQADLLGKSADEIGLWAERGAWSRIEGRLAGDG
FT                   HVRNVDVQIRTRDGDVRDCVVSADPVAIHGRDCLLVALLDISDRKRTEMELVYAIETAM
FT                   QDASWFSRTLIEKLANVRRANAPDAGAQLSDLTARERDVFDLLCHGLADKEIAGRLGLA
FT                   PNTVRNHVATIYAKLDVHSRGEAIVWARERGIVGAAEANGARGDKGGAKGKD"
FT   gene            complement(304469..305434)
FT                   /locus_tag="Bcen2424_3472"
FT   CDS_pept        complement(304469..305434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3472"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bcn:Bcen_2208
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10211"
FT                   /protein_id="ABK10211.1"
FT                   /translation="MSAPSAVTVGIDVAKAHVDVSVLGANLDIRRFNNDAEGHSALAVA
FT                   LQPLNVQLVVMEATGGYETELACALQGAGLPVAVVNPRQARDFARSMGRLAKTDAIDAH
FT                   MLAELASVLLRRDDLSRLLRPVPDERQQWLAALVTRRRQLLTMLLSERQRLQITPVGLH
FT                   PSLLAIIAAIQAQLDDIDAQMVAHVRQHFGELDRLLQSTHGIGPVSSACLIAELPELGR
FT                   LNRRQIAALVGVAPIACDSGLRNGRRRVQGGRFAIRRVLYMATLTATRYNPAIRAFYQR
FT                   LKAAGKLSKVALVACMRKLLTMLNAMVKTNTPWDDSLHRA"
FT   gene            305775..305966
FT                   /locus_tag="Bcen2424_3473"
FT   CDS_pept        305775..305966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3473"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: bur:Bcep18194_B2679
FT                   conserved hypothetical protein, CsbD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10212"
FT                   /protein_id="ABK10212.1"
FT                   /translation="MDRNRIEGKLKQVRGSVKEALGKVTGDRETEAEGVAEQQAGKLQE
FT                   KAGEAADAVRNQTGTDRH"
FT   gene            306385..307536
FT                   /locus_tag="Bcen2424_3474"
FT   CDS_pept        306385..307536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3474"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bur:Bcep18194_B2678 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10213"
FT                   /protein_id="ABK10213.1"
FT                   /translation="MTFRIRSLSGVALTAALLAFQTGAAHAQETIVKVGVAGPLTGGGA
FT                   AYGKDIENGVRMAVDEANAARTMVGGKPVKFVIASQDDQSDPRTGVQAAQQLADAQVAV
FT                   VIGHFNSGTTLPASKIYAKAGIPMITPSATNPDITRAGLGTVYRVIATDTQNAGNAGAY
FT                   AASVTKAKRIAIIDDRTAFGQGEADEFEKAVKANGGTIVTREFTNDKAVDFSAQLTKIK
FT                   STNADLVFFGGLDAQAAMLVKRMRQLGIRAQFLAGGGVMNANFIKLAGNAAEGASVWEY
FT                   GQPLSRLAKGKLFETKFKQKYGVDMLAYAPFAYDATWIAINAMQKANSTKPADFNGALK
FT                   GTRYDGITGTIAFTNTGDLKNPSSTLYEVKNAAWQPVTTQSAD"
FT   sig_peptide     306385..306468
FT                   /locus_tag="Bcen2424_3474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            307688..308860
FT                   /locus_tag="Bcen2424_3475"
FT   CDS_pept        307688..308860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3475"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B2677 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10214"
FT                   /protein_id="ABK10214.1"
FT                   /translation="MSSQVVIVGGGVIGSSIAYFLRATDPTVAVTVIERDPTYARSSSA
FT                   LSAASIRQQFSTPLSIEMSLFGIEFLRTIGERLEVDGNRPSIDLHEGGYLFLATPAGDA
FT                   TLRENHALQTRLGADIRLMDGDALRAKFPWLNVDDLVSGAYGVSGEGWFDGYGLVQALR
FT                   KKAQALGARYVPADVKDVVRDGRRITHVVTGDGERYACDTLVNAAGAWTRTLSSMMGID
FT                   IPVYARRRSIFNVSSPAKLADCPLLIDPTGVYFRPEGRTYICGTSPSPDRDPDDLPLDE
FT                   VDHGLFDDVIWPTLAHRVPEFEALRVENCWSGYYEYNVFDHNAIIGYHPELDNVVFANG
FT                   YSGHGLQQGPATGRGVSELILGGRYDTLDLSSLGWARVLENRPIVEKNVV"
FT   gene            complement(308955..310169)
FT                   /locus_tag="Bcen2424_3476"
FT   CDS_pept        complement(308955..310169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3476"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bur:Bcep18194_B2676
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10215"
FT                   /protein_id="ABK10215.1"
FT                   /translation="MSTRPFTTETSMTSSPASSQQSSTDPALAERIDTVLSRQLDTQRL
FT                   VGAVVLVARDGELVYRRAAGFADRESRTPMREDTLFRLASVTKPIVSAAAMALVAQRKL
FT                   SLDEDIARWLPDFRPALPDGRVPTITVRQLLVHTAGLDYRFNETDANGPYARAGVSDGL
FT                   DGASITLAENLRRIASVRLLFAPGTSWNYSLSIDVIGALIEAVCGVPLADAIDALVLRP
FT                   LGARDTGFVARDPARLATPYVNDTPQPHRLAENETVPIDEGFVGVTYSPSRALNAHAFP
FT                   SGGAGMVGTAGDVLTVLDTLRAGGGTILPTELVDEMGRVQTGDLELPDLPGAGFGIGFS
FT                   VLRDPQAAASPESVGTWRWGGVYGHSWFVDRARGLTVVSLTNTLYEGMNGQYTLDLRDA
FT                   VYGVG"
FT   gene            310413..311540
FT                   /locus_tag="Bcen2424_3477"
FT   CDS_pept        310413..311540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3477"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG:
FT                   bur:Bcep18194_B2675 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10216"
FT                   /protein_id="ABK10216.1"
FT                   /translation="MPGLLPDVDREGLLEYSVVYTDRSVNHMSQRFQGVMRDISATLKK
FT                   VYNAKSVAIVPGSGTFGMEAVARQFATNEKCLVIRNGWFSFRWSQIFDMGSIPSETTVL
FT                   KARPVEAGRQAAYAPAPIDEVVAAIKENKPDLVFAPHVETASGIMLPDAYLRAVADAVH
FT                   AVGGMFVLDCIASGTVWVDMQASGVDILISAPQKGWSASPCCAMVMLSPLARERIDATT
FT                   STSFACDLRKWLQIMEAYEGGGFAYHATMPTDSLTTLRDVMKETDAYGFDKVKAEQLEL
FT                   GERIRALLTEKGFRSVAAKGFEAPGVVVSYTDDDGIRTGKKFADVGLQIAAGVPLQCDE
FT                   REDFKTFRLGLFGLDKLHDVDGAVKRFADALNRIV"
FT   gene            311568..312206
FT                   /locus_tag="Bcen2424_3478"
FT   CDS_pept        311568..312206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A0383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10217"
FT                   /protein_id="ABK10217.1"
FT                   /translation="MAAAQPLSGGFLVVENATILDRDMTEGALTFASQAEWESWLGQNG
FT                   GTSTGAWLRLAKKGAGQRTVSYEAAVESALCHGWIDGQKKAESEQYWLQRFTPRSAKSI
FT                   WSKINKDKAEALIVAGRMRRAGLREIEKAKQDGRWEAAYTSASNAIVPDDLQAALDANP
FT                   KAAKFFATLNSRNRYAILFRIQNARKPETRARKIAEFIDMLKRGETFHP"
FT   gene            312728..313813
FT                   /locus_tag="Bcen2424_3479"
FT   CDS_pept        312728..313813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10218"
FT                   /protein_id="ABK10218.1"
FT                   /translation="MLFAGAIVLTTAMPAHAGSATDVSPICTTVRTEPTRDSLLSRSSY
FT                   CQKTVPLEYVAKDDQNNEIGRVAIDAYAYSDNPSNQLAWPLKFRFRTRIISGNPGGLMI
FT                   KPIVECGSDCTVAPNAGVPLALGGLSNEISVMVTPNMGSSNPLRFSPTLEYRVAKSGDS
FT                   FDNGASVSPYAGVGYIPDIRCDVALVKSNSQGCVYEDAPAVLRTIVATNPDVDESAIHI
FT                   REAQAAGRPGKFVPKGDGTIFPDTWESRPLTRTRDATLRRDNRDASKKQCVAKYGSVNG
FT                   QCTFTGDPDETPTDCDCDEYPFASTEQGASSDPEVSVKRIDASDNRRAGAFLGNFYLNQ
FT                   RVLDQEKFYVDVGSQQPAAKR"
FT   sig_peptide     312728..312781
FT                   /locus_tag="Bcen2424_3479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.961 at
FT                   residue 18"
FT   gene            313833..315914
FT                   /locus_tag="Bcen2424_3480"
FT   CDS_pept        313833..315914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3480"
FT                   /product="MoeA domain protein, domain I and II"
FT                   /note="PFAM: MoeA domain protein, domain I and II; MoeA
FT                   domain protein, domain IV; KEGG: sth:STH2906 molybdenum
FT                   cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10219"
FT                   /protein_id="ABK10219.1"
FT                   /translation="MPLPRFAGIFGPRHENIHHMSDHENFPFWLNQPYERCRRVVPGAM
FT                   QSETVPIEDALTRVTAADVFAPENVPPVPLAAVEGYALRASDTVHATHGAPVELDFEFS
FT                   RRALASSAGSPAARAIHAQCAVDVPPYFPLPENADTVVPKGGLEVTHRDARSFLLLHAP
FT                   LSAGQHVIASGSEYRQGSLLLPKGSRITAELQIALTAAGVRDIEVTKRPRIGVVIVGYE
FT                   QRAPGIAREQWQRPDTSGPYIRAVLQRWGYRVSSIEYIEPPDMTLPPLEVQQNEYAFQK
FT                   KLAEFAQRYDLIVGAGLPATPPFRDIGLNAQRVYSRDEATVEIRQTPADRFNFGRSDDR
FT                   SPPKKTTLPFTRPDGTQSGMTVLTSYDQATLINLPGHTSAVAMLMHAIMPRVLDLLEHA
FT                   ATPGPHWETGIIDHSVERDAQLNAMRWGNLHRGADGHVVVRLLPPEGDGLISGVVHADV
FT                   LAAIPAAEYPMAAGSSVLFLRLDRDLSSEPPRQTAATSAEGASQSPPAVETRTTTVDID
FT                   DARPIDLRDTWQWLDAAFAADASRLPGGLNGPASDDDIAALQVALGATLPDALVDSLRI
FT                   HDGQAALGEAFSGSDALLSAREILAQWRIWKGLVDAGDFGDMTSEPDAGIADDWYNLKW
FT                   IPFTHDGSGNHLCVDLDPAEGGVAGQVIRVWHDDARRERIARSFPEWLAGIASARQSS"
FT   gene            316011..316517
FT                   /locus_tag="Bcen2424_3481"
FT   CDS_pept        316011..316517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3481"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B2666 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10220"
FT                   /protein_id="ABK10220.1"
FT                   /translation="MVSKNVRRATADDVPVLTQIRNDAHARKVAHGDYVWGRDGDGFSE
FT                   RWVRNHVAEKAVYVVEQDGALVGTFSLDFDEDRHWGPQAPIAGYVHGLCVRQGFNGLGL
FT                   GGFMLDWCAHEVSRLNRRLLRLDCGAENTKLCAYYESLGFVRVGLKTDGIVWSLYEKPV
FT                   SSASR"
FT   gene            complement(316620..317195)
FT                   /locus_tag="Bcen2424_3482"
FT   CDS_pept        complement(316620..317195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3482"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bja:blr7984
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10221"
FT                   /protein_id="ABK10221.1"
FT                   /translation="MANDASSNSRERILAAATRLAQTHGYGGLNYRDLASEVGIKAASI
FT                   YHHFESKADLGAAVARRYWEDSAAALDDMLANSRDPLDCLRRYPDTFRKALETGNRLCL
FT                   CSFMAAETDDLPEVVMKEVLAFADVNVAWLSKALSAAAVVGARESKQRARAIFAAIAGA
FT                   QLIARSRADLSLYDALIDNYRKAGLLPA"
FT   gene            317343..318035
FT                   /locus_tag="Bcen2424_3483"
FT   CDS_pept        317343..318035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3483"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   bja:bll7983 glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10222"
FT                   /protein_id="ABK10222.1"
FT                   /translation="MTSSNVDFDAARLPPMKIHDFPTGPYPTRVRIALAEKGLQSRVEF
FT                   VMVDLYQGEHKKPEFIAGKNYSGTLPVLELDDGTCIAECTAITEYLDALDGAPTLTGST
FT                   PREKGIIHMMSKRAELELLDAISVYFHHGTPGLGPDVETYQNPEWGFRQRDKALRGMRY
FT                   FDAVLQSRPYVAGEAFSMADITVIGGLIFAMLVKLAVPEECEALRAWYARMRQRESVRN
FT                   QPVFANLT"
FT   gene            complement(318234..319454)
FT                   /locus_tag="Bcen2424_3484"
FT   CDS_pept        complement(318234..319454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3484"
FT                   /product="transporter, CPA2 family"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pfl:PFL_3608
FT                   sodium/hyrdogen antiporter, putative; TC 2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10223"
FT                   /protein_id="ABK10223.1"
FT                   /translation="MWLIQVALVVLVCNGCGAIAERLGQCKVIGEIAGGILLGPLALGV
FT                   VTPSLYHELFTPDNTSAISRIGEIGLALLMFEIGLDVRLPAQRALLGPVLIAVPGMLLP
FT                   FGGGLMVGWLAHDVLAPQQPFWPFVLFCGVALSVSAVPVMARIVTDLNLTRHAGAASAL
FT                   SAAMVGDLLGWGALSLLVCLSHNAAGWRTLGVNVVLLVAYVALLVIAAKGVLLRVVGRS
FT                   LAQGWSRDTVAILVASVLVSGWITSQLGFHSAFGALLIGMLLRDVPSVREQFDRLLGGF
FT                   LHTILMPIFFACAGLNLQFFDVTAHAQWLWLLAFIVVGFAGKYLGVFAGARLTGHTSGD
FT                   ATVIATLMNARGLMELVFLSIGLQLRILPQNVYTMLVIFALFTTAVTAPLLRHHLRPVA
FT                   GGATESV"
FT   gene            complement(319529..320671)
FT                   /locus_tag="Bcen2424_3485"
FT   CDS_pept        complement(319529..320671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3485"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   gka:GK1316 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10224"
FT                   /protein_id="ABK10224.1"
FT                   /translation="MSSPYPDESYRGLAAELRERLQACLLPEAEGAEARGHLPRAIWPA
FT                   LAAEGWLDLPLAGEGFVRSAVFLEELGRLGYAGVRAAIGVHAFMAASYLAWFGNDAQRE
FT                   RYLARMRDGTAVAALAITEDQAGSDLSDLQCSAAASGDGWRVNGTKRFVSNGSQATLIV
FT                   ALVRSNAQRHALGGCSLLVVDAEAPGVTRTPLNLLGWRSADVCDIRFEDVAVPRENTLG
FT                   KPDKAFTCLMRCLDFERMVAGMLALGGAGCSIRLMNRFVRQRVVRGAPLSANQTIRHEL
FT                   VELIAELRLLRHFAYQLVQQYVGGRLGSGDASILKLRSTELAKRAAHLCAQFHGARGYL
FT                   SESDVARLYRDATAGTIAAGASELVREIIFDSVDSEALLD"
FT   gene            complement(320683..321156)
FT                   /locus_tag="Bcen2424_3486"
FT   CDS_pept        complement(320683..321156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3486"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: lpp:plpp0132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10225"
FT                   /protein_id="ABK10225.1"
FT                   /translation="MSLSKRAQYFQDLLADRGLQMEVLELPASTRTADDAARTLGCQKA
FT                   QIVKSLVFRSLAGNRPVVVLASGPNRVNEAAISELIGAQIVKGDADFVKETTGFAIGGV
FT                   PPFGHREEVALLVDEDLLQFDELWAAAGTPSAVFKITGRFTDVLPAHRVVSVK"
FT   gene            complement(321162..322727)
FT                   /locus_tag="Bcen2424_3487"
FT   CDS_pept        complement(321162..322727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3487"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: plu:plu3123
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10226"
FT                   /protein_id="ABK10226.1"
FT                   /translation="MKSLRCDEAAWSLHERINQTSVPYPDDASIGELFDRVVARRPDAA
FT                   AVITASRTCTYRELDDCANALAWRLIDEGVRPGDVVALVLPRGVDLVAALLAIVKAGAA
FT                   YLPLDAAWPAQRIAHLLEQTGCRHALYGAAGPAPAALGACRALPVSVDALREEGRREAP
FT                   HGRATAASIAYINFTSGSTGQPKGVPIEHRSVARLVFGARYARLDTESRVLQMAPVTFD
FT                   AATFEIWGPLLNGGACVVYEDGFVRASRLRDLIERHRINLLFLTTALFNALVDEAPATL
FT                   ASVETVLTGGEAHSLRHMNEALRRYGADRIVSVYGPTECTTFTTWYPVREIGPDETMLP
FT                   IGLPIQNTRLYVVDQGALCRAGEPGEICVAGPGLTPGYLGMPEITRERFVEYEIAGRRE
FT                   RLYHTGDIGYLREDGVLVFKGRLDDQVKINGFRIEFGEIAFHLQNRPEVRRSYVTVHDN
FT                   GIEKRLVAFVVPKSEASGVEQIRAALAEVLPAYMVPAQIHLCDELPISANGKIDHRHLK
FT                   QTLE"
FT   gene            complement(322732..323487)
FT                   /locus_tag="Bcen2424_3488"
FT   CDS_pept        complement(322732..323487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3488"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: hch:HCH_07001 predicted
FT                   thioesterase involved in non-ribosomal peptide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10227"
FT                   /protein_id="ABK10227.1"
FT                   /translation="MQAGAAQARWCLVPRPVAAPRLRLICFAYAGGSADLFRNWVEYLA
FT                   PDVELVAVRLPGRGMRLREPLYGEWPALVEDCASALAPYLGEPHALFGHSFGGRLAYEI
FT                   AQRMRPVLPPGTCRGLFIGGCRSPDSPQARPYLHELPEPAFRAALRTMGGTPTEVLEDE
FT                   RLMNLMLPIMRADMRLAELWGNWHRTPLDVPLHVYYGHADPIDSEASVAGWRGFTTSGC
FT                   ELVGFDGAHFFLDSHREPLLAHMATRLRS"
FT   gene            complement(323493..323750)
FT                   /locus_tag="Bcen2424_3489"
FT   CDS_pept        complement(323493..323750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10228"
FT                   /protein_id="ABK10228.1"
FT                   /translation="MSNRNDITDIEAWLVEACGALGLRVENADSDFFAAGGTSITAVKL
FT                   LSRVEERFGEDALTPEALFEQSRLSDIASHIAQHSETRTS"
FT   gene            complement(323773..324768)
FT                   /locus_tag="Bcen2424_3490"
FT   CDS_pept        complement(323773..324768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3490"
FT                   /product="chlorinating enzyme"
FT                   /note="TIGRFAM: chlorinating enzyme; PFAM: Phytanoyl-CoA
FT                   dioxygenase; KEGG: psb:Psyr_2610 chlorinating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10229"
FT                   /protein_id="ABK10229.1"
FT                   /translation="MQFYLSRAVKITMNNTIEVRSTRFALSQQELADFHRNGYIGPFDL
FT                   YPSDQMEANLQALRPKLLNTKKAIYSQEKSISGVTNLANYDRHLDVDFLASHITRPEIT
FT                   DRVASILGPDVLCWRSEFFPKYPGDEGTDWHQADNFSNVAGSKHPQIVWPEDAQFGGTI
FT                   TVWSAFTDATIENGCLQFIPGTHRTMNYDESKVMEYREDAINNREKQGVRRGFFGYDYR
FT                   QLQKDPNWSPDESQAKSMVMRQGQFIIFWSTLMHASHPHSGLTDKMRLGFAARYLPNSV
FT                   RVYPYSNTLEEFGGSASLDKFGCVQVAGQDAFGHNRFVTENVNGFRFQAN"
FT   gene            complement(324888..325169)
FT                   /locus_tag="Bcen2424_3491"
FT   CDS_pept        complement(324888..325169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10230"
FT                   /protein_id="ABK10230.1"
FT                   /translation="MTYFEFRDQLKRARLTVREFASLVKMNENSITNYSQKGVVPSHLA
FT                   VIALLMGEMADHQIEFRDIIDQMEIEQKKPRGAPIKFGMSHAKPALQG"
FT   gene            complement(325270..326430)
FT                   /locus_tag="Bcen2424_3492"
FT   CDS_pept        complement(325270..326430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3492"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bpm:BURPS1710b_0051 outative extracellular ligand binding
FT                   protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10231"
FT                   /protein_id="ABK10231.1"
FT                   /translation="MKRANLSSAFKLSLNATLSVLALAAATAASADPIVVKIGSVEPLT
FT                   GGIAHLGKDNENGARLAVEEINAKGLTIGGHSVTLQLDAQDDAADPRTATQVAQKLVDD
FT                   KVVAVVGHLNSGTSIPASKIYSEAGITQISPSSTNPVYTQQGFKTTFRVVATDAQQGPA
FT                   LANYAKKLGNIHRVAIVDDSTAYGQGLANEFEKRAKELGITVLSHDATSDKAIDFRSVL
FT                   TKIKGETPDAIMYGGSDSTGGPFAKQAKQLGLRARVFTGDGVCTESLANLAGDATENVV
FT                   CSQAGAAIQTMPGGEAFQAKYKKRFGQVVEYDAPFAYDAVYIIVDAMKRAKSTDPAKIL
FT                   AQMPPTDYHGVVGETQFDSHGDLAHGVISLYVYKAGKKTFLDQVKM"
FT   sig_peptide     complement(326335..326430)
FT                   /locus_tag="Bcen2424_3492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.902 at
FT                   residue 32"
FT   gene            326602..327249
FT                   /locus_tag="Bcen2424_3493"
FT   CDS_pept        326602..327249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3493"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_B1843 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10232"
FT                   /protein_id="ABK10232.1"
FT                   /translation="MRPPNTLVAEAIREDILRGELPPGTPLIQENLSVRYGVSRIPIRE
FT                   ALVRLEADGLARQEGKRGLTVAPLHATEAEDLWMMRSRLEPLALEMAFPFLTKSVLGEA
FT                   EDLIDKVEHLGNDPAKQSQANWLFHRTLYEKGNRRRLLVTLDGLHLQAERYLRFQYDVM
FT                   SHSRDSRTEHMAILDALRARDLETACQGLVRHIEDAGRKLVTALRNVPIAEA"
FT   gene            327361..328038
FT                   /locus_tag="Bcen2424_3494"
FT   CDS_pept        327361..328038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10233"
FT                   /protein_id="ABK10233.1"
FT                   /translation="MRWIGKTLAVISGMAVVGIACVQAAPSETAFPRFTQAQGKLDADG
FT                   LPLSGVKLCVLPDHAPCFEMPPTLVPGSAKELYQFGLNPRSERLPIASGGSWVFLAGTF
FT                   SGGGSGMLERVAVLRVGANGKIENLMPIVTETEMADRAMWNLPAVSPYPLFVRADYVWG
FT                   KGEDHFGKHFFDVDAWAFDPAANQYAKRFSYRTSQRYDRGEGADHVLSAERAEILRRLA
FT                   AAR"
FT   sig_peptide     327361..327435
FT                   /locus_tag="Bcen2424_3494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            complement(328043..329029)
FT                   /locus_tag="Bcen2424_3495"
FT   CDS_pept        complement(328043..329029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3495"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2663
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10234"
FT                   /protein_id="ABK10234.1"
FT                   /translation="MHDQSMNFDANDVVRRLGARLKIRHLVLLLQIQQHGSLTRVAEHM
FT                   ASSQPAVTNALSELESMFGTPLFERSSRGMRPTALGAVVLERAKAMIKDLDHLAREMEA
FT                   VAAGHAAHLHIGVIPFISGQMLSAALKRLQARMERRLTVTIHEGTSDQLLLQLKDHSVD
FT                   IVIGRASSAIDLGQVSFEVLYQQQPRMIASRRLAAKLARTPLDWHKLHALDWILGAPHT
FT                   PMREQVTDLFLSAGIAPPVPIVESYSSKLIGEMIASSDEAVSIVPADIAEELVRIAGVA
FT                   IVPYSLVWTLPPIALFTRSADSRSPARDLLVDALRAVCKETYGDAQR"
FT   gene            329150..331450
FT                   /locus_tag="Bcen2424_3496"
FT   CDS_pept        329150..331450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3496"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   enzyme domain protein; malic enzyme, NAD-binding; KEGG:
FT                   bur:Bcep18194_B2662 phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10235"
FT                   /protein_id="ABK10235.1"
FT                   /translation="MKQTETQQQAAFDYHEFPTPGKISVVASKPLVTQRDLALAYTPGV
FT                   ASVCESIAADPLQAHRFTSRGNLVGVITNGTAVLGLGNIGPLASKPVMEGKAVLFKKFA
FT                   GIDVFDIEINETDPDKLVDIIAGLEPTFGGINLEDIKAPECFTVEQKLRERMKIPVFHD
FT                   DQHGTAITVSAAFINGLKVVGKSIKEVKVVTSGAGAAALACLDLLVDLGLPVENVWVTD
FT                   IEGVVYRGRTTLMDPAKSRFAQETDARKLAEVIGGADVFLGLSVGGILTAEMLKAMAAR
FT                   PLILALANPTPEIFPELAHETRDDVVIATGRSDYPNQVNNVLCFPYIFRGALDVGATTI
FT                   TREMEIAAVHAIAGLAEEEQNEVVAAAYGAYDVSFGAQYLIPKPFDPRLIVRIAPAVAK
FT                   AAMEGGVATRPLANLDAYVEQLQQFVYHSGAFMKPLFATARQLVRDGGKARIVFTEGED
FT                   ERVLRAVQVIVDEKLARPILVGRPEVLLARIERFGLRLRLGQDVEVTNPEYDERFPQYW
FT                   TKYWELRCRDGISKEMARVEMRRRLTLIGAMMVQLGDADGMICGTVGEYHNHLRFVDEV
FT                   IGKKPGASTYAAMNILLLDQRTVALVDTHVNDNPDAEQIAEFTIAAARQMEWLNLTPKV
FT                   ALLSRSNFGSGSAASGVKMRRALEIVREQAPDIEADGEMHGDCALDEGLRAKLLPMSPL
FT                   KGAANLLVCPNVDAGNIAYNLLKTEAGSNVAVGPFLLGVNAPVNILTSSATVRRIVNMA
FT                   ALTVIEANRGVTG"
FT   gene            complement(331685..335962)
FT                   /locus_tag="Bcen2424_3497"
FT   CDS_pept        complement(331685..335962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10236"
FT                   /protein_id="ABK10236.1"
FT                   /translation="MIERIFQNIPEGKITDADKQPFLMSLGWSRGLSWNDLLQSWRVLL
FT                   ISEAGAGKTYECRAQAQRLSAAGEPTFFVELASLATSELRTLLDDEEENRLNTWLSSQS
FT                   DVATFFLDSIDELQLSLGSFERALKRFKKGIAGNLGRARIVITTRPVAFDSDLVRSLLP
FT                   IPPTSTAKPSEDEFAMIAMRVEQKNNKTEKAPEWRTVALMPLSDAQIVKFACDQGVTNP
FT                   DILLEDLRRRNAQEFARRPQDLIELCCDWREHKRIRTHYDQVAANVRIKLQPRDDRPEP
FT                   AELSVEKAMVGASRLALAMLMTRRLTVRHNAASDDIHNEAALNPSIILPDWSPSERKAL
FT                   LERPLFGFASYGRVRFHHRSVAEYLAAQRLRELREAGMPLRALKRLLFAETRGKVIVRP
FT                   SKRPVAGWLALGDDAIFEILRDNDPAVLLNEGDPETLTPMQRIQALRAYVERYGKGGWR
FT                   GRQVPHIQIHRFASPELASEVTQIWSQGVENPDVRLTLLYLIEAGQLVQCANVAYQCAC
FT                   DPNADSTERTIALDAMVALEEPRLPEIAHAVANDVETWPDKIARAAIVRLFPRDISIEQ
FT                   LCKTLARLKQGKRDINDLSPQLSRLVENAQLDQSQLVSLRDGLVELVSDGLSWHKEWSH
FT                   LISNRENLSDVLASVCVRGIGTNKDEQWLDACVLSTRLHDQAHSSDESHKALLNHINLF
FT                   EAQDNEKLFWATDKLIQSLRVITDPWNRLVEIIYHDSSVRLTVARDLPWIKMTLANTER
FT                   STADRALVLQAALRLSPDEGQWQHHLSELEQLVADQTELLDVIAERRKLPKNNKELERM
FT                   EARSIERKRQRDRTAAKNRASWILFWREVSQNPESAFSDERSWNTAWNLWRAMSQDGAA
FT                   GQESGWNRRLIEEHFGKETADRLRRILMNIWRAESPTCASERPADQRNTYLVRWQLGLA
FT                   AIYAEAEDPGWARQLTEEEARLAARFALVEINGLPAWLDSLIDAHSHAVDTIIGQELTW
FT                   ELSPKAKGAQSLLLQSISYAQSSRLYLPRLMSWLEERGDCLTDNHESTAAVQRLRQVIG
FT                   VILERGDEKMRMQLFSIARQRLQNDLPIQFNFVWLATVIRIDPEIGVAELENRLRTIEP
FT                   GPHSEAVTWFSVLFGDRIDSISLRDEVFTPSLLLRLLRLSYHHVRPNDDATHEGSYSPD
FT                   VRDHAERARNEVVGALLDAKGEDGWAAKLEMSNDPLCAHFRDRIISVAEEHWAQEIDSI
FT                   AFNDMQAISLDKTGEAPASTNEAMFAVLKDRLSDLDDLLLRDTSPREAWAGISDEKVMR
FT                   REIARELSYAANGIYKIDQEAVTADEKETDIRLRSTTSDHEAIIELKLGDGRSAKDLRD
FT                   TIYNQLVKKYMAPENSRTGCLLITLSKNRKWENPDNGQRIDLDELMLLLQAEIERVQEM
FT                   MANAVSLSIHLLDLRTRLPVENR"
FT   gene            336687..337886
FT                   /locus_tag="Bcen2424_3498"
FT   CDS_pept        336687..337886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3498"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   bur:Bcep18194_B2654 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10237"
FT                   /protein_id="ABK10237.1"
FT                   /translation="MYAFTPSFQNPAGSPIRELFKYLSEPGMISFAGGYPASDLFDVDG
FT                   LNAAAERAYAQPVRCLQYGPTDGLAELKQQLIALMARRGVACAPAELLVTTGSQQGLDL
FT                   LLRVMVSPGDVVLTEQPAYPATLQAMRLQQARIVTIPVDGEGLDVDRLAAQLASGAIAQ
FT                   PKLLYTVPTFANPTGATLTRERRLKLLRLAVQYRFLIVEDDPYGDLRFAGEAVPSMLAL
FT                   AGEVDGARDWLVHFASLSKIVAPGLRVGWTIAPAEITRRCVIAKQTVDLCSTPWTQATA
FT                   AEYLADGALERHLPRITAAYRRKCDAMCDALRDGFGDAIEFHRPEGGMFVWARLGAVSS
FT                   DVLLQQAIANKIVFVPGKAFFADNVDAASLRLSFAAPDIDAIREGVARLVRAYGAALAA
FT                   "
FT   gene            337899..338090
FT                   /locus_tag="Bcen2424_3499"
FT   CDS_pept        337899..338090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10238"
FT                   /protein_id="ABK10238.1"
FT                   /translation="MTITVNETASPGAASGAGDTRPAKHRSSQISAGPQYVADVLGRFG
FT                   AEPAPDAGDAAPVVLGYN"
FT   gene            338185..338784
FT                   /locus_tag="Bcen2424_3500"
FT   CDS_pept        338185..338784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3500"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: bur:Bcep18194_B2652 pyridoxamine
FT                   5'-phosphate oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10239"
FT                   /protein_id="ABK10239.1"
FT                   /translation="MSDSTTDSISESLAQTYDRLWSCLESGVNVQRSPFTMLQAATLGL
FT                   DGAPKVRTIVLRQVNRVGRVLSFHTDARSAKVAELRRDPRLSIVANDLDALVQIRAEGV
FT                   ASICDDEAQRRAIWEASRPHTLLLYRAPLPPGTPVVSPEAAHLDSTAPTADGYENFCLI
FT                   HMTVTRIDWLELARAGHRRAVFDLNERGYEARWIAP"
FT   gene            complement(338810..339700)
FT                   /locus_tag="Bcen2424_3501"
FT   CDS_pept        complement(338810..339700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3501"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2650
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10240"
FT                   /protein_id="ABK10240.1"
FT                   /translation="MPPRPSRLPPLNALRAFEVSARHLNFRAAADEIGVTQGAVAQQVR
FT                   HLEDVLGLKLFERLPRGLALTHDGAAYFSDVQRALHAIADATDKLVKRRAALTISTTPS
FT                   FASKWLIPRLAQFTEAHPDYDVRVIADPQIATFRHDGVDLAIRYGKPPFGKHLATHALF
FT                   PLDVCAVCSPSVLSPPAAPRALAGQVLLHDAHDLWPEFLAAMPAPVDVDPHKGLRFNQT
FT                   SLAIDAAVAGQGIALATEPLVERDIAAGRLCKPFDFAFPLSMGFYLVYPAERRDDDAIA
FT                   VMREWMIQAASDGRP"
FT   gene            339781..340539
FT                   /locus_tag="Bcen2424_3502"
FT   CDS_pept        339781..340539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3502"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_B2649 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10241"
FT                   /protein_id="ABK10241.1"
FT                   /translation="MARRMAAARRQNRNEERIVTVEKVALITAAGKGMGAAIARELAAT
FT                   GYRVALMSLSGSAVALGEELGGFGIKGSVTEEADIDKLVQETIARYGRIDAVVNNTGHP
FT                   PKGELLAITDDNWHAGLDLILLNVVRVMRRVTSIFQKQGGGAVVNISSFAADAPEQPMP
FT                   VSSALRAALSAWTRLYAERYAAENIRMNAVLPGFIDSWPETPEIVARIPAGRFGKTGEI
FT                   AKTVAFLLSDGAGYITGQNIRVDGAIVKAL"
FT   gene            340743..342020
FT                   /locus_tag="Bcen2424_3503"
FT   CDS_pept        340743..342020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3503"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; Epoxide hydrolase
FT                   domain protein; KEGG: bur:Bcep18194_B2648 epoxide
FT                   hydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10242"
FT                   /protein_id="ABK10242.1"
FT                   /translation="MSSTPFSPMRRHLLATSVAAGVSAMLPTALHAATGASGIRPFTAH
FT                   IPDEAVADLRRRIAATRWPGRETVADESQGVRLARMQALLRYWGTDYDWRKGEARLNGF
FT                   PMFITEIDGLDIHFIHVRSRHENAMPMIMTHGWPGSIFELLKAIGPLTDPTAHGASADD
FT                   AFHVVVPSLPGFGFSGRPTKTGWGSDHIARAWGELMARLGYTRFVSQGGDCGSVISHRM
FT                   AMQHVQGLAGIHVNMPATVPPEIATLLATDAPAPASLSPKEKAAYEKLATFYRDNCGYS
FT                   AMMVTRPQTVGYALADSPSGQAAWMYDKISQWTYSGGVPERSIPRDEILDDISLYWLTN
FT                   TATSAAQIYWEDHSNNFNAVDISLPAAITVFPGEIYQAPRSWAERSYHNLIYFNEVDKG
FT                   GHFAAWEEPELFAREVRAGFRSLRRV"
FT   sig_peptide     340743..340841
FT                   /locus_tag="Bcen2424_3503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(342073..343458)
FT                   /locus_tag="Bcen2424_3504"
FT   CDS_pept        complement(342073..343458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3504"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bpm:BURPS1710b_1317
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10243"
FT                   /protein_id="ABK10243.1"
FT                   /translation="MKQRAKASLSGAMADNLARQIEEGVLAAGTKLPSIREYAEASGCS
FT                   KNTVISAFEMLAADGLIEPRRGSGFFVTRRAAAAPELDEPSSLDRAMDIVWLMREQLHA
FT                   KPDVLNLGEGFPPIEWLEETRLNQYQQRIMRTSAASLFRYGSRFGYLPLRQSLQQKLAG
FT                   YEIEAPPAQIVLTHGANQAMDLVLRYFVRPGDTVLVDDPGYYPLFGKLKLSGANIVGVP
FT                   REIDGPDVTKLAEHIAAYRPKLFFTQSVGHNPTATDTSAAKAHRILQLADAHDLIIVED
FT                   DALADLRPRSLTRIATLDQLRRTIYIGSFSKSVSAALRVGFLACNAALASDLADVKMLT
FT                   HVSSSEYCERTLDAIVSDGHFLRHTNHLQEKLRRATGTALDALGRLGAEVYRPCEQNLY
FT                   LWAALPGWPDSMLLAQALLERGVILAPGAVFSPQADRPSKYCRFNVAYLADKRFAQALQ
FT                   AVT"
FT   gene            343621..344907
FT                   /locus_tag="Bcen2424_3505"
FT   CDS_pept        343621..344907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3505"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /note="TIGRFAM: hydroxymethylglutaryl-CoA reductase,
FT                   degradative; KEGG: sil:SPOA0163 hydroxymethylglutaryl-CoA
FT                   reductase, degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10244"
FT                   /protein_id="ABK10244.1"
FT                   /translation="MPIDSALPNFRSLTPEQRLSHLSRAVGLDDAEHALLAQPGALPLD
FT                   TANGMIENVIGTFELPMAVAGYFRINDRDVIVPMAVEEPSIVAAASYMAKLSRAAGGFR
FT                   TSSSGPLMRAQVQVIGVDDPYGARLAILRHAAELIALANSRDKVLVGLGGGCRDIEVHV
FT                   FPDTPRGAMIVAHLIVDVRDAMGANTVNTMAETVATRIEAITGGQVRLRILSNLADLRL
FT                   ARAEVRYSAATLATDDYAGEAVIDRVIDAYVFAATDPYRAATHNKGIMNGIDPVVVATG
FT                   NDWRAVEAGAHAYASRSGRYTSLTTWEKAANGDLVGTIEMPMPVGLVGGATKTHPLARL
FT                   ALKIMNVTSAQELGEIAVAVGLAQNLGALRALATEGIQRGHMALHARNIAVAAGATGAD
FT                   IDRIAQRMVAAKDVRADFAVELLAGRSGG"
FT   gene            344996..345493
FT                   /locus_tag="Bcen2424_3506"
FT   CDS_pept        344996..345493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10245"
FT                   /protein_id="ABK10245.1"
FT                   /translation="MEQTGSSAVAPAPHRTRPLAGADAAATTLVEVWGDTVATKHLAWS
FT                   VLLGIAISLGAFEIGRIALASFVHDAAIARAYAMLIGLGGCLLAGTICAVLFKPKRTVI
FT                   EHAAGSAERDDALRQLAEASGGLGATSDLSASARAEMEELGLLDLFASYDASTGRARAG
FT                   GR"
FT   gene            345493..346872
FT                   /locus_tag="Bcen2424_3507"
FT   CDS_pept        345493..346872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB2748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10246"
FT                   /protein_id="ABK10246.1"
FT                   /translation="MDALLQALPAAFAMGLLGAIVFSGIGLISGTDETTTIAPLTLLVA
FT                   LLGVPPAGVFTFFLAGAVAKHITHAIPTALLGIPGDTMAAPLLQQATLLRALGVPHIAL
FT                   RKMISGAIVAAFVALPLAVLFASLLAPFGAAIAKAAPWVFLAAAVGIAYCSAGRWASVL
FT                   LLVPFVMLVVGLQALTGHYGVKLSVSYFLGIAIGPLVADLFSILSPAERRRMRRDGPST
FT                   FVLAPDVKSWRGYFPNPLKVLDREQVAWTVGTAAVSSATFVFSPVAMTVLMGEIVGARV
FT                   RHAYQRLTTVIAARNGVTEATYIAEALIPLIAFGLPLSPVAAGPAAPLFNAPPRFTVDA
FT                   ASGQIHNLHTLMSWPEFLGYGLLSIVLAALIAYPLAMHHAHRAASFVARKLSHEAIIAT
FT                   FAGLIVVIGVWEGQLLGLAVIVTIGLFGGMLSRLFAFNTGVQFMGYYVAVLSVPAIARL
FT                   F"
FT   gene            347129..348172
FT                   /locus_tag="Bcen2424_3508"
FT   CDS_pept        347129..348172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3508"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bur:Bcep18194_B2631 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10247"
FT                   /protein_id="ABK10247.1"
FT                   /translation="MPDTVNTRRRLILGSTLASLSLADLGFSALAQAQSAPDASAAKRP
FT                   AGVASLGTIHQIDAGVLNVGYADLGPKNGPVVFLLHGWPYDIYSYADVAPLLVAAGYRV
FT                   IVPYLRGYGSTTFRSADTVRNGQQAVTAIDIVALMDALKIDRAVFGGYDWGARTADVIA
FT                   ALWPQRVKALVSVSGYLIGSQAANAKPLPPQAEFQWWYQFYFTTERGELGYAQNREAFN
FT                   KLIWQLASPKWQFSDETYARSAASFRNPDHVAVVIHNYRWRLGLAKGEAQYDDIERRLA
FT                   AAPAITVPTITMEGDANGAPHPEPAAYAKKFTGKYQHRTITGGIGHNLPQEAPQAFADA
FT                   VLQVEHL"
FT   sig_peptide     347129..347230
FT                   /locus_tag="Bcen2424_3508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.910 at
FT                   residue 34"
FT   gene            348172..348714
FT                   /locus_tag="Bcen2424_3509"
FT   CDS_pept        348172..348714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10248"
FT                   /protein_id="ABK10248.1"
FT                   /translation="MRARVGLGPHGVRRALVAGVLLAGAWSASGPAAFAEQPKPAAAAS
FT                   PIYGVTIPPGYRKWEMVAPAEEAAPLDELRVVLGNPVAIRALEQATLPFPDGTILVKLA
FT                   YKRKQSDEFAPATVPGQATTVQVMVKDSRRYAATGGWGFGRFVNGVPADIGQHQTCFAC
FT                   HQARVKNHDYVFTRLAP"
FT   sig_peptide     348172..348279
FT                   /locus_tag="Bcen2424_3509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.992 at
FT                   residue 36"
FT   gene            348999..349346
FT                   /locus_tag="Bcen2424_3510"
FT   CDS_pept        348999..349346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10249"
FT                   /protein_id="ABK10249.1"
FT                   /translation="MKAARILAVAVLAVAPALSFADTGHGLTRAEVRADLIRLEKAGYN
FT                   PAGSEAHYPDDIAAAEHAVAAAEQVARSDQNGPSKSQDDNVADASTPAGHRDAAQPRAA
FT                   RNAADDLYAHS"
FT   sig_peptide     348999..349064
FT                   /locus_tag="Bcen2424_3510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            349431..350222
FT                   /locus_tag="Bcen2424_3511"
FT   CDS_pept        349431..350222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10250"
FT                   /protein_id="ABK10250.1"
FT                   /translation="MAGLMKRALVSAAMIGGLFGAVAAQAAPKEDLKGTNVVLVHGAFA
FT                   DGSSWNRVIPLLEARGLHVVSVQNPLSSLADDAAATKRTIDEQKGPVVLVGHSWAGVVI
FT                   SDAGNDDKVKSLVYVAAFAPDNGQSIADVTQGLPAPSWAGELRKDAGGFARLSDKAIAQ
FT                   DFAPDLPPAQQRLVAATQGPWYGGCISEKITQAAWHAKPSTFVVATQDRMIDPALQEAM
FT                   AKRIGATVTRVNSSHVAMLSQPKAVADAIIAAAERAKQDTQ"
FT   sig_peptide     349431..349511
FT                   /locus_tag="Bcen2424_3511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 27"
FT   gene            350299..351699
FT                   /locus_tag="Bcen2424_3512"
FT   CDS_pept        350299..351699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3512"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bur:Bcep18194_B2627 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10251"
FT                   /protein_id="ABK10251.1"
FT                   /translation="MTELWQLSATELAKRVRQRDVSAREVADAVLDRLDAVNPAINAVV
FT                   EHRPDDVRRQADEVDRAIARGDDPGPLAGVPVTVKINVDQAGFATTNGTRLQRDLIARA
FT                   DSPVVANIRKAGGVLLGRTNSPTFALRWFTSNRVHGHTRNPRNPSLTPGGSSGGAAAAV
FT                   AAGIGPLAVGTDIGGSVRYPAYACGVHGIRPSLGRVPAFNASSPERAIGAQLMSAAGPI
FT                   ARTIDDLSLALRAFSAPDPRDPWHAAVPFDGREVPKRAALCVRPRGLEVVPEVEAALRD
FT                   AARRLVDAGWTVDEIDDTPPMREAALLQEQLWLGDGFDALANAAEQDGDPGAAAVIAAV
FT                   RSKVRDLPADVISRALVRRTTLTRQWRLFLDEYPVLLLPVSSELPFPDDLDRQGPEGFD
FT                   RVWEAQLTLRALPAMGLPGLAVTTSLVNGVPVGVQVVATHHREDLCLLAGRDIEARGVP
FT                   VVPVDPVV"
FT   gene            352057..352527
FT                   /locus_tag="Bcen2424_3513"
FT   CDS_pept        352057..352527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3513"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   bur:Bcep18194_B2626 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10252"
FT                   /protein_id="ABK10252.1"
FT                   /translation="MTVELEERTAAQQALEDARAAALAAGKPYAGGVAPETAWALFSAG
FT                   DAVLVDVRTAEERKFVGYVPESLHVPWATGTSLTRNPRFVRELEAKTGKDAVVLLLCRS
FT                   GNRSAQAAEAAAKGGFTQVFNVLEGFEGDLDERQHRGGQNGWRFRGLPWAQD"
FT   gene            352556..353494
FT                   /locus_tag="Bcen2424_3514"
FT   CDS_pept        352556..353494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3514"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: bur:Bcep18194_B2625 serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10253"
FT                   /protein_id="ABK10253.1"
FT                   /translation="MAAFDIDDIVQSLQTVRRAWREKQRRSLEPGGRDLPAREALAQIV
FT                   GALKGVLFPMRLGPPDLRQESENFHVAHALDAALNALLTQVTLELRYAARHRNADGPAD
FT                   NLDEVASKAVQAFAARLPEIRRLLDSDVLAAFHGDPAAGSVDEVLLCYPGILAMIHHRL
FT                   AHELYGLGLPLLARIIAEQAHAETGIDIHPGARIGAGFFIDHGTGVVIGETAIIGERVR
FT                   VYQAVTLGAKRFPRDAAGHLEKGLARHPIVEDDVVIYAGATILGRVTIGRGAVIGGNVW
FT                   LTQDVPAGENVTQAVLRSEANAAPRTAARVA"
FT   gene            353503..353724
FT                   /locus_tag="Bcen2424_3515"
FT   CDS_pept        353503..353724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3515"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bur:Bcep18194_B2624 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10254"
FT                   /protein_id="ABK10254.1"
FT                   /translation="MSDLIHHFGATVRKLREARTWSQEQLAEHAGLNRSYVGEIERGEA
FT                   IASIVTADKIARAFDVSISTLLPGAYVT"
FT   gene            353862..354794
FT                   /locus_tag="Bcen2424_3516"
FT   CDS_pept        353862..354794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10255"
FT                   /protein_id="ABK10255.1"
FT                   /translation="MSTVASGTAALSDHAARQLANATKTVPQLSTITPRWLTHLLQWVP
FT                   VEAGIYRLNQVKNPEAVRAACTQLEDESVLPQTFVPYEEQPREYFLNAVSTVLDVHTRI
FT                   SDLYSSPHDQIKEQLRLTIETIKELQESQLINNPDYGLLANVTDEQRIFPLTGAPTPDD
FT                   LDELLTKVWKEPAFFLTHPLAIAAFGRECTRRGVPPPTVSLFGSQFLTWRGIPLIPSDK
FT                   VPVADGKTKILLLRVGDKRQGVVGLYQPGVAGEQGPGLSVRFMGINNQAIASYLISLYC
FT                   SLAVHSPDALAVLDDVEIAKFHDYPDTYR"
FT   gene            354826..356778
FT                   /locus_tag="Bcen2424_3517"
FT   CDS_pept        354826..356778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3517"
FT                   /product="L-selenocysteine selenide-lyase
FT                   (L-alanine-forming) / cysteine desulfurase"
FT                   /EC_number="4.4.1.16"
FT                   /EC_number="2.8.1.7"
FT                   /note="TIGRFAM: cysteine desulfurases, SufS subfamily;
FT                   PFAM: aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   bur:Bcep18194_B2622 cysteine desulphurases, SufS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10256"
FT                   /protein_id="ABK10256.1"
FT                   /translation="MPHAPLPAGLPDPATLARLASEFFATPPGQATAPGLSAGSGAVGG
FT                   VPSALPAAAPILASVSNPVPGGSPLAGPGGAGTGVPGLALPQGKVPGANLAPSAPTHVL
FT                   SLGNRAPALAPHAAAQNGLPDNVVSIAPALEPRVGGAALGVPQVNAPAPEGAAKASPYY
FT                   FTDGSLQGWQGTPQDIVVPSNGLASPEAFGLPGDDALRALLAVQRDVRVSHASGASGAD
FT                   VPRYFIDDSHAAEPQGQLYRGAHPPFDVNAIRRDFPILQERVNGKQLVWFDNAATTHKP
FT                   QAVIDRLAYFYAHENSNIHRAAHALAGRATDAYEHARETVQRFIGASSPDEIVFVRGTT
FT                   EAINLIAKTWGVQNVGEGDEIVVSHLEHHANIVPWQQLAALKGAKLRVIPVDDSGQVLL
FT                   DEYRKLLNDRTKIVSVTQVSNALGTVVPVKEIVELAHRAGAKVLVDGAQSISHMRVDVQ
FT                   ALDADFFVFSGHKIYGPTGIGVVYGKRAILDDMPPWQGGGNMIADVTFERTVFQPPPNR
FT                   FEAGTGNIADAVGLGAALDYVNRVGIENIARYEHDLLAYATSVLAPVPGVRLVGTARDK
FT                   ASVLSFVLKGYETEEVGQALNEEGIAVRSGHHCAQPILRRFGLEATVRPSLAFYNTCDE
FT                   VDALVSVVRRLAARR"
FT   gene            complement(356858..357742)
FT                   /locus_tag="Bcen2424_3518"
FT   CDS_pept        complement(356858..357742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3518"
FT                   /product="acetylglutamate kinase-like protein"
FT                   /note="KEGG: bur:Bcep18194_B2621 acetylglutamate
FT                   kinase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10257"
FT                   /protein_id="ABK10257.1"
FT                   /translation="MFPDPDTPTRRVAGLARSLPFMQALHGQTVVIVDGGAASDVHTRS
FT                   AFAQDVALLALTGIRPIVVQSAPSTSGTQSMHTVHAAMTGINHELARLIGSHGARAIGI
FT                   DGHDGGLLVASAVPDSANTSMVARFDVTALNALLDNGLVPVVMPVAPDDAGRDCLLRPE
FT                   RLGSLLAQRTCAVSLVMMVDKGLLHELGELAGLYGITELEQWLAEHPAADAAPCVRDAL
FT                   DALAHGVQNVHLADIGQPESLIDELLTEEGSGVVFCRRGNTDLLSEIRRYFADSACVLR
FT                   DGFSVEQKPVVRF"
FT   gene            complement(357791..358312)
FT                   /locus_tag="Bcen2424_3519"
FT   CDS_pept        complement(357791..358312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3519"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; KEGG:
FT                   bur:Bcep18194_B2620 putative PTS IIA-like
FT                   nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10258"
FT                   /protein_id="ABK10258.1"
FT                   /translation="MQTHQAAVDGQSDRPQQRGGTPFATALADACPPDNILLDVPVESA
FT                   IQLFDLVAHHVARDSGVSAERIRAELIKREQLGSTGLGQGVAIPHARVDGIGSAVALFV
FT                   RARYPFTFNAPDRKPVREFVVLVLPHADDRAHLELLADAARWFSERAIRQASRDAQTPD
FT                   EIRRLMQRTV"
FT   gene            complement(358445..358666)
FT                   /locus_tag="Bcen2424_3520"
FT   CDS_pept        complement(358445..358666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10259"
FT                   /protein_id="ABK10259.1"
FT                   /translation="MMLGLTFWKHVIGARTHALREDRTTAHGRHRRVSRTLVLASAIMA
FT                   FAAIAFGAPVVGISVFLLTTLPFVLSGT"
FT   sig_peptide     complement(358508..358666)
FT                   /locus_tag="Bcen2424_3520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.868 at
FT                   residue 53"
FT   gene            complement(359153..359509)
FT                   /locus_tag="Bcen2424_3521"
FT   CDS_pept        complement(359153..359509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3521"
FT                   /product="lysine exporter family protein (LysE/YggA)"
FT                   /note="KEGG: bur:Bcep18194_B2617 lysine exporter family
FT                   protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10260"
FT                   /protein_id="ABK10260.1"
FT                   /translation="MCTLARRNTIAGGPIAAPAATSGWRAARKGYVASMTNPKSVAFYG
FT                   SIFALRAPAHAPAWLDLSVVVLSVATPAAWYCTMALLASRPSVRRLLVRRKAALDTAAG
FT                   LLLMAVGGRMLAGR"
FT   gene            complement(359596..361236)
FT                   /locus_tag="Bcen2424_3522"
FT   CDS_pept        complement(359596..361236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3522"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: bur:Bcep18194_B2616 chaperonin
FT                   Cpn60/GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10261"
FT                   /db_xref="GOA:A0AXY5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AXY5"
FT                   /protein_id="ABK10261.1"
FT                   /translation="MAAKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFG
FT                   APVVTKDGVSVAKEIELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQ
FT                   KYVAAGLNPLDLKRGIDKAVASAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIA
FT                   EAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILL
FT                   HDKKISNIRDLLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGF
FT                   GDRRKALLEDIAILTGGQVIAEETGLTLEKTTLAELGQAKRIEVGKENTTVIDGAGDAK
FT                   NIEARVKQIRVQIEEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDA
FT                   LHATRAAVEEGIVPGGGVALIRVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNA
FT                   GEEASVVVAKVAEGTGNFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTT
FT                   DATVYEAPKDAAPAAAPGGPGAGGPGFDF"
FT   gene            complement(361249..361539)
FT                   /locus_tag="Bcen2424_3523"
FT   CDS_pept        complement(361249..361539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3523"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: bur:Bcep18194_B2615
FT                   chaperonin Cpn10/GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10262"
FT                   /protein_id="ABK10262.1"
FT                   /translation="MSLRPLHDRVIVKRLDQETTTASGIVIPDSAAEKPDQGEVIAVGP
FT                   GRKDTDGQRIVPDLQVGERVLFGKYAGQAVKVDGNEFLVLREEDIVAVVNQ"
FT   gene            complement(361681..362964)
FT                   /locus_tag="Bcen2424_3524"
FT   CDS_pept        complement(361681..362964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3524"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: bur:Bcep18194_B2614
FT                   secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10263"
FT                   /protein_id="ABK10263.1"
FT                   /translation="MTLLSLRGIAARTLLVSALAVSSVVSLAASPGRVPAPDPLQGDGR
FT                   VSAFYTWDRDVPATPGALLRTEALPATLGLASAARQLRILYASTDGVGGRTPIAVSGAL
FT                   FLPRGTPPAGGWPIVAWAHGTFGMADICAPSWFGRSYRDVRYLSAWLQQGFAVVATDYQ
FT                   GLGTPGPNPQLNNRSNSYTLLDSVRAVLAGVPGLANEVVLVGQSQGGSAVIAAAGYAPV
FT                   YAPELAIRATVATGTIYNASRATLASLPKFETAYRRDPERVDPTLAYQFYSVLSAQQID
FT                   PSLRADEVLTDTALPILEQSRISCLASLEDDAALAQLTHANTVKPGGDARLKAWWDDYL
FT                   KYPTLKIATPVFIGAGADDGLAPLELALARDACAAGTTVEAHLYAGREHNGTVNASLAD
FT                   SIPFVKRVLAGETIRPVCSPVPQPAVSQ"
FT   sig_peptide     complement(362878..362964)
FT                   /locus_tag="Bcen2424_3524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            363341..364021
FT                   /locus_tag="Bcen2424_3525"
FT   CDS_pept        363341..364021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3525"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bur:Bcep18194_B2613 class II aldolase/adducin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10264"
FT                   /protein_id="ABK10264.1"
FT                   /translation="MSVTQAIDSGELVAFVERATREFAQAERVLKETRTLSATNTFQAF
FT                   QRVPGTELVVALSAPSPWAASREIQPVVVTLDGDVLHGDARAGGNGPRYAGVFREVPEV
FT                   DVVIHVHGPYLGAWASAHRPLPIRYAPAARYTRAREIPVYVDRRPGEPRFIVDTIRRDP
FT                   DVPAIIEANGGATFWGKSILDVSKYILILEEAAYFQALAEPLGGSLEFGPGALEQQWKM
FT                   TGLA"
FT   gene            364142..365275
FT                   /locus_tag="Bcen2424_3526"
FT   CDS_pept        364142..365275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3526"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG:
FT                   bur:Bcep18194_B2612 sigma-54 specifc transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10265"
FT                   /protein_id="ABK10265.1"
FT                   /translation="MAIFSLPDPTSHAITIRAKALTFDDPKSRVLLERIQLVAPSDATV
FT                   LVTGESGTGKELIARLVHSLSERHDGPFVAVNCGAFSETLIESELFGHERGAFTGAINS
FT                   QPGWFESANRGTLFLDEVGDLPLSAQVKLLRVLQEREVTPVGSRKTVKIDVRLVAATNV
FT                   NLEAAVRAGNFREDLYYRLNVVKLSLLPLRERPGDIAPLIEHFIDTYAKRLRVAAPTLT
FT                   DAARARLHAHAWPGNIRELENVIHHAVLICAGGAIDVGDLQFSALSLAPDPADAPGATA
FT                   APPRRARDVAEATDALRHAVIELLDLGTPALWQHIEDTVYRSVFDYSEHNQLRMSRLLD
FT                   QSRNIVRARLAQLGILKPRDAGDGGDADTGARLRRQA"
FT   gene            complement(365266..366054)
FT                   /locus_tag="Bcen2424_3527"
FT   CDS_pept        complement(365266..366054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3527"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2611 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10266"
FT                   /protein_id="ABK10266.1"
FT                   /translation="MTFVTRVASLAPLRRRARGLVVPALLLAAWQTASSGDAAHQYAFV
FT                   PLQQVGAALVELARSGELTTDLGASLRRTTLGLGFGVAFGLVFGAAMARSTLARKLGEP
FT                   AFQALRYVPLLGLIPLLSLWAGTGEFAKVFIIALAAFYPMTTASFDGLRRVDPRYVELA
FT                   QSYRLTRIGLWRDVLIPGALPDLFAGVLQAVPFAWITATSSELLFNTGAGVGSLMQNAQ
FT                   AGARADVLLVCVLGVTALAVGMSTLCERIAQRALRWRDHA"
FT   sig_peptide     complement(365947..366054)
FT                   /locus_tag="Bcen2424_3527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.588 at
FT                   residue 36"
FT   gene            complement(366077..366895)
FT                   /locus_tag="Bcen2424_3528"
FT   CDS_pept        complement(366077..366895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3528"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2610 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10267"
FT                   /protein_id="ABK10267.1"
FT                   /translation="MATRALAPNGLRAAVRLPGVARLGHHALWWITPVAFAALWWLASA
FT                   QRWFPPQLVVPPERLAATLRTLLDTGELRDNLSITLHRLVLGFAIGATSGAAFGILLAR
FT                   SRLFADYLRPTFDLLRQLPTLTLIPLLILLIGVDEPLKLVVVGKAVFFPVALAAYTGVH
FT                   DAPRDLVEMARHYGLGRFALLRDVLLPAALPPLLTGVRIALARAWLALVAVELLSADSG
FT                   IGQMMELARQMLRLDVVLVDVAVIGLIGFALDRSIALVQRYALRWLTPAR"
FT   gene            complement(366895..368001)
FT                   /locus_tag="Bcen2424_3529"
FT   CDS_pept        complement(366895..368001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3529"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2609 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10268"
FT                   /protein_id="ABK10268.1"
FT                   /translation="MKPTLSLASLHRPLRALLAALPLAVASFVTPAAHAQDAPKVVRIA
FT                   VVAYSSGGKTQYAGASALIDADKSLEKALAARHVTLQWVPVSTAAVGTLVNEAFTNGSI
FT                   DFAGYGDLPSVVVNASGTHTRLIVPGGVGSNTYLVVPAGSSAKSIVDLKGKRIALNRGR
FT                   PWEVPFSKLLAENGLKLSDFRIYNLDPQAGAAAVAAGRVDGFFTLSDAYSLVDKNVGKI
FT                   IWSTKNAPDDWKMRAELWASDDFVRRYPDITQIVATAYVRAAHWISQPQNRDAYVKILS
FT                   ASGQPESVVRREYADEATPWKEQWTPLFTPALTGHYRDVVAYSRQAGLTSAPVDVNALL
FT                   APTFVSTALKQLGLDGYWRADAPRVASR"
FT   sig_peptide     complement(367894..368001)
FT                   /locus_tag="Bcen2424_3529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 36"
FT   gene            complement(368033..369109)
FT                   /locus_tag="Bcen2424_3530"
FT   CDS_pept        complement(368033..369109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3530"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2608 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10269"
FT                   /protein_id="ABK10269.1"
FT                   /translation="MTDRPDSSSDKQQTFWYARSPVPTPLGIAVHLGWLNGETSADGVA
FT                   IRSPRGATRHDVSSISDHTLAQSFRQGGSIPAMWARSNDANTRVIGLSWVDESQLILAR
FT                   PESGIRSVKALRGRRIAIPSRPDDRIDIFRASALRGFVNALSLDGLTLGDVERVDVRAR
FT                   TLQAVGPARAASLFASPQGFSSRALYAAEAGALLRGEVDAIYVKGSTGLEIAQLIGAHV
FT                   VIDIGFHPERSIRNNNGTPRPLTVNADVLANHPDIVAGFLKLVVAAGEWAGTHPDETAH
FT                   YVAGETASSIDWVRAAYGNQLHRHLGINLDDESVAALDEFKTFLHDHGFLEADFDVADW
FT                   IDPRPLADVLRPSLQKRA"
FT   gene            369551..370723
FT                   /locus_tag="Bcen2424_3531"
FT   CDS_pept        369551..370723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3531"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   bur:Bcep18194_B2607 alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10270"
FT                   /protein_id="ABK10270.1"
FT                   /translation="MAVEFLWRLPMHGDGRRAHDLHTRGEWNRQRASRVAPKVDDDAFG
FT                   YIDYLSQVARAADIAGFHGALIPIFRFTEEPWVVAAALARETRRLRLLIALQPHFVHPV
FT                   YAAQMAASLQRISRGRVEWNVVTGGGGPDQRAYGDFIDHDSRYARTDEFLDVVKGVAAG
FT                   APFTFDGRFYRVEEGGLLPPLSGQKPPRIYLAGASDAALAVAAKHGDVHLSWGEPLAKQ
FT                   KEVIDAARRALDRQNAERDLRFGMRIDILARETEEQAWAELRQMFATVGDTTRNGFGGR
FT                   GAASESVGAKRQFALHQGNTQHFDDLIVGPNLWAGMSQIRGGPGCVIVGSHEQVAERLA
FT                   EYVEIGVSTFILASNPHLEEAYRVGEEVLPLVDGALNARGTQAALRVAGA"
FT   gene            370774..371820
FT                   /locus_tag="Bcen2424_3532"
FT   CDS_pept        370774..371820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3532"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2606 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10271"
FT                   /protein_id="ABK10271.1"
FT                   /translation="MTTLAAQATACDALWYTRCPVPTALGIAVHRGWFDEEFGPDGIAL
FT                   HSLQETADADKRESHFDHSLPHSFRQGGNIPALWARARGADTRVIGLSWTNEFQAIVTL
FT                   PERGIRTARDLRGRRLGLPRHPISIDFWRAAALKGFLSALELEGLGHGDAEWVDLPDTR
FT                   ERHTGPASFTRGPHEYGLEIAALVRGDVDAVFVKGVAGLETVHLIDAQVVIDLGAHPDP
FT                   LVRIGNGTPRTLTVDRALIDARPDLVSRFLSVVVGAGDWAARHPAETVAYIGRETRASD
FT                   EWVRYAYGADVHRHLETGLAPTSIDGLVAFKDFLVEWGFLEHDFDARAWIDPAPFTQID
FT                   RHRHAWVA"
FT   gene            371854..372654
FT                   /locus_tag="Bcen2424_3533"
FT   CDS_pept        371854..372654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3533"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: bur:Bcep18194_B2605 TonB-like protein;
FT                   TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10272"
FT                   /protein_id="ABK10272.1"
FT                   /translation="MTGLTIEYGVPPARRHAARAAPRTVAAVARPPSLPPSAQVDARAA
FT                   PANGWRGAAAIALAIAALHAGVALLAARVPAAPPVQPPRPLPMTVELTRPPEPLPQAAH
FT                   PPPPVVSPKPLKQAPTPPKPRAAVPRPAPAATPQATREAAPAPAPATPAVAAPAAPVQA
FT                   PAPAPAVPVRETAPIGDAAYLRNPAPDYPAFAQDQGWEGRVVLRVHVLASGTPDSVEVR
FT                   TSSGRRLLDSAAVAAVKRWTFVPAKRGDEAVDGWVNVPIDFKLG"
FT   gene            372696..373412
FT                   /locus_tag="Bcen2424_3534"
FT   CDS_pept        372696..373412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3534"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   bur:Bcep18194_B2604 MotA/TolQ/ExbB proton channel; TC
FT                   2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10273"
FT                   /protein_id="ABK10273.1"
FT                   /translation="MNAIPTTFIVQGALWLLVVFSVVTWTLIVVKAIQSLRSSARNRRY
FT                   VSAFWAANSFHDAATLDGANSPVGELAATGFDALRRADESSAHDLEHSWSRHDLLERHL
FT                   RQQIHNARRREEAGLAVLASIGSTAPFVGLFGTVFGIIHALTAITHSASASIDVVAGPI
FT                   GEALVATGIGIAVAVPAVLAYNFFVRRVKAASADLDAFATDFVTLAQKAGFRVPAAVPA
FT                   ATPARRSDDTRQEAFA"
FT   gene            373412..373822
FT                   /locus_tag="Bcen2424_3535"
FT   CDS_pept        373412..373822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3535"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   bur:Bcep18194_B2603 biopolymer transport protein ExbD/TolR;
FT                   TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10274"
FT                   /protein_id="ABK10274.1"
FT                   /translation="MAFSSSSDNDDVLSEINITPLVDVMLVLLVAFIVTAPLLNNAVHV
FT                   NLPNTVATAPADRKPNVTVSVDGKGVVYLDKRAVALDTVPAELAALKAGRPDVALDLQA
FT                   DEHVPYGTVAKLMAAIEHAGITRLSVLTAPRG"
FT   gene            373859..374923
FT                   /locus_tag="Bcen2424_3536"
FT   CDS_pept        373859..374923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3536"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2602 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10275"
FT                   /protein_id="ABK10275.1"
FT                   /translation="MSTTASHNVQSIWYTRCPVPTPLGIAAHLGWLDHEFAGDGITVRA
FT                   LQESQHAALHHAHVDHSLDNAFRQGGSIPALWARASGADTRVVALTWVDEAQAIVALPE
FT                   AGLARPKDLRGRRIGLPRRDGERIDIFRAAALRGFVSALSLDGLGPGDVEWVDVPASNL
FT                   RAPVATPATRDAAFSHPASLSSRRLYAAEAAALVRGDVDAIYVKGSLGLETAHLIGAQP
FT                   VVDIGFHPDPQIRINNGSPRPLTVNASTLERHPDIVSRFLARVTDVEGWAREHEHEVLG
FT                   YLGRETGSGHDSLRLAYGVDVHRRLRTDLDEASIAALDDFKRFLVDWRFLPADFDVRAW
FT                   IDRRALDGIATLSR"
FT   gene            374920..376137
FT                   /locus_tag="Bcen2424_3537"
FT   CDS_pept        374920..376137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3537"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2601 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10276"
FT                   /protein_id="ABK10276.1"
FT                   /translation="MSTPARVADAWRRERFTGGFMLLALASGTTISMAQLATTLYALAL
FT                   GVDDARLGIIAAMEPLGIALMTLPAGLLVARYGARRVYFAASMGPMLLNLVVPFTGAWP
FT                   LIALTQGLIGLCIPFRIVSINGVFLARLAQIGLARAGWYRAAMSIGTGMVGPWLASGLI
FT                   GTHGAVATFCVASASFAGMALFSRGLLGEAAPPSPGASRRTGGLRALFALAWSRGIREQ
FT                   LVVEAVNSATRALVGTYTVVLAIQSLGLTQTRAVALLTLQGAVAVIALFGLGHVAQRMT
FT                   ERRCHALGLAGGMAGLLALGLGRDPWIVGAGLAALCAGSSLLHLVNMQHLGRHPADKSQ
FT                   VSSLYNLASMTGAFCGPLVGSALAPLVGLRAVFLCWLPVVVLVALALRLAHGRRGATQA
FT                   LPAKLS"
FT   sig_peptide     374920..375024
FT                   /locus_tag="Bcen2424_3537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.869 at
FT                   residue 35"
FT   gene            376333..378648
FT                   /locus_tag="Bcen2424_3538"
FT   CDS_pept        376333..378648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3538"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: bur:Bcep18194_B2600 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10277"
FT                   /protein_id="ABK10277.1"
FT                   /translation="MFRKKLIVTALGGLLTGGVVSSPAWAEDGAATAGAPDAKPAQQAS
FT                   DDAAAAAPKAVRADRGTAVRETNLGTVTVTARRRKERIQDVPVAVSALSGDAIKNNELR
FT                   VINDVTKYVPNFTGQSTEGRERPRWFLRGVGSNDPSDLSLSPIGVYFDDVYINSVFGQG
FT                   FPLFDLDHIEVLRGPQGTLWGKNTVGGALNITSQKPTFDVSGYGKLGFGQYNSRLAEAA
FT                   IGGPIGKNDVLAARVSVYHENADSFYTNTVQQGRFGGFHDNAVRFQVLAVPTSDTDFLF
FT                   NIHGRNYTGGGNAWHAEGAGRGGTNQFGFVGSSDPYTVSLNAPSSDHISTWGTSLTAHW
FT                   RINPAVSLTSITAFEGLHRWYQDDEDYSPFDAARSHDRLSSRQFSQEFRLESPQSDRLS
FT                   WIVGTHLFTEQLAEQGAGGGLPGSPSPAYYHLTDLTQHTQSAAIFGSVKYRFTDRFNVT
FT                   GGLRYTIERKTINLTGLQDTGNVTFSDPNSWWSPSSVSSPLAVSARQNQTNTWRAPTWD
FT                   LTPEYALSSNVRAYFRYARGFRSGGYNGNAYTQSTVSTVSPEYLTDYEVGIKSEWFDKR
FT                   LIVNASVFHYDYRDIQVFALAPNPFGGPPVSTLSNAGQGRADGFELELKAQPVNSLYLF
FT                   ANLGMLNTRYTEFRNVPTAVGNSFARSPHTTLNAGFDYRVPVSFGTLTAGGDVNYRSRE
FT                   YFSATRQTMPQLWQGGYTVLNAHVSYTTPNQKYIVTGYVTNLTNKVYKKLELLPSYGAY
FT                   PTLYGDPRTVGITLTAKI"
FT   sig_peptide     376333..376413
FT                   /locus_tag="Bcen2424_3538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(378721..379740)
FT                   /locus_tag="Bcen2424_3539"
FT   CDS_pept        complement(378721..379740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3539"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bur:Bcep18194_B2595 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10278"
FT                   /protein_id="ABK10278.1"
FT                   /translation="MHAWHLKPGDGIAGLGRIDATPRAVGPTDIVVKIHSAALNYRDLM
FT                   FARGDYLGIGKEALIPVADGAGEVVETGRDVTRFRPGDRVINTYFPRWIDGPPTPHKVS
FT                   GSPGAQFDGVLAERFVADETALVAIPPHLDYDEAATLSCAGITAWNALFVGGGLKPGAT
FT                   VVLLGTGGVSIIALQLAQATGLRTIVTSSSDAKLERARALGADATINYRTTPEWQHEVL
FT                   RLTGGAGADLVVEVGGRDTLPRSIAATKLGGIVSIIGGLSSFGGPVLDLLPLIGGVKQL
FT                   HGFMVGSRAMLDDVVRLVDAKRIKPVVDRVFGFDEAPQAYAHLQSGQHFGKVVIRVAS"
FT   gene            379867..380796
FT                   /locus_tag="Bcen2424_3540"
FT   CDS_pept        379867..380796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3540"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2594
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10279"
FT                   /protein_id="ABK10279.1"
FT                   /translation="MDERLRGVAEFVDVVESGSFAAAALRLGMTRSAVAKIVARLELRL
FT                   GARLLQRTTRQLGLTDEGLVYYEQCRRLLAELGETEAALDAGRREPAGRVRVSVPVLFG
FT                   RQCVAPVVRRLVERHPRLEIDMSFSDRVADLVNDGFDLAVRIGELADTSALVGRKLGVQ
FT                   RMGICASPAYLARHGRPSGLDELASHVGIAYSRGGQPTPWRVIGADGAVHDHRAAGRLR
FT                   FDDLQAIADAAAAGAGLAWLPCWLMAPYLRDGRLALVMDSNSVSGAEVFAVRPAARHVP
FT                   SKVRAVVDALVDEIPHMLASDDANGVRA"
FT   gene            380950..382257
FT                   /locus_tag="Bcen2424_3541"
FT   CDS_pept        380950..382257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3541"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2592 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10280"
FT                   /protein_id="ABK10280.1"
FT                   /translation="MTATAPQLHAATMRRLNLRLIPFLMLLYLVAYIDRSNISVAALQM
FT                   NADLGLSAEMYGLGAGLFYVTYILFEVPSNLFLARVGARRWIARIMITWGIVAAAMSAV
FT                   HTPGQLYAMRLLLGAAEAGFTPGIIYYLSAWYPQSDRARAMSFFYIGATLASVIGLPLS
FT                   GALLNLNGVLGVEGWRWLFLLEGVPALLLGFVVLRRLPDTPAHARWLPADERAWLEATL
FT                   RDGAPREHLSHGVALRRAFGDGKVWALAAFWLLQAFGTIGLTLFLPLLVKSLSGQSSFA
FT                   VGSLSALPFLFACVAMYLNGRHSDLGGERALHLGVPMLLAGALLVAAIYTPVLPVAYAL
FT                   LVFAVGLNWAATPVFWAVTTEYVSGLTAAASIALINAVANIAGLALPPVMGRIKDVTHS
FT                   YDLALLLVAVALLAGGVLALRIASRRAMPVAAGRVG"
FT   gene            382419..383138
FT                   /locus_tag="Bcen2424_3542"
FT   CDS_pept        382419..383138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3542"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: bur:Bcep18194_B2585 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10281"
FT                   /protein_id="ABK10281.1"
FT                   /translation="MSSRTYLVTGASRGIGLAISTTLARRGHRVVGLARHAQGIDFPGE
FT                   LLACDLADIEQTAATLARIGERHHVDGIVNNAGIVLPQPLGKIDFQSLQTVFDLNVRAA
FT                   IQVTQHFADAMKARGYGRIVNICSRAIFGSLDRTAYSAAKNALVGCTRTWALELAEHGV
FT                   TVNAVAPGPIETELFRQTRPVGSEAERKVLATIPARRLGTADDVAAATVFFLSDEAGFV
FT                   TGQVLSVDGGGSLGGRS"
FT   gene            383275..385245
FT                   /locus_tag="Bcen2424_3543"
FT   CDS_pept        383275..385245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3543"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bur:Bcep18194_B2584
FT                   sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10282"
FT                   /protein_id="ABK10282.1"
FT                   /translation="MKKSASPLHAFRFRVVCAAIAGAVSLASCGGVDSDAPPSQAGVTP
FT                   TPTPTQAAKRPNILYIMADDLGYSDIHAFGGEINTPNLDALVASGRILSNHHTGTVCAI
FT                   TRAMLVSGTDHHLVGEGTMGVPTDERRGLPGYEGYLNDRALSFAQLLKDAGYHTYIAGK
FT                   WHIGSGIVGSATGSGQTPDQWGFERSYVLLGGAATNHFAHEPAGSSNYTEDGRYVQPGQ
FT                   PGQPGGTGGSPAVFYSTDFYTQKLISYIDANKQDGKPFFAYAAYTSPHWPLQVPDPWLH
FT                   KYAGVYDAGYDAIRNARIARQKALGLIPADFKPFDGLPETTVASPATANNGTASAKYIN
FT                   AVHSAADGYSDYGPGKVDKLWSSLSPAERKAQARYMEIYAGMVENLDYNIGLLIQHLKD
FT                   IGEYDNTFIMFQSDNGAEGWPIDSGADPTATDTANAQEPTYSALGTDNGKQNAQRLQYG
FT                   LRWAEVSAAPFRLTKGYSGEGGVSTPTIVHLPGQSQSLPTLRAFTHVTDNTATFLAVAG
FT                   VTPPSQPAPPLVNTLTGVDQNKGKVIYNNRYVYPVTGQSLLPVLTGSATGEVHTTPFGD
FT                   EAYGRAYLRSADGRWKALWTEPPLGPLDGHWQLYDLASDRGETTDVSAQNPSVIGTLVD
FT                   QWKTYMGNVGGVEPLRPRGYY"
FT   sig_peptide     383275..383379
FT                   /locus_tag="Bcen2424_3543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.730 at
FT                   residue 35"
FT   gene            385261..386310
FT                   /locus_tag="Bcen2424_3544"
FT   CDS_pept        385261..386310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3544"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   bur:Bcep18194_B2583 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10283"
FT                   /protein_id="ABK10283.1"
FT                   /translation="MRLRFWTIGAALAATLFAAAFAAGYANPAAPADGAFDDLNRGRAL
FT                   APLGSERQCERYSGLPSKWRDDPQAGMVHLRGGAFVFGSTRGYADERPVGDGKTRVGGF
FT                   WIDQTDVTIAQFAAFVQATGYVTEAEQQGGAAVFHVPTRDELNARDLAWWSWVKGASWR
FT                   HPHGPGSDVEGLGNLPVTLVTQRDALAYARWLGRDLPTEAEWEYAGKAGRDDASLDAAP
FT                   RDAQGKPAANYWQGAFPVLDSAEDGHAGLAPVGCYAANGFRLYDMIGNAWEWTKDAYTG
FT                   PHQSHTNGDTAAVAPPTRRHDTPMVIKGGSFLCSRDYCVRYRASSREQQEADLGASHIG
FT                   FRTILRDAS"
FT   sig_peptide     385261..385329
FT                   /locus_tag="Bcen2424_3544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 23"
FT   gene            386307..387119
FT                   /locus_tag="Bcen2424_3545"
FT   CDS_pept        386307..387119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3545"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bur:Bcep18194_B2582
FT                   NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10284"
FT                   /protein_id="ABK10284.1"
FT                   /translation="MTARIGRFMAAWLLAACGVVLHGAAVAAEAAAPAVRVGVTRGVHA
FT                   QILDEVKRVAAARGLSVDVVEFDNASRIDTALADGRIDAASFEDAQQLAATRARKRYAL
FT                   TEVAPTVTLPMAFYSRQLKNLNELQPGATVALPADPRGMARALVLLQNDTLVTLREKAG
FT                   LHATLRDVTGNRLGLKFVALRRDRLYAALDTAAFVAIDSDDAARFGLQPARDSISLEDA
FT                   RSPYANVLTVRDADRAKPWVAQLVAAYHSDDVARFILTRYQDSVRRPW"
FT   sig_peptide     386307..386390
FT                   /locus_tag="Bcen2424_3545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 28"
FT   gene            387113..388099
FT                   /locus_tag="Bcen2424_3546"
FT   CDS_pept        387113..388099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10285"
FT                   /protein_id="ABK10285.1"
FT                   /translation="MVDTYLLACNACGRCCNSAPTLSLRELFRHRHRFVGALTIRRVPK
FT                   RRIGERWQAGGREHVLDADDVAAIDALADRLFHRGGGVQGEWLALTLQGYDYPSLGRCA
FT                   ALADDGRCSVHANKPSICGAVPLDPMLPDRLQARVLAARRDDAAWLGANCIVEAGHARS
FT                   ADESVFPIPLVTAGQVADRAALDAHREALVFERAVWRDAVFASLADGGPGVSRALSRLA
FT                   PGGYLTVSIVPVLLAVAQVSAHCRALCVDFIDAQLTLIGANVEAALARRQAADRPATHE
FT                   LRGFAQALGRARQALAAMPAPAATAHEDASRIDAWLDDRADAAPLAA"
FT   gene            388165..388491
FT                   /locus_tag="Bcen2424_3547"
FT   CDS_pept        388165..388491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10286"
FT                   /protein_id="ABK10286.1"
FT                   /translation="MYASTFIFRAGQYDDEFHRLDRQIADMARATPGYLGEETWENAEA
FT                   GLIQNVYYWESEAALRQLMQHPAHLEAKAKQARWLDGYRVVISQVLREYGDGKLTPPHA
FT                   GPSA"
FT   gene            complement(388506..389426)
FT                   /locus_tag="Bcen2424_3548"
FT   CDS_pept        complement(388506..389426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10287"
FT                   /protein_id="ABK10287.1"
FT                   /translation="MQIRSASPRLNLARVVIVALYVASLLLPVAAEPPNAAGAVSWWHG
FT                   YTVLVLGPLAILDLQFAWLGNPLLVVALLRPSRTVSALLAVVVVFALGWHTIPTDANYE
FT                   TIRTFGAGYYLWMAVMVGAAALPWIDGRGSQDDGAPSLGVGTAAGAVPTGTGTGTGTGT
FT                   GTGAVTGSPARPHAAPSSPRPPARQSGWTVTATDTRIEATDGTGAMRGIALSDLGAIVI
FT                   ETNDQGPFASDIWWILFDTNKQFACAFPQDAEGAKAAVDRLLDLPGIDHRKVIDAQTSI
FT                   QNATFPIWARAAGEPATPGETGATA"
FT   sig_peptide     complement(389331..389426)
FT                   /locus_tag="Bcen2424_3548"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.626 at
FT                   residue 32"
FT   gene            complement(389582..390514)
FT                   /locus_tag="Bcen2424_3549"
FT   CDS_pept        complement(389582..390514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3549"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2577
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10288"
FT                   /protein_id="ABK10288.1"
FT                   /translation="MNTRFLETFVTLAKLRNFRTTAAALHATPAAISQRLKALEDELHT
FT                   VLVDRDSREFRLTPNGEYLLGYAKAVVEATQELQAAASGESALRGKLRLGVIETVVHSW
FT                   LPHYMRRLAADYPELEIDLTVDVSVVLQRRLMAGELDLIIRVEGSDEASVVCDALANYP
FT                   VRWIARAGLLPNTRAGVARQVLRQPILTYGRGTAPHRALEDIVRTLAHAHGVPLSETRI
FT                   TGSPSISVIVQLVRDGFGVAAIPVLFVDALIESGEVVELPLQPSPPSIVVSMSRRADAP
FT                   RFVHGASIAARAACHEYCEKSTRLLVEAL"
FT   gene            390721..391494
FT                   /locus_tag="Bcen2424_3550"
FT   CDS_pept        390721..391494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3550"
FT                   /product="protein of unknown function DUF1445"
FT                   /note="PFAM: protein of unknown function DUF1445; KEGG:
FT                   bur:Bcep18194_B2576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10289"
FT                   /db_xref="GOA:A0AY13"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AY13"
FT                   /protein_id="ABK10289.1"
FT                   /translation="MTPSEFRQSVRRGAFRGPTAGHCGPFAQANLAILPDAYAHDFLRF
FT                   CQANPKACPLLGVGEPGAFRIDALGDDLDIRTDVPSYNVYRDGRLTERVESLDALWRDD
FT                   FVVFAIGCSFSFEDMLAREGIGLRHVEEGCNVPMYRTSIANRRAGIFGGQLVVSMRPLR
FT                   GADAIRAVQITSRFPGVHGAPIHIGDPRALGIEDLNAPEFGDAVTIRDGELPVFWACGV
FT                   TPQTALMDAKLPIAIAHTPGHMLMTDITNASLAVF"
FT   gene            391581..392879
FT                   /locus_tag="Bcen2424_3551"
FT   CDS_pept        391581..392879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3551"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B2575
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10290"
FT                   /protein_id="ABK10290.1"
FT                   /translation="MESKTLAAPAAEPASRERTGLFSWYADAQPRERRAFWSCKVGYML
FT                   DGMDTQMLSFVIPTLVATWGISLADAGFIGTITLLASALGGWIAGILSDRIGRVRTLQL
FT                   TVLWFAVFTALCGLAQNYHQLVAARALMGFGFGGEWTAGAVLIGEVIRARDRGRAVGLV
FT                   QSGWAIGWGLCALLYALLFSVLPAEQAWRALFLVGLAPALLVVAIRRYVKEPDVYEKEK
FT                   AAQAKVADAPRLTEIFAPKLITTTLRAALLTTGAQGGYYAITTWLPTFLKTERHLTVMG
FT                   TGGYLAMIIFGSWVGYLTSAYLTDRLGRKPNFILFAVGSMVIAFAYTSLNLTNASMLWL
FT                   GFPLGFFASGIFSGMGAFLTELFPTRVRGSGQGFCYNVGRAIGALFPFLIGALSKQYGL
FT                   GTSIGIFAVAAYGVVIVAALTLPETRGRELDAA"
FT   gene            393007..396645
FT                   /locus_tag="Bcen2424_3552"
FT   CDS_pept        393007..396645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3552"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase; Hydantoinase
FT                   B/oxoprolinase; Hydantoinaseoxoprolinase domain protein;
FT                   KEGG: bur:Bcep18194_B2574 5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10291"
FT                   /protein_id="ABK10291.1"
FT                   /translation="MTDRHLSPVPSDTARWQFWIDRGGTFTDIVARRPDGTLVTHKLLS
FT                   ENPEQYRDAAVAGIRHLLGLAADEPITPAQVDMVKMGTTVATNALLERKGERTALATTR
FT                   GFRDVLRIAYQNRPRLFDLDIVLPDALYETVVEIDERVGAHGDVVVPLDVQGAEASLRR
FT                   VFDSGVRALAIVLIHGYRYTAHERMLAELARRIGFTQVSVSHEVSPLMKMVSRGDTTVV
FT                   DAYLSPILRRYVEQVAHEMPGVNLQFMQSSGGLTRADAFQGKDAILSGPAGGIVGMVRA
FT                   ARAAGFGQVIGFDMGGTSTDVSHYNGEFEREFETQVAGVRMRAPMMSIHTVAAGGGSVL
FT                   GFDGARLRVGPESAGANPGPAAYRRGGPLTVTDCNVMLGKIQPDHFPRVFGPHADQPLD
FT                   RDGVVAKFAALADEIHAATGRRETPEALAEGFLEIAIGSMANAIKKISVQRGHDVSRYV
FT                   LTTFGGAGGQHACGVADALGMTQVFAHPLAGVLSAYGMGLADQTAMRERAVEAVLSDAS
FT                   LPALNAALDRLADEAIGALLEQGVPPERIATERRVHLRYQGTDSALDVPAGSVAAMQQA
FT                   FEAAYRQRYAFLMPGTPLVAELASVEAIGRSDAPVDIAPLAPREAGAAPQAHAAVRFYS
FT                   GGQWHDAALVVRDTLRAGDTIDGPAIVAEQNGTTVVEPGWRAAMTAQGNLVLTRTTPLP
FT                   TRRSLGTDADPVRLEIFNNLFMSIAEQMGLRLQNTAYSVNIKERLDFSCAIFDGDGNLI
FT                   ANAPHMPVHLGSMGESIRTVIERNRGRMRDGDVFMLNDPYHGGTHLPDVTVITPVFADG
FT                   SDAPLFYVGSRGHHADIGGTTPGSMPPDSTHIDEEGVLIDNWQLVSAGVLRDADTRALL
FT                   ASGRYPARNVEQNMADLRAQVAANQKGVDELRRMVAQFGRDVVLAFMGHVQDNAEEAVR
FT                   RVIGALQDGAYRYPLDNGAEIRVAIRVDRAARRAEIDFTGTSAQLDNNFNAPKAVCMAA
FT                   VLYVFRTLVGDDIPLNAGCLKPLTVIVPARSMLNPEYPAAVVSGNVETSSAITNALYGA
FT                   LGCVASSQGTMNNFTFGNDQYQYYETIAGGSGAGDGFAGVGAVQTHMTNSRLTDPEVLE
FT                   WRYPVRLDSHVIRAGSGGGGRWRGGDGAVRRVRFLEPMTASILSNNRIHAPFGAAGGAA
FT                   GALGRNTIERADGTVEVLDHIGRAQMAPGDVFVVETPGGGGYGAAD"
FT   gene            complement(396731..397021)
FT                   /locus_tag="Bcen2424_3553"
FT   CDS_pept        complement(396731..397021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10292"
FT                   /protein_id="ABK10292.1"
FT                   /translation="MRAILSNDDEDWHSHLEQSVKESGLDWQAGFFMIGSGECAGDAAR
FT                   IRGGQTARKPCRAGVYDRSTDKGPDTRTRRRGGVELRIARRFFVIFDSIRA"
FT   gene            397216..399219
FT                   /locus_tag="Bcen2424_3554"
FT   CDS_pept        397216..399219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3554"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   KEGG: bur:Bcep18194_B2573 diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10293"
FT                   /protein_id="ABK10293.1"
FT                   /translation="MDDENDSAVLEAHVGTRSPCWRLGSDSNALELAAVRGLTNVAVAL
FT                   TVEQAARIRALTGVTSHLVLDIVLFGNPVSLHLVGRKVNTVDWAGTASAYCDTESVAGD
FT                   LAHGLAFAEQVVSEVNSLVVILDRNGMVQRFNRLCEEVTGKREVDVIGRSAFELFMSPE
FT                   QGAQSRSNITGFFASNQSFAVERYINTVNGPRLFQFRNKFVQSGSGVDEQYLICSGIDI
FT                   TEERNAQQRLTELANTDVLTGLPNRHAISERIHAAIAEEDANTRGHVGILFLDLDNFKR
FT                   VNDHYGHITGDRLLQDVSAIISGCLPSGATLARLGGDEFLVLFEHATRPLLEATAQIIL
FT                   ERLRTPIHLGLMEVYTSCSIGIAMHPQHGDSLETLIRSADTAMYVAKEEGKHTYRVFSL
FT                   EMNQKVAKYMWLDTNLRKALEEEQFVLHYQPVVDIATGDVHAVEALIRWQSPDRGLVAP
FT                   VEFIRFAEESGLIAPLGRWVMRTAAAQAAAWKAKGLGVRIAVNLSARQLQDMNIVHQFA
FT                   SILDGAGLKPGLLDIELTESCFIEDEEAANGLMRQFRQLGAEIHLDDFGTGYSSLSQLS
FT                   RLPLDAIKLDRTFITAIDRNPRSQALVRSVVSLAKALNFAVVAEGVETHAEAEFLKQLD
FT                   VDHAQGYYYARPMPAQAFEAWLAETRKLRLIA"
FT   gene            complement(399268..400131)
FT                   /locus_tag="Bcen2424_3555"
FT   CDS_pept        complement(399268..400131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3555"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bur:Bcep18194_B2572 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10294"
FT                   /protein_id="ABK10294.1"
FT                   /translation="MQLQSHPACRPFYEAGELSQLTAFYEEGRNVMWMMLRSEPRPCFN
FT                   QQLVTDIIHLARVARDSGLKFDFWVTGSLVPELFNVGGDLSFFVDAIRSGRRDQLMAYA
FT                   RSCIDGVYEIYTGFGTGAISIAMVEGSALGGGFEAALAHHYVLAQKGVKLGFPEIAFNL
FT                   FPGMGGYSLVARKANRGLAESLIATGEAHAAEWYEDQGLIDETFDAGDAYLATRTFIDV
FT                   TKPKLNGIRAMLRARERVFQLSRSELMDITEAWVHAAFTIEPKDLAYMERLVMLQNRRV
FT                   SKLRTV"
FT   gene            complement(400490..400762)
FT                   /locus_tag="Bcen2424_3556"
FT   CDS_pept        complement(400490..400762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10295"
FT                   /protein_id="ABK10295.1"
FT                   /translation="MTGRSRAPARVAVVRPSVGDGLASVKPRQREGHLTPIGDAFETGD
FT                   RVMAFAWLRVILSGTLPTVLHLERRHPKPIDAERPCAPRIPSRSR"
FT   gene            400840..402756
FT                   /locus_tag="Bcen2424_3557"
FT   CDS_pept        400840..402756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10296"
FT                   /protein_id="ABK10296.1"
FT                   /translation="MVRFHSRWTGCLLVCAVALGAGRAVADTRDSHDTPDARDAADMAP
FT                   VTLVSDVHEFVIQHDGSLDEHDDSTLRANDANGIDAVAQRYVWFDKHLEKVELLAAETI
FT                   DRDGVAHPVGADGIRDVQEPRSAGAPTFQDGLLRTVVFPGVEAGSSTRVAFRKTRTKPV
FT                   NRGYFGYTVEPSREPVDSQRLIFDVPADMPLYADARGYVALPPVTANGRTRYEFDYRHG
FT                   AYDRIESGSVGYPTYGDRLVVSTLPDYAAFAARYRNAAVDPSANDAAVVQLARALTANA
FT                   ADPRDKARILYDWVQANVRYVGLFLGETAAAPHRVTDILRNRYGDCKDHVALFGALLAA
FT                   VGIRSEPVLINLGAVYTLPSVPGYGAGAINHAITWLPDLALYADTTTAGIAFGYLPPIV
FT                   MDRPALLVDTGVLSRTPATQPRARTARISIDAAQPGAARVQAYVEDDGWTAELERNLFR
FT                   RASRERIAQLATERLRQSGLRGRAQLSTSDRRATDGPFDVTVTGTLDHFVWPDGTTALP
FT                   ALSSVTGGIATQVETWLAEPVRTQPWGCIGGAFDETGQIALPTGVVVTDLPADTAVHDR
FT                   FVDFTSHYVFDAAARVVQVTRRMNADFGRQVCTPDEFAALRASLERIERDTQAQIVVRA
FT                   KQR"
FT   sig_peptide     400840..400920
FT                   /locus_tag="Bcen2424_3557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            402826..402990
FT                   /locus_tag="Bcen2424_3558"
FT   CDS_pept        402826..402990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10297"
FT                   /protein_id="ABK10297.1"
FT                   /translation="MTERDHEIAELSKELLGRIVQGTVATGAAVDVEQCAALAVQCATA
FT                   LIDRLDALK"
FT   gene            complement(403034..404083)
FT                   /locus_tag="Bcen2424_3559"
FT   CDS_pept        complement(403034..404083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3559"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bur:Bcep18194_B2564 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10298"
FT                   /protein_id="ABK10298.1"
FT                   /translation="MTYNPFLLIERPYLDMSEPLLPPIPDVHDLVSELLLGMRLSGVQY
FT                   RRIQVARPFGLSFGHGTGRAQFHFIVRGPVLLRDATGETMRLEAGDAILLPHGGMHALV
FT                   SDPDVPCREIDGFEVAKICDTVASVASAGVSPTSCATKEPGAGDALIFSACMELDLGGM
FT                   QPLVGTMPAFMHVGTLLARYPEIRPMLDAMEREACTARAGFAGILARLADVVAAFIVRG
FT                   WVECGCGDATGWVQALREPKLGRAIVALHRDPGRNWSVAELATEAGVSRSVFAERFLAA
FT                   TGMTPVRYLTELRMRLAAQWIARDRETIEAVAYRLGYGSLAAFSRAFKRVVGKPPGAVR
FT                   ADGDVPAEA"
FT   gene            404155..405357
FT                   /locus_tag="Bcen2424_3560"
FT   CDS_pept        404155..405357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3560"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2563 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10299"
FT                   /protein_id="ABK10299.1"
FT                   /translation="MNPGISSAASTAAPREPAWGAVFAMTLGVFGLVTAEFLPASLLTP
FT                   MADSLGVTEGVAGQAVTATATVALVTSLLISALTRTIDRRRVLLVFSVLLVVSNLTVAF
FT                   APNLAMLLFGRVVLGIALGGFWTMATATAMRLVPTAMVPRALSIIFSGVAVATIASAPM
FT                   GSYFGHLIGWRNVFLIAAVIGGIAFVSQIVTLPSMPPSGTTRLRTLIDVLRRPTVGLGM
FT                   FATILVFTGHFAFFTYLRPFLEQVAGVGVNGLSAILLGYGIANFVGTSLAGRVLEHRLR
FT                   PMLIGMPALMVVLGIALVVLGRAPMIDAVLVALWGMAFGGVPVAWSTWVTRTVPDEAES
FT                   AGGLIVAAIQLAIATGAAAGGVVFDANGAAGVFVGAAIVLAVAVATIVTGVPKRVGVVA
FT                   S"
FT   sig_peptide     404155..404217
FT                   /locus_tag="Bcen2424_3560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.764) with cleavage site probability 0.755 at
FT                   residue 21"
FT   gene            complement(405414..406292)
FT                   /locus_tag="Bcen2424_3561"
FT   CDS_pept        complement(405414..406292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3561"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mlo:mlr2172
FT                   probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10300"
FT                   /protein_id="ABK10300.1"
FT                   /translation="MPDIRHTATFRLGDRHVRRIGYGAMQLAGPGVFGPPKDREAALNV
FT                   LREAVESGVDHLDTSDFYGPHVTNQLIRDALHPYRDDLVIVTKIGARRGDDASWLPAFA
FT                   PDELERAVHDNLRNLGLDVLDVVNLRIMFDTHGPAEGSIEAPLATLAELQRRGLVRHIG
FT                   LSNVTPAQVAQGRRICDIVCVQNHYNIAHRGDDALIDTLARDGIAYVPYFPLGGFSPLQ
FT                   SSTLSGVAARLGATPMQVALAWLLHRAPNLLLIPGTSSAAHLRENLAAADLDLPADALA
FT                   ALDRIAGAGAA"
FT   gene            406394..407293
FT                   /locus_tag="Bcen2424_3562"
FT   CDS_pept        406394..407293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3562"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: ret:RHE_PC00205 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10301"
FT                   /protein_id="ABK10301.1"
FT                   /translation="MQTDLGDLNAFMAVARASGFRDAARVTGLSASGLSEAVRRLEARL
FT                   GVRLLHRTTRSVVPTEAGERLLARLAPALTEVAAALDGIDEFRGRPAGTLKLNVPVSAS
FT                   RLVLPAIVPRFLDAYPDIRLEVTADESFVDVLAAGCDAGIRYDERLEQDMIAVPIGPRI
FT                   QRFATAAAPDYLDRHGRPRHPRDLLGHRCMRGRFASGAMPPWEYERDGEVVRVEPAAGP
FT                   LLVQIGGATELMVDAAIAGTGILYLFEDWVRPHFDSGALEPVLEPWWRPFSGPFLYYPG
FT                   RRLVPPALRAFIDFIKVS"
FT   gene            complement(407493..408371)
FT                   /locus_tag="Bcen2424_3563"
FT   CDS_pept        complement(407493..408371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3563"
FT                   /product="PEP phosphonomutase"
FT                   /note="KEGG: bur:Bcep18194_B2560 PEP phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10302"
FT                   /protein_id="ABK10302.1"
FT                   /translation="MRTFCHTLSADIAYAGRTARFDGNIARHDNRSGIHEETSMGNNEK
FT                   GAIFRSLHRAGQPLALFNVWDAGSARAVADAGAAALATGSWSVAAANGFGDGEQMPRAL
FT                   MMEMLERIVRATDLPVTVDLESGYGERPEEVAETIALSIRAGAIGCNLEDSFPSTGELR
FT                   DVDDAAARVAAARQAADRAGADYFINARTDVFFTAAADTHDERLLDATLARASAYAAAG
FT                   ADGLFVPGLRSPALIRALTAASPLPVNVMRVAETPTLAELAEYGVARVSHGPYPYLQAM
FT                   KALAALVKQGG"
FT   gene            complement(408401..408868)
FT                   /locus_tag="Bcen2424_3564"
FT   CDS_pept        complement(408401..408868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3564"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; transcriptional
FT                   regulator PadR family protein; KEGG: bur:Bcep18194_B2559
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10303"
FT                   /protein_id="ABK10303.1"
FT                   /translation="MARKEKLPFETTLMVRDCCLCLHMQRAARNLARIFDDVLRPLDLT
FT                   NGQFSLLMSLNRPQPAPMKSVASLLAMDRTTLTAALKPLERRGLVTITQDPDDRRSRLL
FT                   ELTPAGHELLAEAFPLWQQTHAEIERPFAPGEVDQLRGQLRTLSIEPGSRD"
FT   gene            408950..409318
FT                   /locus_tag="Bcen2424_3565"
FT   CDS_pept        408950..409318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10304"
FT                   /protein_id="ABK10304.1"
FT                   /translation="MSAQQQLYLAVFLGTRDSPAMKAWMALPEDERRTRERDGIAAWHA
FT                   WVERHRDAIVELGGPLGKTKRIDASGIHDTTNALSGFTVVRAASHEAAAALFEGHPHFT
FT                   LFPGVSVEVMPVLAIPGA"
FT   gene            409358..410032
FT                   /locus_tag="Bcen2424_3566"
FT   CDS_pept        409358..410032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3566"
FT                   /product="Glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, C-terminal domain;
FT                   KEGG: bur:Bcep18194_B2557 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10305"
FT                   /protein_id="ABK10305.1"
FT                   /translation="MCHARHAADIFTTFWMETGDEALRICRHPLAAGAVGAEGTGCGFR
FT                   IRIGQPARGRAQAARFPAPESGRQGAGAGGRRPRDSRIGRDRAVSRGQVPGEGAAARRS
FT                   GAAGAAYRWIMFAVTELEQPLWRITRHTFLYPPEKRSPADIELAREDFMTMAAILDTHL
FT                   EGREFIVGDSLTVADCVTAYLIDWASECHLIEPFPQLRAYLERLYARPKAPQRIADARK
FT                   AA"
FT   gene            complement(410093..410815)
FT                   /locus_tag="Bcen2424_3567"
FT   CDS_pept        complement(410093..410815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3567"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: bur:Bcep18194_B2556 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10306"
FT                   /protein_id="ABK10306.1"
FT                   /translation="MRLAKVSALSFDLDDTLWPFGPSVVRAEATLRTWLIEHAPNTASV
FT                   LPTQQALSALREEYERLRPDLASDYRAMRIGSIRLALERANEDVSLTESAYDVFYAARN
FT                   RVEFYEDALPALAWLSARFPLIAVTNGNADLRLTGGGEFFRTTLSARAFGFAKPEPEIF
FT                   HAAADALGVRPAELLHVGDDFHLDIVGALNAGLQAAWVVREPRADGEPAPPQAATPHLT
FT                   LRDLAMLCRALGGPDTVS"
FT   gene            complement(410840..411811)
FT                   /locus_tag="Bcen2424_3568"
FT   CDS_pept        complement(410840..411811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3568"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bur:Bcep18194_B2555 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10307"
FT                   /protein_id="ABK10307.1"
FT                   /translation="MPTDARLLLLDRDAVEPALQTEQVMAAVREAFVLHSRRAGRVFPV
FT                   VREKLHTGGVFGIKSGDVAGQDLLGFKAAGFWPANRTVGGEPHQATVALFDPATGRPLC
FT                   IMDGNAITTARTGAAGGLGLQQLARRDSTRLCVFGTGVQARVQLDYALALLPRRCTVQY
FT                   VTVSGESDPAFESRFVERCTIGVARDRNEAVADSDVVITATPGGGPLFDADAVQPGTHL
FT                   TCVGADTAGKRELPAGVLERARIVVDDHDQARSIGECQWAPDLPRTEIGDILAGATSVE
FT                   RAAHEITVFDMTGLALQDLTVARFLYRHALDNGSGTSVPWPW"
FT   gene            complement(411918..413045)
FT                   /locus_tag="Bcen2424_3569"
FT   CDS_pept        complement(411918..413045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3569"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bur:Bcep18194_B2554 alanine racemase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10308"
FT                   /protein_id="ABK10308.1"
FT                   /translation="MDLHTLNTPAALIDIDRMQRNIARMQTHLDALGVRFRPHVKTTKC
FT                   RHVVDAQIAAGAQGITVSTLKEAEQFFAHGIRDIVYAVGMVPAKLGQALALRRQGCDLK
FT                   IVADSLPAAHAIAAFGREHGERFDVWIEVDVDGHRSGIPPDADLLIDVGRALTDGGMLL
FT                   GGVLAHAGSSYEYDAPEALAAIAEQERSRTVRAAERLRTAGLPCPVVSIGSTPTALAAE
FT                   RLDGVTEVRAGVYVMFDLVMHNVGVCELSDIALSVLTTVIGHQEEKGWAIVDAGWMAMS
FT                   RDRGTQRQARDFGYGQVCTEAGDVLGDYLLSAANQEHGIVSRAGTPDTGIAQRFPIGTR
FT                   LRILPNHACATGAQHPDYQAGDDGAAQTWPRFYGW"
FT   gene            complement(413147..414106)
FT                   /locus_tag="Bcen2424_3570"
FT   CDS_pept        complement(413147..414106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3570"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2553
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10309"
FT                   /protein_id="ABK10309.1"
FT                   /translation="MLDTLCIKSQEMLDLDDLRLVRAIGTSRSLAAAARLLDLTPPAVT
FT                   IRLQRMEARLNARLAVRQPKGIALTDEGQRLYQEAVGILERVEALPINIAGDHGDVQGT
FT                   LRVVAPLGFGRKYVARIVRDVQRAHPKLEISLHLSESPLTTASGADVVVHVGSLKSSSW
FT                   IGYPLAPNERFLCASPGYARRLKDLNHPSDLTRYDCLCLRENDEDIPRWRFSPGRGVKG
FT                   ESRRSTVIRVTGALSSNDGTVITEWALAGLGIVERSEWDVAPLLANGKLVRLLPGWSLP
FT                   PAPVTALLPSRTGRSARQRVFLDAARQFLDPPPWRGKA"
FT   gene            complement(414231..415145)
FT                   /locus_tag="Bcen2424_3571"
FT   CDS_pept        complement(414231..415145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3571"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: HI0933 family protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG:
FT                   bur:Bcep18194_B2548 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10310"
FT                   /protein_id="ABK10310.1"
FT                   /translation="MDTHHEVIVIGGSFAGLSAAMQLARARRRVLVIDAGRPRNRFAEH
FT                   AHGFFGQDGKPPARIVAEASAQLAAYPTVQRIDGEARTAERDAHGRFHVTLADGSRASA
FT                   DRLILATGIRDELPALPGLAERWGISVLHCPYCHGYEVSGQRLGVLATHPLSVHQAILI
FT                   PDWGPTTWFTQGVVEANDEEAALLAARGVRIERSPVVEILGDAPRIDALRLADGQAVPI
FT                   DALFIGARTDMASDLAQQLGCAFDEGPLGTAIRVDTWKQTSVAGVYAAGDASSLMTNAT
FT                   FASASGVAAGVGVHRSLIFGLDA"
FT   gene            415247..415726
FT                   /locus_tag="Bcen2424_3572"
FT   CDS_pept        415247..415726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3572"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix, type 11 domain protein; KEGG:
FT                   bur:Bcep18194_B2547 transcriptional regulator, BadM/Rrf2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10311"
FT                   /protein_id="ABK10311.1"
FT                   /translation="MQLQKFRERGAPPVRTDSRLSRMLHALIHMDQADGPLTSETIATM
FT                   LCTNPVVVRRLLGGLRDCGYVQSEKGHGGGWALSVALDDITLLDVYRAVGEPPLFSDLV
FT                   PEDEPECLVEQAVNAHLSATLKEAEASLLARFGEVTLGMLSRDFEAKAALRGYTR"
FT   gene            415988..416578
FT                   /locus_tag="Bcen2424_3573"
FT   CDS_pept        415988..416578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10312"
FT                   /protein_id="ABK10312.1"
FT                   /translation="MPESNLSFFGRLSLAVGTFFSVLGNREFAADVLRVRDGASAPVAP
FT                   VPTPAPAAAPVAPAPVKAPAPELREASPQAALQLLGLLQRDARFIDFVEEDIAGYADAD
FT                   IGAAARLVHDGCRAALREHFTIVPVRDEAEGSRVTLPAGFDATAVRVTGNVVGSAPFTG
FT                   TVSHRGWRVSDVRLPKLTGSHDASVIAPAEVEL"
FT   gene            416575..418416
FT                   /locus_tag="Bcen2424_3574"
FT   CDS_pept        416575..418416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3574"
FT                   /product="molecular chaperone-like protein"
FT                   /note="KEGG: bur:Bcep18194_B2545 molecular chaperone-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10313"
FT                   /protein_id="ABK10313.1"
FT                   /translation="MSDPRYSIGIDLGTTHCALSYVDSSTSDGEKIVQQVLPIAQLTAP
FT                   GALESRDLLPSFLYLPHESELTQGDLTLPWTASRAFAVGEMARTRGAGTPIRLVSSAKS
FT                   WLCHPGVDRRAAILPSDAPPEVARVSPLESSIRYLTHLREAWDHAHPDAPFADQDVTVT
FT                   IPASFDPAARELTAEAARAAGYTRMTLLEEPQAALYSWIQKSEGGWRKQVQVGDLILCV
FT                   DVGGGTTDLSLIAVVERDGNLELHRVAVGEHILLGGDNMDLALAHVVARKLAQQGTQAD
FT                   PWQLRALTYACRSAKETLLSDPTTDAVPLVVPSRGSKLIGGSIRTELTRAELTQTILEG
FT                   FFPQVDAAARPVSRARVGLTQLGLPYAQDAGITRHLAAFLGRQVAALDTLEGVQRTLPQ
FT                   GATFLHPTAVLFNGGVFKSTLLTQRVLDTLNNWLAAEGAPPARLLEGADLDLAVARGAA
FT                   YYGYVKRGRGVRIRGGTARAYYVAIESAMPAVPGLEPPVQALCVAPFGMEEGSDAALPP
FT                   QEFGLVVGEPVQFRFFGSSVRRQDQVGTLLDYWSPEELQELEEIQATLPAEGRTVGEVV
FT                   PVKLHARVTEAGTLELEAIPSGTNERWKVEFDVRGAA"
FT   gene            418422..421178
FT                   /locus_tag="Bcen2424_3575"
FT   CDS_pept        418422..421178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3575"
FT                   /product="molecular chaperone-like protein"
FT                   /note="KEGG: bur:Bcep18194_B2544 molecular chaperone-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10314"
FT                   /protein_id="ABK10314.1"
FT                   /translation="MKRYTVGIDLGTSNTVVAYVEAGSDAIRVFDVEQLVGPGAVAAQP
FT                   LLPSVRYHPAAGELPPDALRLPWAADPKVNTKANAADAPPAVIGRYARTLGAQVPGRLV
FT                   SSAKSWLSHAAVDRLAAILPWGAADGVDKVSPVDASASYLAHVRDAWNARFPDAPLAQQ
FT                   DVILTVPASFDDGARALTVEAARRAKLPALRLLEEPQAAFYDWLYGQRDTLRETFTVAR
FT                   RVLICDVGGGTTDLTLVDVAPGDDGEPTFTRVGVGNHLMLGGDNMDLALARLVESRLTE
FT                   PGTRLSAASLSQLVERCRAAKERLLGDDAPASVTVTLLGAGSKLVGGARSAELTRQEVE
FT                   QIVVDGFFPQVEAGELPRRARAAIVEFGLPYASDAAVTRHVAAFLKRHAEGPLPDTLLL
FT                   NGGVFRAGALAGRLAQTLGTWRGAPLDVLHNAHPDVAVARGAVAYGLARAGHAPRIGGG
FT                   SARSYFLVLDDGAEGAVARGVCLLPRGAEEGREIHLDDRTFALQLGQPVRFHLVSTVAD
FT                   TKYQPGDLVDLDGGDFVRLPPIATVVDAKAGGDARETPVKLTASLTEVGTLEMHCIATD
FT                   DAARRWRLEFQLRGDAPVQGDDVALARHPRLDQAIELIERSFGSKAAGVTPKDTRRLRA
FT                   QLEQVLGAREDWDVALARELFDALLARARRRRRSADHERAWLNLAGYCLRPGFGHPLDA
FT                   WRIEQLWPLFDDGIQYVTDAQVWSEWWTLWRRVAGGLDDDAQTQVRDAIAFLEPSDDKR
FT                   RKLPFDPAKVGPADMTRLSASLERLPVARKVELAERLIAQLQKPADRALCAWALGRIGA
FT                   RRPFYGSAHSVVPAEIVIGWLDALFALDWKQVEPAAFAAAQIARMTGDRSRDLPDDTRE
FT                   AVIKRLSAANASVAWIDMVREAIAFDEADTVRVFGETLPAGLKLLGD"
FT   gene            complement(421270..422334)
FT                   /locus_tag="Bcen2424_3576"
FT   CDS_pept        complement(421270..422334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3576"
FT                   /product="amidinotransferase"
FT                   /note="KEGG: bur:Bcep18194_B2543 amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10315"
FT                   /protein_id="ABK10315.1"
FT                   /translation="MHGRPVRRPFSCPSLPPFMNLVSIQAPSAVVMIRPHRFVPNPQTA
FT                   ADNAFQRTAADDSHDTSSVSAAARDEVTAAAQTLADAGVRVHVFDDHGERDTPDSVFPN
FT                   NWFSTHPGGHVALYPMHSSNRRRERRADVIEMLKAEYRVQDVIDYSGLEYDDVFLEGTG
FT                   AMVFDHVARIAYTARSRRADPVALERFCTHFNFEPICFDTADANGRPIYHTNVMMSVAT
FT                   EFAMVGLDLIADSRRRGEIAQRLSETGRAVIALDASQIANFAGNTLELSGKNGRVLALS
FT                   RRAFDCLTGEQRVTIERSARLLPLDVPTIELAGGSVRCMLAGIHLARRSAAAHDGVEIE
FT                   SEEKRRDAVSVSHA"
FT   gene            complement(422340..423419)
FT                   /locus_tag="Bcen2424_3577"
FT   CDS_pept        complement(422340..423419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3577"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bur:Bcep18194_B2542 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10316"
FT                   /protein_id="ABK10316.1"
FT                   /translation="MTRFLDVPATARLIAQTGVTTFLRELVDTLRADYLHWADFDKSPR
FT                   VACHSRDGVIELMPVANASLFAFKYVNGHPVNAARGMHTVMAFGALAEVDTGYPLLLAE
FT                   LTLTTALRTAATSVLAAQVLARPDARSMALIGNGAQSEFQAIAFHTLLGIDEIRVFDVD
FT                   SHATDKLVRNLAAYPGLRIVRAASTADAVRGADIVTTVTADKAFATIVTADMIEPGMHL
FT                   NAVGGDCPGKTELEAGVLRAGRVFVEFEPQSRIEGEIQQMPADFPVTELWRVLQRETTG
FT                   RQRADEVTVFDSVGFALEDYSALRYLYALAQQHNAGVEIALIPPAVDPKNLFALIDDPA
FT                   AIAHGHAAFVTEAVAAFAR"
FT   gene            423713..424144
FT                   /locus_tag="Bcen2424_3578"
FT   CDS_pept        423713..424144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3578"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bur:Bcep18194_B2541 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10317"
FT                   /protein_id="ABK10317.1"
FT                   /translation="MITLDDVDRQLIALLRDNARLPVVALAKELRVARATVQNRLTRLE
FT                   KNGVIVGYTVRLKPAAERHRIRALMSIAVQGNRGAEVVKVLRGHPNVASIHSTNGRWDL
FT                   VAELHADSLEHFDRVLGAIRLIDGIANTETSILLSTHKA"
FT   gene            complement(424179..424772)
FT                   /locus_tag="Bcen2424_3579"
FT   CDS_pept        complement(424179..424772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3579"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; uncharacterized peroxidase-related enzyme; PFAM:
FT                   Carboxymuconolactone decarboxylase; KEGG:
FT                   bur:Bcep18194_B2539 uncharacterized peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10318"
FT                   /protein_id="ABK10318.1"
FT                   /translation="MTTATHGFTSDTLGWRAWLDTVSLDAATPEQLAVLEASHPQAKTS
FT                   DYYLLLVHLPEILRQRSGVFNAIMYGPGGLSRAERELASTAVSRVNGCVYCASVHAQRF
FT                   AQLAKRTDAIEQVFDDPATAGTTARERAIVRYAIALTERPDAINESDIAALEAEGLTHE
FT                   EILDLSHAIAIFAWANRLMLTLGEPVFPESAAGA"
FT   gene            complement(424769..425299)
FT                   /locus_tag="Bcen2424_3580"
FT   CDS_pept        complement(424769..425299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10319"
FT                   /protein_id="ABK10319.1"
FT                   /translation="MTDSITPAAAPDMIDAAAGLREGDAVAALRRARDKVLLPTRLSEA
FT                   ALFDPALPDLSLIERLHAARYVAQQSNAHALADIYRARLLDAGGTLADIERADADALDA
FT                   LPRRLGAILLHAKRLTHAPVDARASDLDALKSAGLTTPAIVALSQLVAFVAYQLRVAAA
FT                   ARALQARAAKEAA"
FT   gene            complement(425296..426756)
FT                   /locus_tag="Bcen2424_3581"
FT   CDS_pept        complement(425296..426756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3581"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG:
FT                   bur:Bcep18194_B2537 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10320"
FT                   /protein_id="ABK10320.1"
FT                   /translation="MTAQLDALEARLAQDLRWLDLPAPSWVPPREADGVRVLDVAIVGG
FT                   GMAGLAASAELRLLGIDNQCVIDRAPAGYEGPWVTFARMETLRSPKQLAGPALGLPALT
FT                   FRAWFEAQYGRDAWDALYKIPRPQWMDYLRWYRRVLDLQVRNDTTLVALRPRDDGLLAL
FT                   DVRGNGEAQTLLARHVVLATGRDGLGGPYVPPVAQRAPRSRWAHSSEPIDFAALAGKRV
FT                   GVVGAGASAFDNAGTALEAGAARVDLFFRRADIPRINKLTGIGSPGLVHGYADLDDATK
FT                   WRFMHYALTSQTPPPRDSVLRVSRHDHAHFHAGSPIETLADHADGLDVTTPRGRYTVDF
FT                   LIFATGFHSDWTTRDEFASFGAHVRRWKDRYRPEPALWLDELAESPDLGPAFAFQERER
FT                   GACPAVTRIHCFNHAASLSHGKLSGDIPAISAGAQRLARGIASRLFDADRDRHYDALVA
FT                   YANAELQGDEWRDADALDHFDDEGTPNR"
FT   gene            complement(426753..427823)
FT                   /locus_tag="Bcen2424_3582"
FT   CDS_pept        complement(426753..427823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3582"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2536
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10321"
FT                   /protein_id="ABK10321.1"
FT                   /translation="MNRACSRSYNAQIASSERVMELHQLEAFSAVMSAGSVTGAGELLG
FT                   RSQPAVTRQIQELEADLGYALFDRHGPRVTPTRRAFLLYEEVERSLVGLRAIEARARAL
FT                   GDETAEPVRIAATPSLAATLVPAALAALPDDAHAPHYQLRSESAEHVVHEVLAGTADVG
FT                   VVTLPMAHAGLDVHWIAQTPCVAVLPADDPLAAQPRIALRDLARRRIVTVANRHRLRQR
FT                   IDAAFAAARVDARVFIETNASLNAVMAARAGIGIGIVDPATGVALPVEGVVARALDVDI
FT                   PFAFGVATPAGKARTEAVDALLDALHRTTRTLLDDVIFHDAAAHDALLRGDRLRTDRTA
FT                   RPPRPTRTRRARPEAA"
FT   gene            428121..429314
FT                   /locus_tag="Bcen2424_3583"
FT   CDS_pept        428121..429314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3583"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bur:Bcep18194_B2535 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10322"
FT                   /protein_id="ABK10322.1"
FT                   /translation="MNVSGNDARGAWRRVLGTVAALAAAWGLSTGGALAAGVSGEPVVI
FT                   GVSGPLTGQDAQYGEQWKRGFDLALDEINGSGGIHGRPLAIDFQDSRSDPRQAVAIAQK
FT                   FVADPRIAIELGDFSSATSMAASPIYQRGQLIQFGFTNSHPDFTKGGDYLWSTALSQAE
FT                   EQPLLARYAVKELGFKRIAVLYLNTDWGRTSKDIFAKAVTGLGAQVVAAEGYQPAEKDF
FT                   RSTLVRIGESKPDSIVLISYYADGAQIVRQARTSGVALPIAAVGSVYSPKFLELGGTAV
FT                   EGVYTESNFFPAEPRPEVQAFVQRYRAKFHADPDSFVARAYDALILSAEVLRRYGTTRQ
FT                   AAHDGFAKVSDVPSVIFGKVRFDPQTRRVAGARTVYLVVKQGQWALWDGAKPQLAAR"
FT   sig_peptide     428121..428228
FT                   /locus_tag="Bcen2424_3583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.990 at
FT                   residue 36"
FT   gene            429354..431165
FT                   /locus_tag="Bcen2424_3584"
FT   CDS_pept        429354..431165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3584"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family / amino acid/amide ABC transporter membrane
FT                   protein 2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_B2534 ABC branched-chain amino acid family
FT                   transporter, fused inner membrane subunits; TC 3.A.1.4.-;
FT                   TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10323"
FT                   /protein_id="ABK10323.1"
FT                   /translation="MASWLDYTLNGLIVGNIYALLAVGLALIFGVSHLINFAHGSVYMV
FT                   GAFIGWLCLTRFGLPLPVALAAVVVGCGALGIAIERIGLRPLRHAARIAPLLATIGISF
FT                   ILDQLAQLAFGADPRAVPTPLPDWHVRIAGATLGSLDLLIAGIGIAAAALLYGFLRFTR
FT                   LGWAVRATAQDRDAALQMGVDVDRVNQTVFAIACALGGVSGLLVGMYYNSIDPAMGFQA
FT                   TLKGVVALLIGGLGNVPGAIAGSLLLGLVESYGVALFGTSYRDLFAFGLLIVFLVWRPN
FT                   GLFSANRALPPEPMTGTFLAAAKAVRVPRPLLVALIAAAAVLPWLGASPYVLQTLTNAW
FT                   LYGLLALSLTLVAGTVGQISLGHAALLVIGAYASALLSSDLGWSPAVTIPCAGAITAVL
FT                   GTLLVYPAFRLRGHYVSIATLGIGEVVSLVILNWDGLTRGPLGITGIAPLPWATTARAA
FT                   YWFTFAVLVVFALVQVRLLRSHLGRTLRAVREDDVAARAHGIAPNRYKAIAFAVGGVAA
FT                   GVSGGIAAHLYSYINHQTFDSQVSILALTMVILGGLGNVLGGIVGAIALIGLPELFRWA
FT                   ADYRMLIYGLVLLLLVRFRPQGLLGTV"
FT   gene            431177..432034
FT                   /locus_tag="Bcen2424_3585"
FT   CDS_pept        431177..432034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3585"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B2533 ABC branched-chain amino acid
FT                   family transporter, ATPase subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10324"
FT                   /protein_id="ABK10324.1"
FT                   /translation="MTTTRPLLDVQGLTRRFDGVTALDGASLTLADGELLSVIGPNGAG
FT                   KSTLFNLIAGADRPDAGRVTFDGRDITGTAPERLAALGIARTFQHGRVFGNLSVLDNVL
FT                   IGAHARLRAARPGWPALGAAAEVLRALVRPASVRREEAELREEARAIVAGFGERLTPRI
FT                   DHPAHSLSYANRRRVEIGRALALHPRLLLLDEPTAGMNETETAEMLQLIQSLKARGLTI
FT                   LLIEHKLELVMRVSDRVMVLDNGVKIAEGAPRDVRHDPRVIEAYLGRRHAGGAATEHSA
FT                   QAAA"
FT   gene            432031..432795
FT                   /locus_tag="Bcen2424_3586"
FT   CDS_pept        432031..432795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3586"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B2532 ABC branched-chain amino acid
FT                   family transporter, ATPase subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10325"
FT                   /protein_id="ABK10325.1"
FT                   /translation="MTVQSSVPDTTMTDALLKLEHLDTFYGPVQVHFDVNFEVGRGQIV
FT                   SLLGGNASGKSTTMKLILGLMRPKRGVVRFDGDDVTALATPQRVRRGIAAVPEARRLFG
FT                   DMSVRENLLMGAYTRGDRAAVSEDYERVLDLFPRVRERLAQRAGTLSGGEQQMLAMARA
FT                   LMARPKLICMDEPTMGLSPLYVDKVLELIDAINKQGVTVFMVEQNASLALEIAHYGYVL
FT                   QTGRVVLEGPAKTLLDDERVRDAYLGGEAVAV"
FT   gene            432883..433332
FT                   /locus_tag="Bcen2424_3587"
FT   CDS_pept        432883..433332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10326"
FT                   /protein_id="ABK10326.1"
FT                   /translation="MLTYSIQKVGYDFNQLDQQGAADYASFVHAFDAFPWGAQHVEWNE
FT                   TQDGPLPALVLQHADDQRELWVTALTDAHSDGFQLNAVSMRIKKGLFGIGKGKLEQHVD
FT                   TIDVRKRVDVDALCRLFCDRQYDELDQRVARYAQRNADDDRDSDD"
FT   gene            complement(433391..434815)
FT                   /locus_tag="Bcen2424_3588"
FT   CDS_pept        complement(433391..434815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3588"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   Two-component sensor kinase N-terminal domain protein;
FT                   KEGG: bur:Bcep18194_B2527 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10327"
FT                   /protein_id="ABK10327.1"
FT                   /translation="MPRIDWFPKTLFGRTLLFIALVVATGALALAAIARYYAGVAAERA
FT                   YDQLLAGASIQVAENLYVQGGVLALNPPVAALSTLSRYDLVYYKVVDSRGVVVAGYHDL
FT                   ASPATLAAAKQGPAFANAVYQGHRVRTATIARFMPEESTPGWALVTVAQTTNARQQLTN
FT                   DMSFKVWTLILLMSVLAIGASGLAIRRGLRPLAQIGAIIAARDPADLRPVAVDTPSEID
FT                   AIIGSINGLMHRLAERINAMQRFIADAAHQMRTPLARLDAQIELLDGESDPARHAARLD
FT                   ALRATSSDVGRLTGQLLNHAMVIHRTEAVPLQPVDLVALAKEVLGRTIPLAGERDVAVA
FT                   FASDAPHAWIDGDAISLQEALSNVLHNALLHGHADDIVVAVATQGNVDRAVTLTVTDNG
FT                   RGIPREHWDAALQPFVRIAPDGSERRTGSGLGLAIVQEVMKAHGGRVGFSFPDAGGFAV
FT                   VLTFPRAAAKHAASDA"
FT   sig_peptide     complement(434720..434815)
FT                   /locus_tag="Bcen2424_3588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.862 at
FT                   residue 32"
FT   gene            complement(434802..435467)
FT                   /locus_tag="Bcen2424_3589"
FT   CDS_pept        complement(434802..435467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3589"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bur:Bcep18194_B2526 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10328"
FT                   /protein_id="ABK10328.1"
FT                   /translation="MRILVVEDDAEIGAAIRSRLARLGHAVDLETDGATANGLLRVERF
FT                   DLVVLDANLPGMDGFTVLRHLRASGSTTPVLLVTARSAIDDRVSGLGLGADDYLVKPFD
FT                   YRELDARVQALLRRNSGHANDVLTLGGLVIDRSSRLAELDSQPLSLSRQEFALLEILAS
FT                   RPQRIFSKEELLNQLFSFGNEPTANAVEQYVTRVRKKLQGSSVEIRTARGMGYQIAAH"
FT   gene            435705..436730
FT                   /locus_tag="Bcen2424_3590"
FT   CDS_pept        435705..436730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3590"
FT                   /product="ABC nitrate/sulfonate/bicarbonate transporter,
FT                   periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2525 ABC
FT                   nitrate/sulfonate/bicarbonate transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10329"
FT                   /protein_id="ABK10329.1"
FT                   /translation="MTTSPRRRALIAAGLGVLGGLGAPALVRAKPRTVRISKGYGVLYL
FT                   PLLVMEKQRLFERHAARHGVRDVAVEWVLLDGGNSVNDAMMAGTLDFAGAGAPGFIELW
FT                   ARARGIPNVEVIGISGLSTTSLSLNANRAGLASLRDFTSSDRIAVPGIRTSLSAVVLQM
FT                   VASRQLGPTHFAQLDSITVNLPHPQAMQALIRRENGVTAHFTSPPFSTLELRQPGIHRV
FT                   VSSVDVLGPMTLDVVFAPKRLVDAEPALAVAFLGALDEANRLIAQDPRAAAALYAASSG
FT                   VGVSHDDVMRMLAAPDTRFSVLPNQLMDYVEFLYLAGTIKAKPRAWREMFAPMLDDYRS
FT                   G"
FT   sig_peptide     435705..435794
FT                   /locus_tag="Bcen2424_3590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.951 at
FT                   residue 30"
FT   gene            436860..438170
FT                   /locus_tag="Bcen2424_3591"
FT   CDS_pept        436860..438170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3591"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2524 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10330"
FT                   /protein_id="ABK10330.1"
FT                   /translation="MNATDTLDPASAEEQRIMSKMARRLLPILVVMFLIAFIDRQNVGF
FT                   AKLQMVHSLGMTEAAFGLASSLFFIGYLLFEVPSTLALHRYGARVWLARIMLTWGLITV
FT                   LMGFTTSMPAFCSLRFVLGIAEAGFYPGVIYYLTLWFPQSYRAKVLGIFTLGSALANML
FT                   GSLVGGLLLSLNGVWGLAGWQWVFVATGIPAVVVAIVVFRVLPASFREARFLDEREKQI
FT                   VAAALEREKPAQAEHGQPWKALLDPRVMLFAATYMLMSTSLYGVTYWLPTIVKSFGVSS
FT                   TMNGFLSMLPWALAVVLLVWLPSKLRRAKSILRTIAIVAALGALGFLLSLVLPSTPLRF
FT                   IALVLGGACIPLLYPCFWSMPPRYFTGARAAASVAAINSIGNLGGFFSQNLMPFAGKVT
FT                   GTAFGPMIVPIVCLALLGVGALVAWTRSERGMVAARA"
FT   gene            438283..438558
FT                   /locus_tag="Bcen2424_3592"
FT   CDS_pept        438283..438558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10331"
FT                   /protein_id="ABK10331.1"
FT                   /translation="MKTATMPALRVDPQLREEAESVLEENETLSAFMESALRDGIARRR
FT                   LQREFVTRGLASRDEARRTGEYVDAADVQAELEGMLKAARAAKAAD"
FT   gene            438606..438854
FT                   /locus_tag="Bcen2424_3593"
FT   CDS_pept        438606..438854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3593"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   atc:AGR_C_1518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10332"
FT                   /protein_id="ABK10332.1"
FT                   /translation="MYRYLLERDVDAAARAVDAIEQGVAMLRMFPFTCRKVDHGNPFLR
FT                   ELIMSFGTSGYVLLFEIEAAEQVTILAVRHQREDDYH"
FT   gene            complement(438891..440687)
FT                   /locus_tag="Bcen2424_3594"
FT   CDS_pept        complement(438891..440687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3594"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region; KEGG: bur:Bcep18194_B2521
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10333"
FT                   /protein_id="ABK10333.1"
FT                   /translation="MTAAFRFPPTSPPDDDDPDTSRLFMSSLPPGRREQRLALATVLVS
FT                   AVIFAALAPFAAMPLTPGWAFIPVYQSAIVINDMVTAGLLLGQYAILREKPLLVLAGGY
FT                   LFTAFMAGTHMLTFPGLFTPTGLLGAGEQTTAWLYLFWHGGFPLSVAAYALLRATSRGR
FT                   PAPAPQRRAAIPVVLCLVAAGGATAALALLATVGHALLPHIMSGNRMTSTMTNAITVVW
FT                   GLNLVALMLMWRQRRRHSVLDLWVMTVLVAWLFDIALSSMLNHGRFDLGFYAGRAYGLV
FT                   ASGVVLFAMLFENGRLHAQTVRALAGARYQHLLVVQKSAQLNDANERLEQRVAARTAQL
FT                   SASNRDLRREVEERVRAERALQASREELREIAAISASAREAEQRRIARELHDELAQTLA
FT                   TLKNDLEWLIDHVPQDDASLARKIAAMHALARGAVAATRRIASDLRPLMLDDLGFAAAM
FT                   QWLVEDFRHRHGIACSLRVEPPELQLDEPYATAVFRIAQEALANVARHAAASHADVELV
FT                   CGGEAIALTIRDDGAGFDPAVPRKSASFGLVGLRERAYLVGGTLRIATTLGEGTTVEVE
FT                   IPLSPAPVAVAHGGDRDSRINR"
FT   gene            complement(440684..441331)
FT                   /locus_tag="Bcen2424_3595"
FT   CDS_pept        complement(440684..441331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3595"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: bur:Bcep18194_B2520 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10334"
FT                   /protein_id="ABK10334.1"
FT                   /translation="MIRVILADDHAVMRDGLRHILERAGGFEIVGEASDGSGTLALAER
FT                   AAADVLLLDLSMPAPTGIELIRLVKRQAPSLRTLVLTMHAETQYAARAFKAGATGYLTK
FT                   DSATAELVEAVGKVAAGGVYVSPSAAESLAHTLRAPAQALPHERLSAREFDVMRRIVAG
FT                   QTVTRIASELALSAKTVSTYKTRILEKMGLPHEAALVRYTVRHDLDLGDDDA"
FT   gene            441655..442107
FT                   /locus_tag="Bcen2424_3596"
FT   CDS_pept        441655..442107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10335"
FT                   /protein_id="ABK10335.1"
FT                   /translation="MIDLADILPSALPAAVAWAEAEAARGLAQGAPLTPAQADDARTVG
FT                   VAQPDRIRVMAVDRMPFPDTPTLAAIARDSGLLAPGTIGLTLGHAVYVLRGHDTRRLLT
FT                   HEFRHVHQYEAAGSIGAFLARYLREIATVGYHDAPLEADARQHEFD"
FT   gene            442223..444241
FT                   /locus_tag="Bcen2424_3597"
FT   CDS_pept        442223..444241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3597"
FT                   /product="DedA family membrane protein"
FT                   /note="KEGG: bur:Bcep18194_B2518 DedA family membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10336"
FT                   /protein_id="ABK10336.1"
FT                   /translation="MSDTIHAWIGAIGAHPLLVLAIVFVAACAEAIALVGTIVPAGAVM
FT                   FAAGALIGAGALDAWATIGVAAVGAVIGDGISYELGRHYRGMIRNAWARFGYASAYARG
FT                   EEFVLRHGMKSIVLARFLAPVRAVVPVIVGCATLPRRSFYPVNVISALVWAPVHVAPGI
FT                   LFGASAALAAAISVRVAAILLVVAGLVALVWIGVRVALRRGWPLLRRALVQTVHACARR
FT                   WPRFGARLHDGIAYLRGLPGAVPVLALLFIGCVWLFAGIVQDVVANDPLMHVDIALYAF
FT                   LQNLRTPPGDAVMSALAVLHGHDTGLIVAAAFLVWLMIHRCWLTAAWWLATIGVAVALV
FT                   PVFGASVPGATPASLPPGALHVALPDADAAFAILASSGLGWALTRDRPALWRIPVVTAV
FT                   VLWIVLGGFARLYVGDTWLSGLLGGWSLGLAWFALLAGAYAYWRVREHVQPRGALVAVV
FT                   VVLATAGVWTVPAQWQLDRAARPHVGDVVAMTVDQWLRGGWQRVPTRRTEIGGDREEFL
FT                   PLQWSATSDTLDRHLAQAGWQRATPWTPATALRWLLPQAAADTLPVLPRYTHGESTRRV
FT                   FVRVDPAHPESRFVLRLWRYPYVLQDALGMRPLWYGALYRETLRRPARLMTFVRSTTID
FT                   DAVAIAHALAVEPTIVHRPAGMAAAPDAMLLVWMVQP"
FT   gene            complement(444266..444595)
FT                   /locus_tag="Bcen2424_3598"
FT   CDS_pept        complement(444266..444595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3598"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: Helix-turn-helix, Fis-type; KEGG:
FT                   bur:Bcep18194_B2517 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3598"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10337"
FT                   /protein_id="ABK10337.1"
FT                   /translation="MNKLKGAVSHHDAEVAELGADRELAVAYLRVAMESLDDPDNRAAG
FT                   LLALRTVAEAYGGLGAVAAEAGISRESLYRTLSPNGNPTLKTLLAVLKTVGLRLSVVPA
FT                   QPSHA"
FT   gene            complement(444592..444924)
FT                   /locus_tag="Bcen2424_3599"
FT   CDS_pept        complement(444592..444924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3599"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   bur:Bcep18194_B2516 protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10338"
FT                   /protein_id="ABK10338.1"
FT                   /translation="MLAKFELLRYQRDDGREPFTEWLNAVRDKPAQARIRERLRRVQTG
FT                   NFGDCEPVGEGVIELRVHVGAGYRVYFGRHGSALVLLLSGGDKASQPDDIRRAREHWSN
FT                   WKRRQT"
FT   gene            complement(445315..447765)
FT                   /locus_tag="Bcen2424_3600"
FT   CDS_pept        complement(445315..447765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3600"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bur:Bcep18194_B2514 lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10339"
FT                   /protein_id="ABK10339.1"
FT                   /translation="MLSPDPSRSAGSTTPLAAIIIGAGFAGIGMAIALQRAGIRDFVIV
FT                   ERSHDVGGVWRDNRYPGAACDVPSHLYSFSFEPNPAWSRVFAPQPEIHAYLQHCARKYG
FT                   LARHLRFGAEVEHARYDEADALWHVTLRDGTTLSAALLVSGTGQLSRPAMPNLPGIDTF
FT                   RGRAFHSAHWDRDYALAGKRVAVVGTGASAIQFVPAIAGDVRRLTVFQRSPAYVMPRPD
FT                   RAYRPWEKALFRRLPAAMKLHRASIYLRYEARAIAFTRLHGLMKVAVGRPFRKLLARDV
FT                   PDPALRARLTPDYPVGCKRILLSSDYLAAMSRDHVELVTQPIRRVTEDGIETIDGVHHP
FT                   VDAIVYGTGFAATEFLSPMRITGRGGLDLNDAWRRGAQAYLGLTVPGFPNFFMLYGPNT
FT                   NLGHNSIVYMLESQIAHVMRCIQAMRRDGAREIDVDARRYRCFNVHVQQRLAGSVWSSC
FT                   KSWYVDASGHNSTNWPGFTLTYRWITRFTGMSAYRLSQPLPGAAAPMHGMVVAPPAGRF
FT                   EAFTAASLRGFLRVAFRPLIGPPFGARMQRRVVALLSPLMPGAGGTLRYRTSAQHVPIE
FT                   VVAPKRGDTGGAILYLHGGAFCLGGPHTHRGVTTRLANDAGLPVWVPDYRLAPEHPSPA
FT                   ALDDALAAYDAMRTQGYAPHRIVIAGDSAGGALALALAIALRERGEPTAAALLLISPVT
FT                   DSTLGGATLASRRHDDPMIRRGWLEQGLRWYHGTGSAAARGPLDTDLHGLPPILIQAGD
FT                   QEVLLSDAQRLAEHAHACGVPCRLEIHAARWHVFHLQAFYLRSARDALRTLAGFAAERV
FT                   ATTA"
FT   sig_peptide     complement(447670..447765)
FT                   /locus_tag="Bcen2424_3600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.683) with cleavage site probability 0.290 at
FT                   residue 32"
FT   gene            complement(447752..449470)
FT                   /locus_tag="Bcen2424_3601"
FT   CDS_pept        complement(447752..449470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3601"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bur:Bcep18194_B2513
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10340"
FT                   /protein_id="ABK10340.1"
FT                   /translation="MSKTFDYIVVGGGSGGCVVAGRLTEDPAVTVCVLEAGGRGDSAVV
FT                   NVPTGAVAMMPTRLNNWAFDTVPQPGLGGRIGYQPRGRALGGSSAINAMVYIRGHRVDY
FT                   DGWAALGNEGWAYDDVLPYFRLSEHNERFDDAWHGRDGPLWVSDLRTGNPFHARYLEAA
FT                   QQAGLPLTDDFNGAQQEGIGIYQVTQKHGERWSAARAYLLPHVGRRDNLTVETHAQVLR
FT                   ILFDGTRATGVEVRQHGEIRTLRARREVVLAAGALQTPQLLMLSGVGPGRELQQFGIAV
FT                   QADLPGVGSNLQDHPDFIFGYRTRSVDTMGVSVRGGLRMLREFARFRRERRGMLTSNFA
FT                   EGGGFLKTRADLAAPDIQLHFVVALVDDHARKLHAGHGLSCHVCLLRPRSRGSVTLNGA
FT                   DPLAAPRIDPAFFDDPRDLDDMVAGFRLTRRLMDAPALASWTTRDLFTANVTTDDEIRD
FT                   VLRRRADTVYHPVGTCRMGRDALAVVDPQLRVHGLQGLRIVDASVMPTLIGGNTNAPTI
FT                   MIAEKAVDLMRGICRVPAQPHADATVRRTTDRDPTLATRAAHAGDQPEETRHAVA"
FT   gene            449680..450774
FT                   /locus_tag="Bcen2424_3602"
FT   CDS_pept        449680..450774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3602"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bur:Bcep18194_B2512 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10341"
FT                   /protein_id="ABK10341.1"
FT                   /translation="MLVGDNCFSIWAKSALRGFLRMSFWDFTRSPASARLLVDFGDERG
FT                   VPHATLLAGTGLASAQLDDPKVEVTAAQELRLTGNLLRALGRAQGLGFEVGRRYHFSAY
FT                   GVWGYGLIASATGRDALALAMRFLPLTYAYTVITYREAADTGVLSFGAPELDADLSRFL
FT                   VERDMTAAAVLLHEIASGDFALSRFTLQAARSPALAAPRIAGIEPTFSARANSLAFDRA
FT                   FLDRPLPHANPLTVSMCEQMCGQLVEARRARVGTSEMVRQYLNATPGSAPFSLDDMARL
FT                   MNTSPRTLKRRLQEEGTTFRALLAQTRGAMAETLLGDARLSLADVAERLGFSDLSSFSQ
FT                   AFKRWYGVPPGAYRSAARRSGDPQ"
FT   gene            450771..451352
FT                   /locus_tag="Bcen2424_3603"
FT   CDS_pept        450771..451352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3603"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B2511 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10342"
FT                   /protein_id="ABK10342.1"
FT                   /translation="MNRGTIARSLARPACRHHIHERPRMITIRPMTDDDFARFWPTYRA
FT                   IVAAQETYAFDPEPTQEAARALWLDAPLCTWIAEEDGVVLGSYFLKANAAGPGKHVSNC
FT                   GYMVSEAARGRGVARLMCEHSQQVARERGFLAMQFNSVVATNAVAVALWQKLGFEIVGR
FT                   LPRAYRHARLGFVDCFVMFKWLGDAAAAEA"
FT   gene            complement(451369..452322)
FT                   /locus_tag="Bcen2424_3604"
FT   CDS_pept        complement(451369..452322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3604"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3604"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10343"
FT                   /protein_id="ABK10343.1"
FT                   /translation="MLNLHRALGFHPALRDKLARGESGKLLVGHDTRNRDIALRAFSAL
FT                   PDSLDATTLCLESTPPADIAAALDAADLFVLLYDSSCLPTPSPSGPPFLAAIRPAIVEH
FT                   WSKSVLFKDYGPHLDEAFAESLDDIAARNGRLIDAAARASQIRFIDEAGNTLTGSLAPD
FT                   QKWTSVDGMGNLDVVPGEIATHVTDLNGSVVFSGTFLGTVPFAIKYKVAERLATLHVEH
FT                   STIVDFDTDDAGFRRDFTTYLDRHANHRRIEEFGIGTNLGIRGLYGRNAGFEERHPGLH
FT                   LGLGGGENGSHHLDLIFARGTLALDERIVFDGAFAV"
FT   gene            complement(452381..452503)
FT                   /locus_tag="Bcen2424_3605"
FT   CDS_pept        complement(452381..452503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10344"
FT                   /protein_id="ABK10344.1"
FT                   /translation="MQETQQIELLDWMQEDTHPEAVDMMVEDAVVPFGTALWPV"
FT   gene            complement(452909..453364)
FT                   /locus_tag="Bcen2424_3606"
FT   CDS_pept        complement(452909..453364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3606"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bur:Bcep18194_B2509 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3606"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10345"
FT                   /protein_id="ABK10345.1"
FT                   /translation="MPDEALDRLDLAILEALQENARTPLSEVGRRIGLSQPATSERVKR
FT                   LEERGIIAGYGARIDPAALGLGMMAIIRLKTTHEHIKPALRAFAEMPHVIEVHRMTGED
FT                   CFLLKVLVPTPGQLETLIDAIARFGAVTTSLVLRSEPTKTIGKALLG"
FT   gene            453468..454025
FT                   /locus_tag="Bcen2424_3607"
FT   CDS_pept        453468..454025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3607"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   bur:Bcep18194_B2508 protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3607"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10346"
FT                   /protein_id="ABK10346.1"
FT                   /translation="MEGVMDQAIVIVPGIGNSGPDHWQSHWETAFPGAARIAPASWEAP
FT                   DLADWTAALDTAVANAGAPPLVICHSLGCLLFAHWRAGSARAVRGAFLVAVPDPAGPRF
FT                   PVAAAAFANLPGGRFGRVPVLAIASADDPYDPAGRALEWATEHGATPLLLGARGHLNAA
FT                   SGLGGWPEGRALLAAFAAGLGR"
FT   gene            454209..455459
FT                   /locus_tag="Bcen2424_3608"
FT   CDS_pept        454209..455459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3608"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B2507
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3608"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10347"
FT                   /protein_id="ABK10347.1"
FT                   /translation="MRAVPQPERAGRSRPDAGATDPGRMAAWRLAICLSLGSAIALGLA
FT                   RFSYALLLPPMKADLGWTFAQAGALNTANAAGYLIGALAFPLLSRRWRAGTLLAAGCVL
FT                   TAVLMAAGGLTSDMHVLLAQRLATGVGSALIFISGGVLAARLASASPRDAGLLLGLYYG
FT                   GTGWGIVASSLLVPATLVHRVHGWQPAWFALATACVLFSAVAVSAARRIEHAHAAPARE
FT                   ADGAKPAATASPARFALALAGYGLFGVGYIGYMTFIVALLRGAGMSGTVVAAFYVMLGV
FT                   ATVVSARLWSGLLDRMRGGQALAVLNALLGVATLMPALFVHPAAAFASGLLFGATFLSA
FT                   VASTTAFVRHNLPPDGWAKGISAFTTVFAFGQIAGPVAIGWVSDSAGLARGLVYSALTL
FT                   FAGAALAVGQRALRAPA"
FT   gene            complement(455499..456044)
FT                   /locus_tag="Bcen2424_3609"
FT   CDS_pept        complement(455499..456044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3609"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase reductase
FT                   component"
FT                   /EC_number="1.14.14.9"
FT                   /note="TIGRFAM: 4-hydroxyphenylacetate 3-monooxygenase,
FT                   reductase subunit; PFAM: flavin reductase domain protein,
FT                   FMN-binding; KEGG: bur:Bcep18194_B2506
FT                   4-hydroxyphenylacetate 3-monooxygenase, reductase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3609"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10348"
FT                   /protein_id="ABK10348.1"
FT                   /translation="MSSTTDIQRPARVEPTDAQKAFRQAMAHLGAAVNVITTAGPHGRC
FT                   GITASAVCSVTDAPPTLLVCLNRSSAMHATFERNRQVCINVLPAEHELLARHFAGLTDL
FT                   PMEQRFELPVWDRGEQDVPVLRDALASLQGTIAEMKEVGSHSVMFIEATSIRVRDDGDS
FT                   LIYFSRAFHRVSRTACVR"
FT   gene            456399..457031
FT                   /locus_tag="Bcen2424_3610"
FT   CDS_pept        456399..457031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3610"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG:
FT                   bur:Bcep18194_B2505 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3610"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10349"
FT                   /protein_id="ABK10349.1"
FT                   /translation="MTSPAPIVYIVDDDSGMRTSLAWLLESVGIASEGFANAADFLARF
FT                   DVNLPACLVLDVRMPEKSGFDVQAELNARGATLPVIFVSGHGDIPMSVRALQNGAIDFV
FT                   EKPYNSQQMLERVQRALRLAQQRHAVSQRHRELRQRLDALTAREKEVLRGVVDGKGSKQ
FT                   IASDLSISVKTVDVHRASIKEKLGATSIAALVRDVMVVWGDDGESSR"
FT   gene            complement(457173..457979)
FT                   /locus_tag="Bcen2424_3611"
FT   CDS_pept        complement(457173..457979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3611"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bur:Bcep18194_B2504
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3611"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10350"
FT                   /protein_id="ABK10350.1"
FT                   /translation="MNHDAGAAATGVRPRTTEFQTMSDRVVLVTGAARGLGAVIAERFH
FT                   AAGYRVALADIAADAIHAHARDLDPSGERALALPLDVTSKRDFEAARDALVARWGTIDV
FT                   LVNNAGASKVVPAMEITAEQFDQVIDVNLRSVLFGCQVFGQYFAQRGAGRIVNIASLAG
FT                   QNGGSATGAHYAAAKGGTLTLTKVFARDLAAQGVTVNAISPGPLDLPIVYESVAPEKLR
FT                   QVLASLPGGKLGSAGFVADAAVLLASGDAHFANGACWDINGGLYMR"
FT   gene            complement(457976..459100)
FT                   /locus_tag="Bcen2424_3612"
FT   CDS_pept        complement(457976..459100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3612"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bur:Bcep18194_B2503 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10351"
FT                   /protein_id="ABK10351.1"
FT                   /translation="MTGFIDTFTLGGPGPTIAIKDTIDIAGHPTRAASRALADAPPAEH
FT                   HADVVRLLLDAGWQIAGKANMHELAFGMTGINDYTGTPVNPQDATRIPGGSSSGSASLV
FT                   GLGTVDAALGTDTGGSIRGPAACCSVAGLKPTFGRVSRRGVAPTDTTLDCVGPFAREIR
FT                   TLVAVMAAIAPGFDRARATASAAGCTVAQLTVEADPAIAAALDAAVRASGLRSHTIVLD
FT                   AMPAAFAAGLTVINAETSRAFGHLVATGKLGADLDARLRAAATTAPAALKEAEAVRARF
FT                   TAQVDAALEHADVLVLPTLPALPITLQQARDGVSVIAMSSLIRPFNLSGHPALSLPLPL
FT                   AGSPLKAGLQIVGRKGADEQVCAIAAHFEAALAA"
FT   gene            complement(459132..459653)
FT                   /locus_tag="Bcen2424_3613"
FT   CDS_pept        complement(459132..459653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3613"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10352"
FT                   /protein_id="ABK10352.1"
FT                   /translation="MTELSPAAIDALARRVAALDAERAVRATITRYMALCDVPENAGDG
FT                   PSLAELFTPDAVWEGIGPQYTKKFGRLEGTAAIVAMLGRYLPPDPHFSANLHFLTSESI
FT                   EVASDLASARGRWIMLQASRYADGAAELIAARLTIDFAPAADGAAWLIRHFRTERVLDG
FT                   PWPLAAASRP"
FT   gene            complement(459662..460039)
FT                   /locus_tag="Bcen2424_3614"
FT   CDS_pept        complement(459662..460039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10353"
FT                   /protein_id="ABK10353.1"
FT                   /translation="MSDSNPLPLRVLFCCGVSQNFFDLPREQIGEVWQAYGAMLAAVEA
FT                   MPGVRVLGVMDDDRLVVGQADGAPWTFYIMADVADFDTTVAVCNLYRTTPVGEYNLWRY
FT                   GKIEARVGRALTVPPAAKPAA"
FT   gene            complement(460142..461335)
FT                   /locus_tag="Bcen2424_3615"
FT   CDS_pept        complement(460142..461335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3615"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: bur:Bcep18194_B2500 acyl-CoA
FT                   dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10354"
FT                   /protein_id="ABK10354.1"
FT                   /translation="MPQAALAIESAPTSPPAARPAAAPLSPLDAVIETVAARREEFDRL
FT                   SHVPRDVIALFKQAGIYRAGTPRRFGGDALAPTAFLDMIERIATADGSAAWVASFGSAN
FT                   VYLAALPLDTQAELYASGPDQVFAGGLFPVQPAQDAPGGWRVNGTWKFASGCKGADWLG
FT                   VGIAVPGAQDAAPNKPRTAVFRAADVEIVENWSVVGMQGTGSHDLRVNDRFVPEAWTFV
FT                   RGGEPTVDEPLYRYPTVAYAAQVLAVVNLGLARAALDVVNRMSGGRQTTTGAPRLADRA
FT                   YFRIELAKAEAQLRSARAFFYDATDTVWQSILAGNPVTPDQVSLLRLAATQIAREGASV
FT                   VERAYRLGGTAAIYRSHPLQRLLRDAMVVTQHAFLAEGNFDGAGAVFTGVTPFPGYL"
FT   gene            461485..463032
FT                   /locus_tag="Bcen2424_3616"
FT   CDS_pept        461485..463032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3616"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bur:Bcep18194_B2499 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10355"
FT                   /protein_id="ABK10355.1"
FT                   /translation="MRSARAGAMLGFRPRDAARLPPNPIMSFPDEDDFHRLLDALTTCV
FT                   LLHDAHTRAIVWANRAACIALGFSVEELLPLKAPDMTRPEPKYQREIAVSAWDRARVDG
FT                   PQVYEWCYRSRTGVDMLSEATATYVPLRGRDVVMVQFRDISAEEAVRQQLRRYEARLRE
FT                   FMQDLDEGIAVVTPRGGVQFISESGRRVLGLAPDEPLGEVLDYCSAADRDRLIAQLRDA
FT                   PSACPSAPQRYRIVRRDGSACWLRILCRQVEIEGDLDGLLVQFRDVSDEVAIEEARRAE
FT                   ARMLEYAGRYNAMGEMATVIAHELSQPLAAVRNFIEGAVRRLNGNGAVDDAIWGLRSAD
FT                   RQAEHAALIIKSVREFIVKREPVVARADLRDILADVAYFIELRAKEAGVTVAIVQADAP
FT                   LPIRCERVLIGQVILNLAFNAIEAFAGCERLPRTLTLGTANVAGHAELRALDNGPGIEA
FT                   GAHDRLFDGFSSSKAGGNGIGLSLCKSIVTRHGGRIAATPAAGGGLDCRVTLPLADG"
FT   gene            complement(463083..463469)
FT                   /locus_tag="Bcen2424_3617"
FT   CDS_pept        complement(463083..463469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3617"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bur:Bcep18194_B2498 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10356"
FT                   /protein_id="ABK10356.1"
FT                   /translation="MPTLEVFLPAGHDDARKAELIARLSHATVDAIGASIDSVRVLLTE
FT                   LPATHIGLGGRSAADGAPPSLPVIVAILIAGRTDEQKRALIAALSDAGANVLDAPLQAT
FT                   RVIIKDIPNTDFGIGGQTARALGR"
FT   gene            complement(463592..464092)
FT                   /locus_tag="Bcen2424_3618"
FT   CDS_pept        complement(463592..464092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3618"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: bur:Bcep18194_B2497
FT                   aromatic-ring-hydroxylating dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10357"
FT                   /protein_id="ABK10357.1"
FT                   /translation="MDDRNALFSEQTFARAVEFVWREAEMLDRRDYRAWLDLWAPAGHY
FT                   VVPIDPDTTDFAATLNYVFDDQDMREKRVQRMVSGYSASATDAARTVRTVSRFTLESSG
FT                   ADTVELKSAQVVVAYKRGVATLFAADVTHKLHVDADGEIRIAEKVVRLIDSTEALSAIG
FT                   FLL"
FT   gene            complement(464092..465375)
FT                   /locus_tag="Bcen2424_3619"
FT   CDS_pept        complement(464092..465375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3619"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: bur:Bcep18194_B2496
FT                   ring hydroxylating dioxygenase, alpha subunit/Rieske
FT                   (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10358"
FT                   /protein_id="ABK10358.1"
FT                   /translation="MSDIAYQTIDTRALHGLAQPDRIAPAMYHDPALFEAELDRIFYRT
FT                   WIWVAHDSELPNPGDFVTTTIGRQPVIVVRDKTGEINVLQNRCRHRGATVCEAHKGNAK
FT                   GFTCPYHSWSYALDGTLRALPYGDGYEGVCDKGDLPLVKLRVGVYQGLIFASFNDAIEP
FT                   LEDFLGGAKPWIDLFMKQGAGYPIKANGEHKFKFKGNWKIQLENTTDLYHFPVVHKSWM
FT                   KSIDDETAAAITSFMTSEHAFCRGLGNGHSLAVLMPELIDLDEDDGAPLPERFAPLAAK
FT                   LAERHAPDEVRRIVRSLMGVGFNLNLFPNLALSMAFFRVLRPISANETEIRHVALAMDG
FT                   GPDEANRERLRIHEHFQGPFGFGSPDDAEAWERVQRGAHAGPDVPILVNRGLNRETTAA
FT                   NGEKTAHATDETGMREAYQQWRKMMEQQ"
FT   gene            465516..466433
FT                   /locus_tag="Bcen2424_3620"
FT   CDS_pept        465516..466433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3620"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2495
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10359"
FT                   /protein_id="ABK10359.1"
FT                   /translation="MTSVDHLDLNLLRVFQAIVEERSLTKAGERLALSQPAVSYSLGRL
FT                   RTLFDDPLFVRTRSGMQPTPVALELAGIVGKALDMVRVALRYAERFDPATSARTFRVSL
FT                   SDAGEMAYLPAICQALRERAPRVTLSVQPLPVEEIEEALRASRLDFAIGNLPELMPRTR
FT                   HQVLFEETYVCMTGRRRGLPTAAVLSLEQFVRAAHVNVKSVEHSHHALDDALRAQGVGR
FT                   NIALEVPHFVALPSVLSVTDLYATLPRRLAQILNRDNAFRLYELPVTLPPAPVTMHWHE
FT                   HFHEDEGNAWMRALLAEIVERFDE"
FT   gene            complement(466575..467555)
FT                   /locus_tag="Bcen2424_3621"
FT   CDS_pept        complement(466575..467555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3621"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: bur:Bcep18194_B2494 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10360"
FT                   /protein_id="ABK10360.1"
FT                   /translation="MQANRHQVRIDALIDAAQDIRCFRVSRVDGQPFDAYEPGAHIDVT
FT                   APSGVTRQYSLCGNPDERGSYLFAVKKEAQSRGGSRSLHDDVSVGAELSIGTPRNLFRL
FT                   TDDASEHVLVAAGIGITPLLSMAYALHKRGARYRLHYFARSRAHAAFVDALSVEPFASH
FT                   VTFHYGVEPDALAAELGRCVESIDPTAHVYTCGPGPFMDAVVAAAARRIPEDAIHLERF
FT                   AAEPSETVTAAHAAPAEGFEVRLQRSGQSVRVAPDTSIVDALAQIGIEVDTSCGEGVCG
FT                   TCMVPVLDGEPDHRDHCLSKAERASNTVICCCVSRARSAVLVLDL"
FT   gene            complement(467770..469173)
FT                   /locus_tag="Bcen2424_3622"
FT   CDS_pept        complement(467770..469173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3622"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2493 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10361"
FT                   /protein_id="ABK10361.1"
FT                   /translation="MSASTARAADGKRYTYEWYVVVICMLAYIFSFVDRQVLVLMIEPI
FT                   KRDLHLSDTQFSLLNGFAFSLFYAVMGLPVAYLADRYARPRIISLGIALWSVATAACGM
FT                   SQHFVHMFVARMGVGVGEAALSPGAYSMLADYFPKEKLGRAVAVYSLGSFIGGGIAFLI
FT                   GGYVIALLKHASAFTLPVVGQVHAWQVTFLIVGLPGILVALLFAATVRDPQRKGLAQDR
FT                   SGAVRRVSMRDSLRFVGTHRATFACHYLGFSFYAMALYCLLSWTPAFYIRRFGMTAVEA
FT                   GYTLGIVLLVANTAGVFCGGWLNDWLLRRGRSDAPMRAGAIGAACMVIPATLFTQLDSL
FT                   PASLAMLVVAMFFASFPMPTSTAAMQTLAPNQMRAQISALFLLVSNLIALGIGTTVVAL
FT                   FTDRVFGAPAAVGHSMSIVNVAAATLAALLLAAGCRHYRRSLERERGHAAASASADAAV
FT                   DGGNAIAAR"
FT   gene            469584..470702
FT                   /locus_tag="Bcen2424_3623"
FT   CDS_pept        469584..470702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3623"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B2492 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10362"
FT                   /protein_id="ABK10362.1"
FT                   /translation="MNHPNGRALRLAVPLAALLACMTLPAAAQSSVTLYGRIDTAIEYA
FT                   NAGPNHVTRMGSGNLWASQWGLKGVEDLGGGYATIFKLEDGFNAASGALSNSSALFGRE
FT                   AWVGITGPFGGVQFGELYTILHTTLVTYSLPGLGAGLAWGNATNNFVGPAFLRVRNSMR
FT                   YTSPRYAGFLLRAMAARGTNGAAGQPATLGDTYGAGLNYVRGGLSVDVDYMQQKFSPVA
FT                   APTLGATSAAANGNYTLGAISYDFNVVKVAALYLRHRGGPDVATAIDSQSAYPHSDIME
FT                   LSATVPIGRASLLLSVGHYRKVADSDGNADSYGIRFDYPLSKRTVLYTGAAMVRNGAHA
FT                   RFVVNGAAGGGVAVAKPGATASSLVAGILTSF"
FT   sig_peptide     469584..469670
FT                   /locus_tag="Bcen2424_3623"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 29"
FT   gene            complement(470741..471778)
FT                   /locus_tag="Bcen2424_3624"
FT   CDS_pept        complement(470741..471778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3624"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2491
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3624"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10363"
FT                   /protein_id="ABK10363.1"
FT                   /translation="MTLSAPGRPAAPTRPEPVPHDGDASDGLRVQDLDLNLLKTFRAVY
FT                   EARHVGRAALRLGVTQPSVSYALGRLRLMFRDALFVRTGTGVEPTPRAQRLAISVDKAL
FT                   AILQDVLDEGSRFAPDSTQRVFRLHMSDFAASAFLPTLLAAFDRRAPGAVIETLHVDEC
FT                   QLNVALESGRIDFALGHFADASSHFQRTALLHERCVLLMPRRTAQRVGLPDDFVLDGAA
FT                   PDTLRFVAVTSHPQSMQLLERHELMPRVRAALPDFLVVPALLQDGDYALILPETIAITF
FT                   AARQPCVLYEIAGAGEWAVNAYWHRRFDADPGHCWLRALLLELFNIGEQAPFDAWLAPQ
FT                   PPACA"
FT   gene            complement(471775..472749)
FT                   /locus_tag="Bcen2424_3625"
FT   CDS_pept        complement(471775..472749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3625"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bur:Bcep18194_B2490 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10364"
FT                   /protein_id="ABK10364.1"
FT                   /translation="MDIALSRHAPNRLGTLQAPDEVERAVAHRLGPHRMAASGRDPFHA
FT                   ELYEVPLHHGALLELCYGRETRIEFGDDADHFLFRLTLAGACELQAGNVVARAGPGALT
FT                   VSSPALPSRLRTSPDCRNLVLRLERGALERKLQDMLQATLTRPLQFDLAAGGAGAGAAL
FT                   VRPTFEYLCRLGAQPGIGAASPVFGADLTAWLMSLLLTHLPHSYSDALRRGTPPLPAHV
FT                   RRACAHVDAHLGEPLALAALAAVAGVAPRTLQHAFRAFLHTSPAAYVRERRLAAVHAAL
FT                   QRGDARSVTDVLIAHGIHGFGHFAKAYARRYGHAPSVTARQTR"
FT   gene            472899..474005
FT                   /locus_tag="Bcen2424_3626"
FT   CDS_pept        472899..474005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3626"
FT                   /product="NAD/NADP octopine/nopaline dehydrogenase"
FT                   /note="PFAM: NAD/NADP octopine/nopaline dehydrogenase;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; KEGG: bcn:Bcen_4737 NAD/NADP octopine/nopaline
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10365"
FT                   /protein_id="ABK10365.1"
FT                   /translation="MKVCVLGGGHGCHAAAIDLLEKGHDVTWWRRDREPHARLRALGVL
FT                   NVTDYRGKRAVPLGDAPGAIRLTDDLAAALRGARLVVVPLPATSHDALAAQVAPLLEDG
FT                   QVVFLPPGTFGSVVFARAAADAGNRARVAFAETGTLPYLVRKHGDNEVVISAYATRLPT
FT                   GVWPANAAGWAFDVLRAGYPSVEPVEDALSGALMNAGPVIHPPLILMNAGPLEHFDAWD
FT                   IHNEGTQPSIRRVTNALDAERIAVREALGYRAPHFPLADHYATDGDEWMYGRGAHGKLT
FT                   DSGDWREKIDLRTHRYMLEDTRLGLSFIVSCGRWAGVPTPVAQGLLSIASAVAVRDLYA
FT                   EGRTLERLGFAALSKDALRALLDAGYSA"
FT   gene            474002..475012
FT                   /locus_tag="Bcen2424_3627"
FT   CDS_pept        474002..475012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3627"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   KEGG: bcn:Bcen_4736 3-hydroxyacyl-CoA dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10366"
FT                   /protein_id="ABK10366.1"
FT                   /translation="MKAAADVTRIHVLGAGRMGQGIALVFAFAGLDVTLIDFKPRDAAG
FT                   WRAFDDRTRNEITRPLHAQIALGRIDNAQADAVAARITLVARDGAADAVCDADIVFEAL
FT                   PEVLEAKADALRWLGRHVDAHATIASTTSTFVVTELQRHVAHPARMLNAHWLNPALLMP
FT                   LVEVSRSDATDQTVVDVLAALLERVGKKPVICGPAPGYIVPRIQALAMNEAARMVEEGV
FT                   ASAEDIDTAIRTGFGPRFAVLGLLEFIDWGGCDILYYASRYLAGEIGPRFAPAASVVRN
FT                   MEAGRDGVRTGAGFHDYAAVDVPAYMRQRLGEFARLLDHLGLAPAFDSARRDAGR"
FT   gene            complement(475024..476361)
FT                   /locus_tag="Bcen2424_3628"
FT   CDS_pept        complement(475024..476361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3628"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_4735 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10367"
FT                   /protein_id="ABK10367.1"
FT                   /translation="MYPTDTVQSPSAVRPLADRQLRRIVIASVAGNAMEWYDFFVYGTA
FT                   AALVFGHVFFPPGASPLAGSLAAFAAFALGFVARPLGGIVFGHVGDRYGRKASLVWTLL
FT                   IMGASTFAIGLLPTYAQVGLWAPAALVVLRLLQGIASGGEWGGGVLMISENAPPEQRGY
FT                   YAAWSQLGVGGGFVLSSAAFLAAQALPDDAFRTWGWRLPFLASVAIFAIGIYIRRHLPE
FT                   SRDFEQAGKRGAHAHLPIVECIRRHPKEILLAMGLRVAENGGAYIFLAFSLVYGKYLGI
FT                   PNGTMLTGVMIAMIVEMGAMLAWGRLSDRIGRKPVYLIGALSLVACAFPFFWLLDTRVT
FT                   PLVWLALTIGTAVSHGAMIGTLPALVGELFSTEVRYSGVALGHEVASIFAGGMSPLIAT
FT                   ALLARYHASWPVSLFLIALGLVTVATLCVMRETRTPPADGSRGDPA"
FT   gene            complement(476531..477577)
FT                   /locus_tag="Bcen2424_3629"
FT   CDS_pept        complement(476531..477577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3629"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bcn:Bcen_4734 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10368"
FT                   /protein_id="ABK10368.1"
FT                   /translation="MKLLGTIAAAAALCIAGAGAPAFAQTKTIYVGMNGGPMEKAYTSQ
FT                   VLPDFEKANNVKVVIVPGTSSDVLAKLLANRNKPQIHVAFLDDGVMARAVSLGVCQKLD
FT                   DSPVLKELYPFARMKDDVGAGVQLGMTGIAYNKKLFAEKGWAPPTSWMDFADPKYKGKV
FT                   VFQSASSSTFGLHGFLAINRLLGGNEQNVEPGFGKWASTVGPNVVEYIPNSAKISEMVQ
FT                   TGEAGLFPLTPTGVGDLQDKGIPVAYANPKEGPVLLLVDLCVVANNPDPQLAQKLAQFL
FT                   LSAPAQTKAAEAGKQIPTNRLAKMPAPMQQSLGNVDDLVRKVTVVDWTAINARRAQWDT
FT                   RWNRQIER"
FT   sig_peptide     complement(477503..477577)
FT                   /locus_tag="Bcen2424_3629"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(477574..478725)
FT                   /locus_tag="Bcen2424_3630"
FT   CDS_pept        complement(477574..478725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3630"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_4733 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10369"
FT                   /protein_id="ABK10369.1"
FT                   /translation="MSEIRHYDVAIVGGGLVGASAALALTRRGLRVGLFERRDCGAQAS
FT                   GVNYGGVRCQGRPVEQLPLALRARRIWDRLPELIRIDGEFVVSGHLRLARSDADLDALD
FT                   AYAVLASEHGLPLQVMRGDAFRRRYPWLGRAALGGSLCETDGHANPRVVSPAFARAART
FT                   AGADVFEHTAVDEVHHDGTRFHLQAGGRAHTATWLINSAGAWANTIAERFGEAVPMEPI
FT                   YPNMWVTEPLPPFIAHNLGVYGGGVYARQVARGNCVIGGGRGRGDGEFGQPSVDTTRVV
FT                   MRDACALLPALRDALLIRTWSGVEGCTPDHNPIIGASRTTPNLLHAFGFSGGGFLLAPG
FT                   VGDVLADLITTGETATPLDAFSIGRFFPQAVPTAPFRQEETQR"
FT   sig_peptide     complement(478651..478725)
FT                   /locus_tag="Bcen2424_3630"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.686 at
FT                   residue 25"
FT   gene            complement(478718..480160)
FT                   /locus_tag="Bcen2424_3631"
FT   CDS_pept        complement(478718..480160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3631"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bcn:Bcen_4732 BFD-like
FT                   (2Fe-2S)-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10370"
FT                   /protein_id="ABK10370.1"
FT                   /translation="MSAALQPVIVGAGPAGVRAAEALVDAGLRPVVIDENARWGGQIYR
FT                   QPPANAAFVRGKRTLYGFEAAKADAVHRTMAALLPHVDYRPNTLAWSCGASRVDTLQDG
FT                   REVTVPYSHLIVASGATDRMLPVPGWTLAGVYTLGGAQVALKAQGCAIGRRIVFAGTGP
FT                   LLYLVAYQYAKAGAHVAAVLDTSPLRRQAGAAPALLRMPSIFAKGLYYHGWLRAHGVAI
FT                   ETGVTLERVLGDQHVTGLAWRAAGDSAQPAPPRVLDCDALGLGFGLRSETQLADLAGCR
FT                   FGFDPLNRAWLPERDAAGRTSVRGLYVAGDGAGIAGADAAEASGRRAALALLDDAGIAS
FT                   RSPSGQPDAAALERTLARIGAFRAGLEAAFAPPVEQAARCPDDTIVCRCEEIDAGTLRR
FT                   CVREGAATELNRLKALTRVGMGRCQGRMCGDAAALVLAAETGQPLADVGRLRAQPPVKP
FT                   FPISAALAGDDVAAIPDEARDE"
FT   gene            complement(480157..480504)
FT                   /locus_tag="Bcen2424_3632"
FT   CDS_pept        complement(480157..480504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3632"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3632"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10371"
FT                   /protein_id="ABK10371.1"
FT                   /translation="MTTPVSRSTDVADDRAQFVRVAERERAAVAFTLDGRPAHALAGDT
FT                   VLTAILVAQRRVRVSEFSGQPRAGFCLIGACQDCWVHTEAGARMRACSTPIAEGMRILT
FT                   TARPAATGDAS"
FT   gene            complement(480504..481298)
FT                   /locus_tag="Bcen2424_3633"
FT   CDS_pept        complement(480504..481298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3633"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_4730
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10372"
FT                   /protein_id="ABK10372.1"
FT                   /translation="MRKNGPFALAFHTLVILFVLAPLAIVVLVAFTPDETLTLPTHGVS
FT                   LRWFRAILDYPDFVTAFVNSVKLAFASATLSLAIALPAGLAIGRATFPGRAFLNGLLLS
FT                   PLVIPGLVLGIALLRFFALIGATGSFAWLVLAHMIVITPFVMRLVLASVAGLDRSIEQA
FT                   ACSLGADPWTTFRRITLPMIVPGITGGWLLAFINSFDELTMSIFVTSPQTVTLPVRMYM
FT                   YATESIDPMMASVSALVIFITAGAMLLLDRVYGLNRILIGQH"
FT   sig_peptide     complement(481206..481298)
FT                   /locus_tag="Bcen2424_3633"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.787 at
FT                   residue 31"
FT   gene            complement(481295..482275)
FT                   /locus_tag="Bcen2424_3634"
FT   CDS_pept        complement(481295..482275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3634"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_4729
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3634"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10373"
FT                   /protein_id="ABK10373.1"
FT                   /translation="MGQPSRPLSTDGAPAGLAASPAAVDAMSPRAVGGNAPRARWRAYA
FT                   PLWLMCAPAFALFAALVLVPLAMTFVLTFYRFDPATGPIAAFQFGNYAEVLGSSYFHTI
FT                   FARTFGIAALTTAICVAIGTPEAYVLSKMRDPWRSLFLLAILAPLLVSVVVRAFGWSML
FT                   LNTSGLVNQALALVGLGPYKLEYTTFAIVIALVHVMLPFMVIPVWTALQRLDPQTEHAA
FT                   LSLGASPFTTLRRIVVPQLMPGVLSGSLMVFGLSASAFAIPGLLGGRRLKVAATAVYDE
FT                   FLGSLNWPLGATIAVLLLAANLVVMLTYYRVLERRYARSLGGASR"
FT   gene            complement(482276..483358)
FT                   /locus_tag="Bcen2424_3635"
FT   CDS_pept        complement(482276..483358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3635"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_4728 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3635"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10374"
FT                   /protein_id="ABK10374.1"
FT                   /translation="MSFLTLTDLTKTFGELTAVADVNLSVEQGEFVSLLGPSGCGKTTT
FT                   LQMIAGFVDVTHGRIALDGQDITHLKPNRRGLGIVFQSYALFPHMSVAENVGFGLDMRG
FT                   VDKAERAERIRAALALVRLDALAHRFPRELSGGQRQRVAIARAVVIEPPVLLLDEPMSN
FT                   LDAKLREDMQFELRAIQRKIGTTTIMVTHDQSEALSISDRVVVMEAGRITQTDTPYRAY
FT                   ERPENHFVSQFIGKANLLPGTIVAHDGDAIRIDLGHDLAETGRTAHLPPRERDMRVGDA
FT                   VSVCIRPEKLRLCAPDAGRFAATVTSRFFLGSQWLYRVDSALGEVLVCCQNEGTEPLAE
FT                   GAPVGIDWHSDAVRVMRREA"
FT   gene            483399..483632
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3636"
FT   gene            483653..484555
FT                   /locus_tag="Bcen2424_3637"
FT   CDS_pept        483653..484555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3637"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: bcn:Bcen_4726
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10375"
FT                   /protein_id="ABK10375.1"
FT                   /translation="MQEPHLPGTSPAARMPHPDEDAVPADSADAAGAPGTGMLQRAFAI
FT                   LRALAGMQQDGVRVTHLAKAVGLTQGTAHRILQSLIAEGMVEQDEQSKLYRLSVDFFAL
FT                   AALAGNPSSMRTLCRPALLRLCASLGETIFLLVKSGFDAVCLDLCEGPFPIRSFTGDIG
FT                   GRIALGVGQGSLAILAFLPEAEREEVIRFNVPRIRGYGVLDEVYLRTEIERVRQLGYAG
FT                   RNSGVLDGMAGVAVPILDRTGYPVGALSVGTLASRLGDDRMPMVVELLRRQADAIGPRT
FT                   NPFDAALRRPMHGLSGKTI"
FT   gene            484827..485573
FT                   /locus_tag="Bcen2424_3638"
FT   CDS_pept        484827..485573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3638"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_4725
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3638"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10376"
FT                   /protein_id="ABK10376.1"
FT                   /translation="MRLRNKSALITGGTSGIGLATAKLFISEGARVAVTGRDERVFERV
FT                   KAELGEHAVVLKGDVRSLDDMRAIAGEVNERFGGLDVVFANAGWAFPSAVNDIDDTLYN
FT                   DIMDVNVKGVVFTLQAALPYLREGSSVILNTSFVAQTGKHGISLTAAAKAAVRSLARSW
FT                   SYEFLDRKIRFNAIAPGAIDTPLLSKWGKPDEWVRDRKAEFAEAIPVGRMGHADDIAYA
FT                   ALYLASDESSFVVGTELVVDGGASQL"
FT   sig_peptide     484827..484895
FT                   /locus_tag="Bcen2424_3638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.970 at
FT                   residue 23"
FT   gene            485726..486580
FT                   /locus_tag="Bcen2424_3639"
FT   CDS_pept        485726..486580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3639"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: ThiJ/PfpI domain protein; KEGG: bcn:Bcen_4724
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3639"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10377"
FT                   /protein_id="ABK10377.1"
FT                   /translation="MTDSSDNHAPGGQLTRAGRSRRDVLKFGSAATLGAVLGGSALLGH
FT                   AAPAPAPTGSPALLAPTEPLNILIVNYDGGTLLDFAGPSEIFHRLPNTNVRYASLDGGN
FT                   VTLEFGVVYGKTERLADIDRTDVILVPGGSDLSAPMRPAYQAQIRRLAESAKHVTSVCN
FT                   GSLVLAATGVLDGKRSACHWAFVNKLAEYGAIPVPDRFVEDDDGRFMSGGGVTAGIDFA
FT                   LRVAAKLRGQQAAEYTQLVVEYDPDPPFHSGHPREARPELVAMVDKKLPGASKGLARVP
FT                   GVR"
FT   gene            486648..487121
FT                   /locus_tag="Bcen2424_3640"
FT   CDS_pept        486648..487121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3640"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   nuclear transport factor 2; KEGG: bcn:Bcen_4723
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3640"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10378"
FT                   /protein_id="ABK10378.1"
FT                   /translation="MRQIHLCTAALAACVSFFAFTAPAVAGGAQRLPEAAIKAENARWA
FT                   DAFARGDYDAIGRLYTDDGTLLPPDGDKVTGRRAITEYFTSGYAGSKPGTVSFSNDEFY
FT                   GNDRVVTEVSDVEVRDGDGKLKIRAKQTLVFLKQGGTWKLHRDMWNAYPPVKD"
FT   sig_peptide     486648..486728
FT                   /locus_tag="Bcen2424_3640"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.911 at
FT                   residue 27"
FT   gene            complement(487232..488179)
FT                   /locus_tag="Bcen2424_3641"
FT   CDS_pept        complement(487232..488179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3641"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bcn:Bcen_4722
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10379"
FT                   /protein_id="ABK10379.1"
FT                   /translation="MHRIGFFVCRGYDALDLGGPLSAFNQVATAAGHTPYDLHVISPTG
FT                   GPIPGNTGLSIDTKPVGRRAFDTIVFVGGDIAPMQTSENITAASKLAAKASRVASVCTG
FT                   AFLLAETGSLDGLRAATHWRYAAQLQSRFPRTRVDGDSIYVVDGRVWTSAGIASGIDLA
FT                   LGMIERDMSAEIAREVSRLLVVPYRRPGGQSQFSAMSQMEPESDRIRIALNFAREHLTE
FT                   ALPVERLADAASLSVRQFGRAFRRETGETPARAVERLRVEAARLRLQGGSEPIEQIALA
FT                   VGFTDPERMRRAFIKLLGHPPQAIRRESRSNAAR"
FT   gene            complement(488340..488861)
FT                   /locus_tag="Bcen2424_3642"
FT   CDS_pept        complement(488340..488861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3642"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_4721 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10380"
FT                   /protein_id="ABK10380.1"
FT                   /translation="MLIRVATLADAVPLAKLKRDTFRETFLQDGFGIDYPPHDLAEYEA
FT                   RTYSVAAITEQLADPQRRTWVTEGDDGTLVGYAHAGPCKLPHPDVADGSGEIHQICLRR
FT                   GTQGTGAGRALFDAALEYLAATRPGPVWLGVWSGNAKAIAFYEKAGFKRVGTYDFKVGE
FT                   STDLEFIYRR"
FT   gene            489139..489522
FT                   /locus_tag="Bcen2424_3643"
FT   CDS_pept        489139..489522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3643"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3643"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10381"
FT                   /protein_id="ABK10381.1"
FT                   /translation="MPFICENVECRAVLARGQVRHHQEGAGWCFYCPDCNTRNELMNIG
FT                   TLSGPVELVQPERASPPHKVVATARPLDDGRYAAQLSVQRALAVKGTYAAEEHWDQLGV
FT                   FGDAQEAVAHAKSFATDLLQRAA"
FT   gene            complement(489691..490548)
FT                   /locus_tag="Bcen2424_3644"
FT   CDS_pept        complement(489691..490548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3644"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   bcn:Bcen_4719 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3644"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10382"
FT                   /protein_id="ABK10382.1"
FT                   /translation="MADAPDNLLGAYLRDRREKLDPAALGLPATRRRTPGLRREEVAQR
FT                   AHVSVAWYTWLEQGRGGAPSADVLDRLARALMLNEAEREHLFLIGVGHPPEVRYHAPAG
FT                   VTPRLQHVLDSLDASPAIIRTATWDVAAWNDAAAATLTDYATLPPAARNILRLIFVDAG
FT                   VRYAQPNWERVARFAVGAFRADVARSGATQAVQAFVDEMRATSAEFDAMWRDHDIRTHD
FT                   EGTKEIRHPQAGRIALEYSAFSVTGSPDLSLVIFTPVTPADRARIRELVAAREQARATQ
FT                   APAA"
FT   gene            490644..491537
FT                   /locus_tag="Bcen2424_3645"
FT   CDS_pept        490644..491537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3645"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KEGG: bcn:Bcen_4718 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3645"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10383"
FT                   /protein_id="ABK10383.1"
FT                   /translation="MRVFVTGASGFVGSAVVAELVAAGHSVLGLARSDAAAASVAAAGA
FT                   DVHRGSLEDLDSLTRGAEAADAVIHTGFNHDFSRFAQNCELDRRAIETIGAALVGSARP
FT                   LIVTSGLALVAPGRAATEDDPHVPVSENYPRASEATAVALEARGVHASVVRLPPSVHGD
FT                   GDHAFVPRLIAFAREKGVSAYIGDGANRWPAVHRLDAARVYRLAIERGAAGARYHAVDD
FT                   TGVPFREIAEVIGRRLNVPVVAKSASEAGEHFGWFARFAGMDAPATSERTRASLGWAPT
FT                   QPGLLADIDRPQYFES"
FT   sig_peptide     490644..490700
FT                   /locus_tag="Bcen2424_3645"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.488 at
FT                   residue 19"
FT   gene            complement(491583..492572)
FT                   /locus_tag="Bcen2424_3646"
FT   CDS_pept        complement(491583..492572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3646"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcn:Bcen_4717 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3646"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10384"
FT                   /protein_id="ABK10384.1"
FT                   /translation="MTRIVRFHRIGGPEVLQIDTVDVPAPGPDDIQLRVKAIGVNRAEV
FT                   MFRSGEYTFMPRFPASLGYEASGVVAAVGRNVTTFAEGDAVNVVPAFSFADYGMYGEVV
FT                   NVPARAVVKHPDSLSFEEAAATWMMFVTAYGALIELGGLQRGEAVLIGAASSSVGQAAI
FT                   QVANRVGAVPIALTRGEAKRQALLDAGAKHVIVGSPADLPRQVAELTGGIGARLVFDPV
FT                   GGPEAANLLRALAINGTFFQYGALDTRDIPVPLMDLLARHLTLRGYELFEITGDAQRLE
FT                   RAKRFIVDGLAAGALKPRIDRTFAFDDIADAHRYMEAGAQVGKIVVTV"
FT   gene            complement(492696..493598)
FT                   /locus_tag="Bcen2424_3647"
FT   CDS_pept        complement(492696..493598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3647"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4716 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3647"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10385"
FT                   /protein_id="ABK10385.1"
FT                   /translation="MDRLQTMQIYVQIVERGNFTQAADALQLHRPAVTKAVQQLEQELG
FT                   VRLLNRSTRRVSVTAEGEAFHARCVQLLAGIDDAFASFPKQRAVPKGRLRIDIALALAK
FT                   TIVIPALPDFQQRYPQIELVLGASDQPADLIGEGIDCVVRVGTLKDSSMVARTVGAVSM
FT                   ATCASPAYIARHGLPRTLDDLRTHRAVNFFTGRNRRVLEWTFRPHGETIAVKLASSLLT
FT                   DNSEALLSCGLAGLGIVHALRPALQPSIDSGQLIELLPGVPAVPKPVSVLYPNRAHLPD
FT                   KVRTFIDWLTELFARRYPA"
FT   gene            complement(493678..495057)
FT                   /locus_tag="Bcen2424_3648"
FT   CDS_pept        complement(493678..495057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3648"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: bcn:Bcen_4715
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3648"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10386"
FT                   /protein_id="ABK10386.1"
FT                   /translation="MTQHFDAIVIGTGQAGPPLAARLAGASMKVAIIERGRFGGTCVNT
FT                   GCIPTKTLIASAYAAQLARRASEYGVSVGGPVTVDMKAVKARKDQISGRSNHGVEQWVR
FT                   GLDNTTVFQGHARFERANAVRVGDDVLEAERIFINVGGRAQVPAMPGLDSVPYLTNSTM
FT                   MDVDFLPDHLVIVGGSYVGLEFGQMYRRFGSQVTIVEKGPRLIRREDEDVSQAVREILE
FT                   NEGIDVQLDANCLNARRDGDGIVVGLDCAGGGREVAGSHLLLAVGRVPNTDDLGLDRAG
FT                   IATDARGYITVDEQLRTNVPGIWALGDCNGRGAFTHTAYNDYEIVAANLLDDDPRKVSD
FT                   RIMAYAMYIDPPLGRVGMTLAEAKQTGRRLLVGTRPMTRVGRAVEKGESQGFMKVIVDA
FT                   DSHAILGASILGVTGDEVVHGMLDVMTAGAPYTTISRAMHIHPTVSELVPTLLQDLHPV
FT                   E"
FT   gene            complement(495195..496457)
FT                   /locus_tag="Bcen2424_3649"
FT   CDS_pept        complement(495195..496457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3649"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bcn:Bcen_6212
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3649"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10387"
FT                   /protein_id="ABK10387.1"
FT                   /translation="MPRLATVVAGQSVHFAQTAMQDTQQHDAVDVFVGVDVGKGQHHAV
FT                   ALDRNGKRLYNKALPNDEVKLRALIAELKTHGRLLFVVDQPSTIGALPVAVARAEGVLV
FT                   AYLPGLAMRRIADLHAGEAKTDARDAAIIAEAARSMPHTLRSLRLADEQLAELTMLCGF
FT                   DDDLAAQVTQTSNRIRGLLTQIHPALERVLGPRLDHPAVLDLLERYPSPAALASTTEKT
FT                   LANRLTKLAPRMGKGLAAEIVQALSEQAVTVPGTQAATIVMPRLAQQLAALRKQRDEVA
FT                   AEVERLVLAHPLWPVLTSMPGVGVRTAARLLTEVAHKAFASAAHLAAYAGLAPVTRRSG
FT                   SSIRGEHPSRRGNKVLKRALFLSAFAALRDPVSRAYYSRKIQQGKRHNQALIALARRRC
FT                   DVLFAMLRDGTIYQPKSAPNA"
FT   gene            complement(496693..497271)
FT                   /locus_tag="Bcen2424_3650"
FT   CDS_pept        complement(496693..497271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10388"
FT                   /protein_id="ABK10388.1"
FT                   /translation="MRALRLSALLLPLLAAFPLSVRADTLPKSIAAHLPPGYQPLLAQA
FT                   GPDVDNGRHSFLVVVHRAVDTRDQPSPRPLLIYEEQADHTYRLAARNDQVVLRANEGGQ
FT                   CDPFDPEDAADNGLSVKGRYFTVQNFVACGQHWTDYITFRYDPRTHGWLFSNQIVTESF
FT                   PLDDQPDHVTVTRADAHRPVSFGQWKRKD"
FT   sig_peptide     complement(497200..497271)
FT                   /locus_tag="Bcen2424_3650"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(497321..497821)
FT                   /locus_tag="Bcen2424_3651"
FT   CDS_pept        complement(497321..497821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3651"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_4712 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3651"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10389"
FT                   /protein_id="ABK10389.1"
FT                   /translation="MLALFPVISRRPMIAIRAARYPDDAAAVEAIFREYVASPTVSLAF
FT                   QDYEPEIAALPGKYAAPRGQLLLAWRGERVVGCAAFREIDAATCEMKRVYVRPDARGLN
FT                   VGRQLVERLLRDAKAAGYARMCLDVLPEFVAARQLYASLGFTPAPPVAFNPVPGTDFLG
FT                   RDL"
FT   gene            497936..498574
FT                   /locus_tag="Bcen2424_3652"
FT   CDS_pept        497936..498574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3652"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bcn:Bcen_4711 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3652"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10390"
FT                   /protein_id="ABK10390.1"
FT                   /translation="MTASAAVLAILAALFLGAMIPGPSFVLVARNSIGLSRRDGLATAL
FT                   GMGIGGIVFGGVALAGLYTLLQAVEWLYVGLKVAGGVYLIYMASKIWRGADRPIAMDDP
FT                   QAMAGGSARKSFWTGLTTQLSNPKTAIWYGSIFAALLPQHPPLWCYLALPPLVFAVEFG
FT                   WYTLVALCFSTRRPRELYLRAKKWVDRIAAGAITLLGLRLILNAPKAGI"
FT   sig_peptide     497936..498016
FT                   /locus_tag="Bcen2424_3652"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.432 at
FT                   residue 27"
FT   gene            499000..499791
FT                   /locus_tag="Bcen2424_3653"
FT   CDS_pept        499000..499791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3653"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3653"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10391"
FT                   /protein_id="ABK10391.1"
FT                   /translation="MVQASPRPALSGPTLVRLLARLADADVAESRQTLSDRLSQWLGWT
FT                   DAITLSSALNASPPGVAAGVRGYDAERDCARVRHDLAQAITATQRPRARRRPGDLPPPA
FT                   ADTADFADFRQRYLTLQQDMETAIGQLRGRLRVALAARSSGMARLATLDTIMERVLGAR
FT                   ERSLLSAIPALLGTRFARLRDAERQALAEAEAVAAAAAAPDADASALADEGAAADTPTV
FT                   AAIVPGAWLDTFRDEMHSILLAELEVRFQTVDGLLAALRTC"
FT   gene            499802..502609
FT                   /locus_tag="Bcen2424_3654"
FT   CDS_pept        499802..502609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3654"
FT                   /product="protein of unknown function DUF802"
FT                   /note="PFAM: protein of unknown function DUF802; KEGG:
FT                   bcn:Bcen_4709 protein of unknown function DUF802"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3654"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10392"
FT                   /protein_id="ABK10392.1"
FT                   /translation="MSRIRLDLVVFVAGLLAVGWIGAGYVASNPLAAAVTLLIGACYVA
FT                   GAWELLRYRQATATLSHAVAGLSAPPATLDPWLDTLHPGLRGAVRARVEGARVALPGPA
FT                   LTPYLVGLLVLLGMLGTLLGMVVTLKGTGAALESATDLDAIRASLIAPVKGLGFAFGTS
FT                   IAGVATSAMLGLLSALVRRERIDAAQQLDAKIATTLRVHSSAHQRDESFRLLQRQADVM
FT                   PALVDRLQTMMTTLEARSVALHDRQIESQQAFFDRTERAYAGLASNVGDALKESAAESA
FT                   RVAGAALQPVVAATMTGLAQEMAALRDTVTGAVQRQLDGLTEGFEKTTGNVTAVWNRAL
FT                   DEQRRAGDAVAQQLQTTLGQFTDTFAQRSSDLLDGVATRLESTEGRLSDAWREALARQE
FT                   QVGETLAGQHARALGEAAATFERHSAATLAAMHESHAGLQTQLAARDEERLAAWNDSLA
FT                   AMAAKLGDEWQRAGAHSAGRQQEICDALAQTTRDLAAQASTFEQRSNDLLSTIRESHTG
FT                   LQSQLAARDEERLSAWNESLAAMATKLGEEWQRAGVHSAGRQQEICDALAQTTRDLAAQ
FT                   ASTFEQRSNDLLSTIRDSHTGLQSQLAARDEERLSAWNESLAAMATKLGEEWQRAGVHS
FT                   AGRQQEICDALAQTTRDLAVQASTFEQRSTDLLTTIRESHAALQSQLAARDEARLSAWN
FT                   DSLAAMATALRDEWAQTSAQAAARQQDICDTLTRTANDITAQAQVHASDTINEIARLVQ
FT                   AASEAPKAAADVVAELRQRLSDSMVRDTATLEERSRLLATLETLLGAVNHASTEQRAAI
FT                   DALVSTSADLLDRVGARFNDTVDAETRKLDSVAAQVTAGAVEVASLGDAFGMAVQVFGE
FT                   SNDKLLTHLQRIEAALEKSLARSDEQLEYYVAQAREVIDLSVMSQKQIVEDLQQLAGRR
FT                   ASVGA"
FT   sig_peptide     499802..499900
FT                   /locus_tag="Bcen2424_3654"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.432 at
FT                   residue 33"
FT   gene            502613..503257
FT                   /locus_tag="Bcen2424_3655"
FT   CDS_pept        502613..503257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3655"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bcn:Bcen_4708
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3655"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10393"
FT                   /protein_id="ABK10393.1"
FT                   /translation="MHDEIDGGAPSAPVWPAFADLMSVLLGAFVLILVGVIGMQLQLTS
FT                   KLEEAVRARQLEAQQRKSLEQALAGPLAAGRVTLVNGRIGISGNVLFALNSDQLQPAGR
FT                   DLLKTLAGPLATYLKTRDEILMISGFADDQQVHAGNRLFADNWELSAKRALTVTRAMID
FT                   AGVPASSVFAAAFGSEQPVSSNADDEGRAKNRRVEIAPVPRKSASNGGKAK"
FT   gene            503284..503880
FT                   /locus_tag="Bcen2424_3656"
FT   CDS_pept        503284..503880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3656"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3656"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10394"
FT                   /protein_id="ABK10394.1"
FT                   /translation="MLDAWREQGADRLDPVGFHRIDALERRAAVLDGAARALLDVRLAT
FT                   LIDGFAKRVARDDDAEAPRETVQAATSVPARGALAALVEGFARDAQADRRGLDPELIDY
FT                   FRTMWSKVRTEQQYRQSLDQVPRNAGPLNSNSLVHRSLATMRDLSPEYLQQFLSYVDAL
FT                   AWLEDLAGGGTQPEKEAPRAKAAKPARKTTRTKAR"
FT   gene            complement(503914..504486)
FT                   /locus_tag="Bcen2424_3657"
FT   CDS_pept        complement(503914..504486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3657"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bcn:Bcen_4706 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3657"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10395"
FT                   /protein_id="ABK10395.1"
FT                   /translation="MANETRTDSERSLDIVALCGSLRAQSYNAALLDAAARVAPRGMRI
FT                   ARFDRLGEFPLFNPDAEYPTPAAVRDLIDRLNAADGVLIASPEYAHGVTGVMKNALDWV
FT                   VGCEAVVYKPVAVLNASPRATHADAALRETLSVMSARIVEPASIALPILGSRLDAAGIA
FT                   AHPPFASALVDALHALRAVIHAPAADR"
FT   gene            complement(504541..505272)
FT                   /locus_tag="Bcen2424_3658"
FT   CDS_pept        complement(504541..505272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3658"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3658"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10396"
FT                   /protein_id="ABK10396.1"
FT                   /translation="MRPRRAPFAMRIDVQHSQHDIDDELDTLYERLHQPGHRLHGLPAI
FT                   ALGRSGLIVRHREADGEYFLYVEDPAARQLAGYTVFNRLPELPRRADRYLRAPHTRLRG
FT                   SAQRKGLATTLYRWGLDAGLCLISGARQSVGAARLWTALAHDYRHGFVDVEGRALRYLG
FT                   EAVADDVHGALHTRRLLLGNGWTLGELAQATGMTGVDAAEYANVNVRRGEHERHSVRSV
FT                   GHARPVAHTAHVTHGAHAPMR"
FT   gene            505935..507134
FT                   /locus_tag="Bcen2424_3659"
FT   CDS_pept        505935..507134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3659"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4704 drug resistance transporter Bcr/CflA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3659"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10397"
FT                   /protein_id="ABK10397.1"
FT                   /translation="MPDQTRTTPAWAYSLPSALLLMAPFDLLASLAMDVYLPVVPEMPS
FT                   ALHTSPAMVQLTLSVYMVVLGLGQLMFGPLSDRLGRRPVLLGGALLFSVASLALAMAGS
FT                   GGVFVALRLLQALGASAALVATFATVRDVYADRPEGSTLYSQFGAILAFVPALGPMLGA
FT                   GIAHGFGWRAIFMTLGGAGCLAFYRALSRWHETRQQAGGKPRQSAVSILRSPSFLVYSL
FT                   GFGTSMGAFFVFFSIAPRVLVGQAGYSRTEFSVAFATVAIVMIGAARFARWFVSNWGGP
FT                   GCFVRGAGVMMAGATALAACTALMAPSFVSFVMPMWIVAIGIVLMSSVTANGALRDFDD
FT                   AAGTAVALYYCVQSLIVGGAGTFVTLVLPGDTPWPLAAFCFVAPTACVLALAALKRTRG
FT                   "
FT   gene            complement(507197..508480)
FT                   /locus_tag="Bcen2424_3660"
FT   CDS_pept        complement(507197..508480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3660"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3660"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10398"
FT                   /protein_id="ABK10398.1"
FT                   /translation="MNSTLDGIVAAPDRPPRSATPFRAGLLGITAGLFALWITRDHPAL
FT                   DAATRAVIASLAIIGTIALHELFISRVYLRPSAGLSRQAVRPLGIARVATRLGALTSIY
FT                   AGIGAIYWLLPEYHGAFYLPFWSLLRSLAPYVIVAAPFYFAWMDRHQRETDDAYLLWGR
FT                   FLFRREQPASWKPVREMLAGWGVKAFFLPLMTVYLSKDADHLSASLANAMHAPMTIATF
FT                   VFMYDLSFTMDLMFGTVGYLCTFRILDSHVRTVEPTTLGWVAALICYQPFWSLISNNYI
FT                   RYEGSMFWDNWLLSAPTLRVIWGTVIILLLLTYALCTISFGLRFSNLTNRGIITSGPYR
FT                   FTKHPAYITKNLSYWMVSVPFVEPLGWQLGLMHCAGLVTVNLIYYTRAKTEERHLMRDP
FT                   DYRAYAEWIAQHGLFARIRQAFGGRQPV"
FT   gene            complement(508608..509918)
FT                   /locus_tag="Bcen2424_3661"
FT   CDS_pept        complement(508608..509918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3661"
FT                   /product="collagen triple helix repeat protein"
FT                   /note="KEGG: bcn:Bcen_4702 collagen triple helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3661"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10399"
FT                   /protein_id="ABK10399.1"
FT                   /translation="MTALGTTVVNGGGQIGGVQIPGTNPTTATSIGNAVGSLGNGVQSL
FT                   GNGIAAGLGSIGVSANPLGPTITSTTGLLTGAGGAVNNLGNAVTSLGTGPLSPLAPATT
FT                   LVGSLVNTVGTAVNSTASALNTALNSSPVQQLETQLGKVINPITNTLTGGVTTPGATQT
FT                   LGGVTLLGTPLNGLLSTLGSGLGLAGTKVGGATDNPVGAGLGGVVTQLGNTVTSTGGLV
FT                   HDNNAGSSSSGTGGSNPLAPITGLLGTLTGGLGGGSSSGSGGTSGTSSGGPLAPITGLL
FT                   GTVTGALGGIGSSGTSGTGGTSGTGGTSGTGGAGLGGLLAPVTNLVNSLTPLGASLTGT
FT                   VTTPGGNLSGTLGGVLTSGPVGTLTGALGTPAGSAGATGTVSPGGAAGTVTTPGGSGSV
FT                   VTGLTGSTGGAAAGGTGNLLSPVTNLLGGLLGAGTKK"
FT   gene            511197..511664
FT                   /locus_tag="Bcen2424_3662"
FT   CDS_pept        511197..511664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3662"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bcn:Bcen_4700 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10400"
FT                   /protein_id="ABK10400.1"
FT                   /translation="MARHPPAAGGAAAATTSNHQDTDMSEQDREYGKARRIDVMGEAFV
FT                   ERAMRDLDGFSRPLQNWLNEHAWGSTWQRGGIDLKTRSLCTCAMLAALGRGTELKGHVR
FT                   GALNNGASLVEIREVLLHSALYAGAPAAVEAFRSAREVLSDLGLSIPDDEA"
FT   gene            complement(511722..512705)
FT                   /locus_tag="Bcen2424_3663"
FT   CDS_pept        complement(511722..512705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3663"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_4699
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3663"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10401"
FT                   /protein_id="ABK10401.1"
FT                   /translation="MTPTLHLIQNVLLGVVAVLAALALFSAYVARRVTRAFPPEGRFVD
FT                   IDGDRIHYVEYGNGPPIVFVHGLAGQWRNFAYLPLTRLAQQHRVILLDRPGAGRSLRGA
FT                   ASQANVFAQARTVAAFIDALQLDKPVLVGHSLGGAIALAVGLNHADRVSRLALIAPLSH
FT                   EQTEPPAPFKPLMLPSPLVRRFVSWTFAIPLTILTGRKAVRQVFAPEAVPRDFPVKGGG
FT                   LLGMRPHVFYATATDLLSAPVDLPAMERRYAELALPVDVLYGRADPILNWREHGDALAK
FT                   KSARVRLKVVEGGHMLPVTLPEATADWLLEVAAAPADVAAQPVRIA"
FT   sig_peptide     complement(512616..512705)
FT                   /locus_tag="Bcen2424_3663"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.439 at
FT                   residue 30"
FT   gene            complement(512713..514305)
FT                   /locus_tag="Bcen2424_3664"
FT   CDS_pept        complement(512713..514305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3664"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_4698 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3664"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10402"
FT                   /protein_id="ABK10402.1"
FT                   /translation="MTSTTTDRRDAPSARDTRRDSGDNHDSRDLDVLIVGAGLSGIGAA
FT                   YHLKQRCPHASVAIVEARDAIGGTWDLFRYPGVRSDSDMFTLGYSFRPWHSDKAISDGQ
FT                   TILDYIRDTARAYGIDKTIRYGQKVVAADWDSNRARWTVRIERTRDGATDALVYTCRFL
FT                   FMCSGYYDYDAGYLPDWAGMDTFEGQLVHPQHWPKDLSYANRRVVVIGSGATAVTLVPS
FT                   MAADAQHVTMLQRSPTYIVSLPARDKIANALRRVLPSRLAHRLVRVKNVLLTMYLYNVS
FT                   RRKPDQTKKFIIRAASKQLGPDFDVAKHLTPRYMPWDQRVCLVPNGDLFKAIRAGRASI
FT                   VTDEIERFTPTGLQLKSGQQLDADVIVTATGLKVKMLGGARVTVDGRAVDLPETVSYKG
FT                   MMYSGVPNLASSFGYTNASWTLKAELIARYVCRLLNHMRANGYDTCVPRLGAGDLGDVP
FT                   AVNLSSGYIQRAAGILPKQGHRKPWKFHQNYVLDLASLKFSALADSAMQFERRAQTGPA
FT                   ATAPAAEPALETR"
FT   gene            complement(514302..515204)
FT                   /locus_tag="Bcen2424_3665"
FT   CDS_pept        complement(514302..515204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3665"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_4697
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3665"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10403"
FT                   /protein_id="ABK10403.1"
FT                   /translation="MKGFSGKVAAITGAGSGMGRSLAVELARRGCEVALADVSETGLAG
FT                   TAAACAQHGVRVSTRRLDVADRDAVFAWADFVRAEHGKVNLIFNNAGVSLAASAETARL
FT                   ADLEWIVGINFWGVVHGTQAFLPHLRASGDGHVVNTSSLFGLVAMPTQSAYNATKFAVR
FT                   GFTEALRMELELDGAPVSATCVHPGGVATSIVDAGRVDTSIHALTGQDEATHRRQANRL
FT                   INATTADEAARQILAGVERNARRVLVGADARRLDRIARLLGAGYQWLMLRHVRRARARN
FT                   LERAHAPATRPTTPTKDLA"
FT   sig_peptide     complement(515133..515204)
FT                   /locus_tag="Bcen2424_3665"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            515292..515948
FT                   /locus_tag="Bcen2424_3666"
FT   CDS_pept        515292..515948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3666"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_4696
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3666"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10404"
FT                   /protein_id="ABK10404.1"
FT                   /translation="MSNSGMEKALETEKRGRAYGGVAPEVRAAERRDALIRAATRVFGT
FT                   VGFRKATVRSICQEAKLNDRYFYAAFDSTEDLLRCTYLHHAQQLHDAVAQAVAARGGEL
FT                   RERVDAGLAAFFAFLRDPCAARVLLLEVMGVSADTDMTYQRMLIDFGKLIMAIGAPGEA
FT                   VTPAERTEQRLIGLALVGAMTNVGAAWLLTDYRDPEAQMIASCRKVLLGTLGTGR"
FT   gene            516274..516756
FT                   /locus_tag="Bcen2424_3667"
FT   CDS_pept        516274..516756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3667"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: eca:ECA2199 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3667"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10405"
FT                   /protein_id="ABK10405.1"
FT                   /translation="MRSKILSIACLVGISITAHAQVACPSGWIPYSATSCGPAPRAQAA
FT                   PTQQAPTFSLATTWGAIATDGVKGVLGTAIGGESERGAARTAMADCQAKGGTTCKVQLT
FT                   YSNGCGAMIVGSKGFSTAGAGTREEAIQKGMAICQTDGDTACRLYYTDCSLPKSAR"
FT   sig_peptide     516274..516336
FT                   /locus_tag="Bcen2424_3667"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 21"
FT   gene            516810..517250
FT                   /locus_tag="Bcen2424_3668"
FT   CDS_pept        516810..517250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3668"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3668"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10406"
FT                   /protein_id="ABK10406.1"
FT                   /translation="MKHFNTCLLWLSVATSFASSVSASGHLPPVDMPPQSFASFDACVE
FT                   HLRQLYAHDLVGAKQGPQQIEGGATREAVVDTKGVVTNERDEAHYDTELGWSIRKPGGD
FT                   AVGNRWMQTNYNFERWSWTCRSASLTGTMESGFTSPSVEPLR"
FT   sig_peptide     516810..516887
FT                   /locus_tag="Bcen2424_3668"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.685 at
FT                   residue 26"
FT   gene            complement(517865..518806)
FT                   /locus_tag="Bcen2424_3669"
FT   CDS_pept        complement(517865..518806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3669"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4694 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3669"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10407"
FT                   /protein_id="ABK10407.1"
FT                   /translation="MADLRDVNLNRLAIFVAVVDAGSLTAAAERLGLAKTVVSTHMQRL
FT                   ESEVGANLLVRTTRRLSVTDAGRVFYDACRDIVRATEAALDAVSSDAGPLRGTLRVSVP
FT                   IDYGALVVAPAVVALRDRHPALAVELVANDRVVDLVADNLDVAIRIGRLADSNYRAVQL
FT                   GTYEKWLVASPAFVARHGLPRDPDALAALPFVMLSSLPRPHTLELDDARGGRASVRCVA
FT                   PVVSNTATACRAIVLAGGGFGLLTDFSTADDVAAGRLVRLLPGWRTAPAGIHAVYPSTR
FT                   LPSPKVRAFIEAMKGKLGEAPTTPTTKRSRSN"
FT   gene            518933..519577
FT                   /locus_tag="Bcen2424_3670"
FT   CDS_pept        518933..519577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3670"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   bcn:Bcen_4693 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3670"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10408"
FT                   /protein_id="ABK10408.1"
FT                   /translation="MSAASKPASPIRVYSFLLSGHAHRVRLFLSLLGLPSKTIDVDLAA
FT                   GAQREPAFLALNPLGQVPVIDDGGTVIADSNAILVYLAKRYGDAHWLPDDPVGAAVVQR
FT                   WLSYAAGPIASGPAAARLVTVFGATLDPEAAKRTAAKVLDVIDRELAGKPFAAGAQPTI
FT                   ADIAAYTYIAHAPEGGVSLEPYPHVRAWLARIEALPGFVAMPTTRAGLLAA"
FT   gene            519613..521691
FT                   /locus_tag="Bcen2424_3671"
FT   CDS_pept        519613..521691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3671"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   pyridoxamine 5'-phosphate oxidase-related, FMN-binding;
FT                   KEGG: bcn:Bcen_4692 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10409"
FT                   /protein_id="ABK10409.1"
FT                   /translation="MNAPTAVVPGWELDTAPFHAGELAVQQRAGVTDAASAAGRRGIRR
FT                   FMPDQHRTFFAQLPFFVLGGVDAHGQPWATLRAGAPGFVTSPDARTLRIAAPALPGDPL
FT                   AGAWQAGAPLGGLGIEFDTRRRNRVNGVVRAVDGDALTIAVEQSFGNCAKYIQGRKPTF
FT                   VARDVEASVAPDVSDALSGADRALLAQADTFFVASANTSAEAGAARGADVSHRGGMPGF
FT                   VRVDDARTLTTPDFSGNRFFNTLGNLQHDPRAGLLFIDFDSGDVLYVAARAEIVWDGPD
FT                   VASFDGAQRVVRFHVREVRRVRAVLPFRWSAVERAPQFAAMAAAATATALGRAAATAGP
FT                   APSAVAPSPAPAWRSLRIAKIVDEARAIRSFHFEPADGGALPAYEAGQHLTLRIALPGS
FT                   DAPAIRSYTLSDAPGGTQYRITVKREGRVSAWLHDHAQAGMTLDAQMPRGRFTFDLASP
FT                   RPAVLVSAGIGITPMIAMLRRALADDTPSRRIVFVHGAREAADRPFAAELARLAAADAR
FT                   LSLHWFDSRPQESTVAQAGRIDIGQLKRVLSFDDYDFYLCGPAAFMRDLYDGLRALNVP
FT                   DERIRFEAFGPSSVSRSATRAAAAPAAASVPVVFRRTGRDAAWTPADGTLLEFAEGQRV
FT                   AVPSECRAGSCGTCATRVLSGAVEYEQTPDAPVEPGCALLCVARPAQGATQPLVLDR"
FT   gene            521761..522015
FT                   /locus_tag="Bcen2424_3672"
FT   CDS_pept        521761..522015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3672"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3672"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10410"
FT                   /protein_id="ABK10410.1"
FT                   /translation="MPSGSTIASTDSIKEPIMKLLGMVRLVLWSFFGVRNSKAHATDLA
FT                   NANFTLLPFVAILLALLVGAVIYGVVHLVVDPTVTMQGF"
FT   gene            522086..522364
FT                   /locus_tag="Bcen2424_3673"
FT   CDS_pept        522086..522364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3673"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3673"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10411"
FT                   /protein_id="ABK10411.1"
FT                   /translation="MTLVSAAGTHDAHRDRIAAVAAGAAVIAPLKPSVLVPVSPRPSFR
FT                   RIPRPFAAPGVKCAPRRDVARRAGRRSDERPASVPAARTGAFEASPA"
FT   gene            522664..524895
FT                   /locus_tag="Bcen2424_3674"
FT   CDS_pept        522664..524895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3674"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: bcn:Bcen_4689 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3674"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10412"
FT                   /protein_id="ABK10412.1"
FT                   /translation="MTVNRTTAAPARRRRAKVGLGVGLGVTLFAAQAAVAQGDTPAPGT
FT                   EAAGNATLPAITVSGERGQPLRAREASVAGLDDAPLRDTPASVNVITRALIDDQQAKRL
FT                   SDVVRNDASVVNDYAPVGYFEGFAIRGFPVDLASAIRIDGLTVSGEQNVPLENKERVEI
FT                   LKGLAGIDSGVVAPGGVINFVTKRSANVASVTGGVDSRGSTSAAIDLGRRFGPDHQFGF
FT                   RINAAKENMHSYIDGTNGRRTFGSIAADWDISPRASLQLNAEFQQWIQRSAPGYQLLGG
FT                   TVVPSVKTTSKALGTQPWAKPVTTDALNLNARFDYQFNDDWKAYVAVGRSRTMIDDNSA
FT                   FAYGCSYAASCAAGATSPFFFGANGDYDVYDFRSPGEYRRNDDLRAVTTGKFATGPLRH
FT                   ELTLGVSVQRRVVHMADAVYDYVGSENIYGPDLTFPPSPNSPGPSYPRLDAWQYGVFGL
FT                   DRISIGEHWQVLAGGKEVLLRQRSWSSLDGETTHTDRSVFLPQVALVYKPVNVLSLYAS
FT                   YSKALSLGDQAPVRATNAYAFLPPVESHQIEVGAKYDWLDRLSLTAAVFSISKPFQFAD
FT                   PDASGTSYTFVQRGTQRHQGIELGAAGRVTERLGLTASVAAIRARAVDSGSPAYEGHQI
FT                   INVPALRASLYADYAVPGVAGLNVLGGVEYSAARNANEEGTARVPSWFVFNLGARYTTK
FT                   IGGHRTVLRVSVDNLFNKFYWRDAGEQQGDAYLFPGAPRTARVSLTYDF"
FT   sig_peptide     522664..522774
FT                   /locus_tag="Bcen2424_3674"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.689 at
FT                   residue 37"
FT   gene            524955..525599
FT                   /locus_tag="Bcen2424_3675"
FT   CDS_pept        524955..525599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3675"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /note="TIGRFAM: nicotinamide mononucleotide transporter
FT                   PnuC; PFAM: Nicotinamide mononucleotide transporter PnuC;
FT                   KEGG: bcn:Bcen_4688 nicotinamide mononucleotide transporter
FT                   PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10413"
FT                   /protein_id="ABK10413.1"
FT                   /translation="MSPLEIAGVIVSALAIWLTAKRRMLCWPVGLASVALYGWIFFDAK
FT                   LYSDMLLQGAFAVLQVYGWQRWLAQRASEADGSADGGAAPAGDVAPVTGVRPLRMLPDL
FT                   IAAVIGSALLGGMMARWTDAALPFVDASLTAFSLVAQYWTARRYIASWGLWIVVNVVYV
FT                   GMFVFKELYLTAGLYALFIGLAVVGWRDWSRTAAALRAAAGGPLASGGGAR"
FT   gene            525636..526826
FT                   /locus_tag="Bcen2424_3676"
FT   CDS_pept        525636..526826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3676"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bcn:Bcen_4687 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3676"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10414"
FT                   /protein_id="ABK10414.1"
FT                   /translation="MSFPLEPDGPLSRDVAPPQFGVDGEQAERDWPLITHDEVAAVLAR
FT                   IDGAGEPVRLTWHSPRQFAAAVLVRMADGRGLFVKRHHASLRDVAGLEEEHRFIAHLRE
FT                   RGVPVVDVLADRNGATAFASGEWTYEVHVLAPGVDPYRGVMSWQPFTHPSHAYAAGRAL
FT                   AELHRASAGYDAPARPVRTLLSSFRVLSSTDLAGALERWVDAQPLLVRALGSRDWRGDV
FT                   ADAIGPYHARLVPLLPALAPLWTHGDWHASNLLWTDAGPGAQVRTVLDFGLSDRTCAVM
FT                   DLALAIERNTVDWMAPADARRVEYDQIDALLDGYESLEPLSDDAYAALVALLPIVHTEF
FT                   ALSEVAYFGCIIDAPAIVDIAYDGYLIGHARWFGERDGRQLLDWLEQRRREKQRIT"
FT   gene            527070..528389
FT                   /locus_tag="Bcen2424_3677"
FT   CDS_pept        527070..528389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3677"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bcn:Bcen_4686 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3677"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10415"
FT                   /protein_id="ABK10415.1"
FT                   /translation="MLKLNLNLVAAIVFVMVATAHAQPLLTPGPGAAAASSATPIGAPP
FT                   SDTLPASSLTLSDALAVAARNNPALRGARADVDASAGALMQAGARPNPEVSFLQEGFSR
FT                   AERTSTALINQTIELGGKRRARLDVASYGREAANASLDEQGAAVRADVIAAFYGLLAAQ
FT                   RQLQVTEESAAIAARSADLAGRRAQAGKVSPVEATKAQVAAAGVQIEVVTARGRVEVAR
FT                   EKLNAVMGEARDDRLAVRGDLETVPPVEPLSALTVQLDDAPLARVARAEMLRSNAAVSL
FT                   ERARRIPDVTVSAGFKRVTTGGVPENQAVVGVSIPIPLFNTNKGALLEATHKAERANAD
FT                   LDRERTRLRLELTQAYANFEAAEQEAQRLKVDILPAARLALDAMSRGYELGKFSFLDVL
FT                   DAQRTLFQGQSQYVRALAGAHAARADIGRLVGTPLAAVAQ"
FT   sig_peptide     527070..527138
FT                   /locus_tag="Bcen2424_3677"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            528416..529885
FT                   /locus_tag="Bcen2424_3678"
FT   CDS_pept        528416..529885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3678"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_4685 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10416"
FT                   /protein_id="ABK10416.1"
FT                   /translation="MSRSRIFVIAAAVLGGAGIVIGALAVTRGGSSASAPPAADAAQPA
FT                   EGAGARGGVVLKRGKLSVEIVMTEKPGDARLVVYPFVDGKPVDKGVTVSGTLVRYDRTH
FT                   EPLRFDAAGQKFVSAQPIAKPHVFDATIDVKAGNDAASFPFARADGAIALTDAQLATSK
FT                   IALAKAGPAQIATPFQLPGEIKFNEDRTAHVVPRVAGIVEQVSVSLGQNVAKGQVLAVI
FT                   ASTDLADRRSELLTAERRLSGARATYERERTLWKERISAEQDYQQAQVQLREAEIAVQN
FT                   ARQKLAALNAPVGAGALNRYELRAPFAGTIVEKHATPGEAIAADASMFVISDLSTVWAE
FT                   MAVPAQRLNDVRVGRDATVSATAFESRSSGPIAYVGSLLGEQTRTAPARVVLPNPDRVW
FT                   RPGMFVNVSVDAGRQAVPLAVASDALQDVDGAPSVFVRSPKGFVAQAVETGRRDERATE
FT                   VLKGLKPGQEYAVSNSFVLKAELGKGSAEHE"
FT   sig_peptide     528416..528493
FT                   /locus_tag="Bcen2424_3678"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.417 at
FT                   residue 26"
FT   gene            530014..533226
FT                   /locus_tag="Bcen2424_3679"
FT   CDS_pept        530014..533226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3679"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: bcn:Bcen_4684 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3679"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10417"
FT                   /protein_id="ABK10417.1"
FT                   /translation="MFERLIRFAIAHRWLVMLAIAAVAALGVFSYQRLPIDAVPDITNV
FT                   QVQINTSAPGYSPLEAEQRITYPVETVMAGLPGLEQTRSISRYGLSQVTVIFKDGTDIY
FT                   FARQLVNERIQEAKDKLPPGIAPAMGPTSTGLGEIYLWTVEADANARKPDGTRYTAADL
FT                   RELQDWVVRPQLRNVRGVTEVNSIGGYVKEYRVAPNPAKLMSYGLTLADVVRALERNND
FT                   NVGAGYIEKRGEQYLVRVPGQARTVDDIANIVLTNVGGVPVRMKDVGVVDIGRELRTGA
FT                   ATSNGEEVVLGTVFMLMGENSRTVSKAVAAKMEDVNRTLPAGVKAIPVYDRTVLVEKAV
FT                   ATVKKNLLEGAVLVIAVLFLFLGNIRAALITALVIPLSMLMTFTGMVNAKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENCVRRLAHAQSAAGRPLTRDERFAEVFGASQEARRALIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAITVVMALAAAMVLTVTFIPAAVALFIGERVEEKENR
FT                   LMGWARRAYEPVLAAFMTRPARVMIGAGAIVLVTLGLATRLGSEFIPSLNEGDLAVSAL
FT                   RIPGTSLSQSVEMQKSIEKTLKARFPEIERVFARTGTAEIAADPMPPNLSDGYIMLKPA
FT                   DTWPDPKKPRDQLVREIEEALAELPGNAYEFSQPIQLRFNELISGVRSDVAVKIFGDDM
FT                   AVLNQTGEQIAAALQKVPGASEVKVEQTTGLPVLTVNLDRDKLARYGVSVADLQDSVAA
FT                   AVGGQKAGTLFQGDRRFDIVVRLPDELRSDIEAIKRLPIALPAPAAGASAPLAAAPYVP
FT                   LAELATIDVAPGPNQISREDGKRRVVVSANVRGRDVGSFVADAREQLQQDVRVPAGYWV
FT                   SWGGQFEQLQSASERLKLVVPLALFMVFVLLFVMFNNVKDGLLVFTGIPFALSGGVVSL
FT                   WLRGIPLSITAAVGFIALSGVAVLNGLVMISFIRNLRDEGMPLDAAVHDGALTRLRPVL
FT                   MTALVASLGFLPMAFATGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRVSHAVSWR
FT                   AALRGGFGAGVLRRLGFFKGNA"
FT   sig_peptide     530014..530106
FT                   /locus_tag="Bcen2424_3679"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.836 at
FT                   residue 31"
FT   gene            533223..533909
FT                   /locus_tag="Bcen2424_3680"
FT   CDS_pept        533223..533909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3680"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bcn:Bcen_4683 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3680"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10418"
FT                   /protein_id="ABK10418.1"
FT                   /translation="MMRILIVEDEPKTGAYLRKGLTEAGYVVDWVEDGITGQHQAETEE
FT                   YDLLVLDVMLPGQDGWTLLQNLRRSKSTPVLFLTARDDVGDRVKGLELGADDYLAKPFD
FT                   FVELTARIKSILRRGQPRDSNTLRVADLELDLTRRKATRQGDTILLTAKEFALLWLLMR
FT                   REGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKIDDAYEPKLIHTVRGMGYVLEA
FT                   RGGAAA"
FT   gene            533906..535330
FT                   /locus_tag="Bcen2424_3681"
FT   CDS_pept        533906..535330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3681"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: bcn:Bcen_4682
FT                   heavy metal sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3681"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10419"
FT                   /protein_id="ABK10419.1"
FT                   /translation="MIARLLPRTLRGRLTALIILSTSVILASSGVALYEALSNRVETTA
FT                   AEQMAGISAALGAHLAEARTTADVARNTDIWIDQLHGHPNMDLAIFDAAGTRLVGTPGF
FT                   RPYAPLMLTNAGRVPVGIAPPGARHQYLLTTVPLAGAGAPVVRVAVQYDRSADVLLLRT
FT                   HAYTIVVIEVFGVVLAAAIAYGIAALGLSPLRRFAARAEQMSSSRLAHPLPELDTSGEL
FT                   KELEHAFNGMLARLNESFTRLSQFSSNLAHDMRTPLTNLQAAAQVVLSQPRSADEYRSV
FT                   IESSIDEYQRLSRMIEDMLFLARSEQAGTSIGVRRLNAAEEAERVAGYYEPLAEDEGVT
FT                   VKVDGHAWVDADLTLYQRALSNLLSNALTYAPRGSVVTIDCVEQGGATTIAVSDTGPGI
FT                   AAEHVGRIFERFYRVDPSRHNSASGTGLGLAIVRSIMDNHGGECGVDSEPGRRTTFWLR
FT                   FPRRPAEPGRPAAIGT"
FT   sig_peptide     533906..534007
FT                   /locus_tag="Bcen2424_3681"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.390 at
FT                   residue 34"
FT   gene            complement(535410..535697)
FT                   /locus_tag="Bcen2424_3682"
FT   CDS_pept        complement(535410..535697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3682"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3682"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10420"
FT                   /protein_id="ABK10420.1"
FT                   /translation="MKTAKFAALFVTATLSLGMATQAAFAQTQTQGKSRTQVVNELKQA
FT                   QHDGVVPISKTQYPPTGEIVARNKELHGISVHGGEKKPQTDNHDNLTAKQ"
FT   sig_peptide     complement(535617..535697)
FT                   /locus_tag="Bcen2424_3682"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            535904..536230
FT                   /locus_tag="Bcen2424_3683"
FT   CDS_pept        535904..536230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3683"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3683"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10421"
FT                   /protein_id="ABK10421.1"
FT                   /translation="MADAPAAFVPIAIAASIAGGAVQTFIPDRKLPRPAIRLALIAVLI
FT                   APLFAGCASTRSDTTATYGAARKPVPADLAPGEQIDYAGHRCGNPNLYVKTHPCVYPLR
FT                   DSAP"
FT   sig_peptide     535904..535966
FT                   /locus_tag="Bcen2424_3683"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.504 at
FT                   residue 21"
FT   gene            complement(536431..537591)
FT                   /locus_tag="Bcen2424_3684"
FT   CDS_pept        complement(536431..537591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3684"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_4679
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3684"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10422"
FT                   /protein_id="ABK10422.1"
FT                   /translation="MKTPVRIVMMSGALLTAAHAAHATEVTLYGLFDTSLTVVWNADAQ
FT                   GRNLVGLGNGNLLGNRFGVKGAEDLGGGLKAIFTLENGFNPNTGALGQGNRMFGRQAFV
FT                   GLESARWGTLTLGRQYDALADVAWPITGDFYFGSVYATPGDVDNYDTSSRTDNAVKYTS
FT                   PVVGGFQFVGMYALGGVAGKSGAGQTWSAGLSYNHGPFDAAGGYYYAANRASLANGVRT
FT                   GWNGTSDGTFDGSLVNGGYLSAKSIGIARGALRYTFAPFTIGIDYSNAQYKADAMTAFR
FT                   STQKYDTARGFFNYQATASLLVGVGYSYTKARGDTSATYHQVSAGADYVLSKRTDLYAV
FT                   GAWQRANGEQRTLDGGTQAAQASIGSYGYGGTRTQGILNLGLRHRF"
FT   sig_peptide     complement(537520..537591)
FT                   /locus_tag="Bcen2424_3684"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            537907..538182
FT                   /locus_tag="Bcen2424_3685"
FT   CDS_pept        537907..538182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3685"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3685"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10423"
FT                   /protein_id="ABK10423.1"
FT                   /translation="MNIPRPLIAIAAAALSIAAFSQAVAAQPKSRQEVIQELVRARHDG
FT                   VIPSPNHDYPASPAAVARNQEIHRSTVHRGEKTPMVDAHDNRFAVL"
FT   sig_peptide     537907..537984
FT                   /locus_tag="Bcen2424_3685"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.614 at
FT                   residue 26"
FT   gene            538244..538732
FT                   /locus_tag="Bcen2424_3686"
FT   CDS_pept        538244..538732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3686"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10424"
FT                   /protein_id="ABK10424.1"
FT                   /translation="MRHVAKGIVLAVCLMSTAAMAAGWPERALSHAPAHDVGRRANERM
FT                   RCEFAAVPAGAWTATFARGQCEVDNGRLTFVPADAGDEKRIVLGDVRTASHQSRKLKEQ
FT                   LQLTTRDEVIALNVLTDDGSRKSREHAIDLWAALRNAGVTPVNGTRIVDTYPTGATTW"
FT   sig_peptide     538244..538309
FT                   /locus_tag="Bcen2424_3686"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(538755..539480)
FT                   /locus_tag="Bcen2424_3687"
FT   CDS_pept        complement(538755..539480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3687"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3687"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10425"
FT                   /protein_id="ABK10425.1"
FT                   /translation="MTPTAKLALLTLPPVLAACFGALAAAWRAPGPKTSSVIQHFTGGI
FT                   VFAAAALELLPQDRAHALFPVVVGFVLGIALMLAIRALSGAIETRFEEARLPVSLIIVT
FT                   AIDLVVDGLVLGIAFSASDESGIILTVALTLEVLFLALSVSAALAAAGVGRMLAIVVPV
FT                   ALAALLSVAAVAGNAAFAGLPANIYAALLGLGTVALLYLVTEELLVEAHEVPETPFATA
FT                   AFFIGFIVFFLIEGSVKAG"
FT   sig_peptide     complement(539406..539480)
FT                   /locus_tag="Bcen2424_3687"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 25"
FT   gene            complement(539646..540941)
FT                   /locus_tag="Bcen2424_3688"
FT   CDS_pept        complement(539646..540941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3688"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: bcn:Bcen_4675
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent enzymes;
FT                   DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3688"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10426"
FT                   /protein_id="ABK10426.1"
FT                   /translation="MTDQAHSNWRLETIAVHGGYRPDPTTRAVAVPIYQTVAYAFDDTQ
FT                   HGADLFDLKVQGNIYTRIMNPTTDVLEQRIAALEGGIGTLALASGQAAVTYAIQTIAEA
FT                   GDNIVSASSLYGGTYNLFAHTLPQYGITTRFADPRDPSSFEPLIDARTKAIFAESVGNP
FT                   LGNVTDIAALAEVAHRHGIPLIVDNTVPSPYLLRPFEHGADIVVHSLTKYLGGHGTSLG
FT                   GAIVDSGKFPWAEHADRFKRLNEPDVSYHGVVYTEAFGPAAYIGRARVVPLRNMGAAIS
FT                   PFNAFQILQGIETLALRVERISDNALKIAQHLARHEHVEWVNYAGLPDHPDHPLVVRYL
FT                   SGRAPGILTFGVKGGRDGGAKFQDALKLFTRLVNIGDTKSLATHPASTTHRQLSPAELA
FT                   KAGVKEETVRLSIGIEHIDDLLADLDQALAQL"
FT   gene            541091..541759
FT                   /locus_tag="Bcen2424_3689"
FT   CDS_pept        541091..541759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3689"
FT                   /product="O-methyltransferase, family 3"
FT                   /note="PFAM: O-methyltransferase, family 3; KEGG:
FT                   bcn:Bcen_4674 O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3689"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10427"
FT                   /protein_id="ABK10427.1"
FT                   /translation="MNQDRWNQVDAYFSATLVPSDAVLDAALAASDAAGLPAINVAPNQ
FT                   GKLLQLLATIRGARRILEVGTLGGYSTIWLARALPPGGSLMTLELNPAHAKVATENIAR
FT                   AGFAQVVSVVVGSAKDSLARLIDAGEAPFDFIFIDADKDNNAVYLDAALKLSRPGTVIV
FT                   VDNVVRNGRVADPDNREPDVVGVREGFARLVAEPALATTAVQTVGQKGWDGFSISIVGA
FT                   "
FT   gene            complement(541769..543040)
FT                   /locus_tag="Bcen2424_3690"
FT   CDS_pept        complement(541769..543040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3690"
FT                   /product="protein of unknown function DUF1176"
FT                   /note="PFAM: protein of unknown function DUF1176; KEGG:
FT                   bcn:Bcen_4673 protein of unknown function DUF1176"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3690"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10428"
FT                   /protein_id="ABK10428.1"
FT                   /translation="MPFGTARRRMRRSLRPAPPADDALAVRHLPPAHPQSIRTVMSHRL
FT                   SLAIAALLAVSPFVAEARPLARPPVERDFKNWSVVCDNGNRCIAESHADDIDDARTSLI
FT                   LRVTRDAGPDAQASLDIYASAPLDLRSARVDGRPFDAMAARWHAFGGKPDDDDAHPFRI
FT                   RTNDPATVAAWLTASRNAQLLSFGDPASAQTARTPLTGLSAALLLIDDTQGRVGTVTAL
FT                   LRPGTRPASAVPVAPALPPAVTPAPAVANLSAAEQRPLVDAVLAKFGGDVKQCAADVED
FT                   EMPAGDRRKASTAVAVSADEALVAIPCQTSSMYNHTDLWYRVRRTAPYSPTAMNFGENA
FT                   NAGLDSASFANELTDAGYDPASATLSSKVRLRSAGDCGSTASWIFDGRHFVLSDIATHG
FT                   TCNGLFDDQWPRLYRRADAAANPH"
FT   gene            complement(543180..543995)
FT                   /locus_tag="Bcen2424_3691"
FT   CDS_pept        complement(543180..543995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3691"
FT                   /product="nucleotidyltransferase-like protein"
FT                   /note="KEGG: bcn:Bcen_4672 nucleotidyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3691"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10429"
FT                   /protein_id="ABK10429.1"
FT                   /translation="MKTDKAMTTVRSAHPIDPVVRARVMAELAEVERRHDVCVLFACES
FT                   GSRGWGFASPDSDYDVRFVYAHRRDWYLSVEPQRDVIERPLDDELDVSGWELRKALQLL
FT                   RRSNPTLLEWLDSPVVYREDARWAPRLRSLASAFFSPVRGRHHYLSMAKKNFRGYLQGD
FT                   TVRYKKYLYVLRPLLAVRWIDMGLGMPPMRFVDLVDGTVHEPTVRAELDALLALKMSAN
FT                   ESEYGPRRPAIHALVETMLADAEHDREYKRPWGDVAMLDAFLRDVVDGR"
FT   gene            complement(544051..545274)
FT                   /locus_tag="Bcen2424_3692"
FT   CDS_pept        complement(544051..545274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3692"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   bcn:Bcen_4671 protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3692"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10430"
FT                   /protein_id="ABK10430.1"
FT                   /translation="MTDMDYQVMELANGKPVKMWTQGVAVEDEARAQLRNTAQMPFIFG
FT                   HVAVMPDVHLGKGSTIGSVIPTKGAIIPAAVGVDIGCGMMAARTTLTAADLPDSLGGLR
FT                   SAIECAVPHGRAPGRRDPGAWGDRTPAAVTDAWKSLQPGFQRIVDKYPKLAKTNHYAHL
FT                   GTLGTGNHFIEVCIDEADRVWFMLHSGSRGVGNAIGSLFIELAQADMRQHIANLPDRNL
FT                   AYFTEGSRHFDDYVEAVGWAQDYARRNRQAMMDAVIGAARGVIAKPFSVDEHAVNCHHN
FT                   YVQRERHFGEDVLVTRKGAVSAQKGQLGIIPGSMGAKSFIVRGLGNPESFCSCSHGAGR
FT                   TMSRTEAKRRFTADDQAKATQGVECRKDAGVVDEIPMAYKDIDAVMAAQRSLVEVVHTL
FT                   RQVVCVKG"
FT   gene            complement(545336..546475)
FT                   /locus_tag="Bcen2424_3693"
FT   CDS_pept        complement(545336..546475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3693"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: bcn:Bcen_4670 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3693"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10431"
FT                   /protein_id="ABK10431.1"
FT                   /translation="MWKRHVVKKNERALLMSEGDFVKVLEPGVFKAFDPFKRLSVQTAR
FT                   LDAPLADEALADYLRHDAPDVLARYFVAMDLADDEAGLRYEDDVLVEILAPGTRRLYWR
FT                   GLTAHRLERIDLAQDSMLPAALVKRIAQPSLRARGVAGLTGVLLAQVPAYHVGVLKVDG
FT                   KIERLLDAGASAFWRFNRDVAVELVDLRLQAIEVGGQEILTRDKVALRLNLSATWRYAD
FT                   VLQAFGQLQKPVEHLYRELQFALRSAVGTRSLDELLEDKQSLDEVVIAHVRARLDGSGV
FT                   DVRSVGVKDIVLPGDMKTILAQVVEAEKSAQANVIRRREETAATRSLLNTAKVMEENPT
FT                   ALRLKELETLERVAERIDRISVFGGLDQVLNGLVSIKGT"
FT   gene            complement(546733..546803)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_R0074"
FT                   /note="tRNA-OTHER1"
FT   tRNA            complement(546733..546803)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_R0074"
FT                   /product="tRNA-OTHER"
FT   gene            547143..548759
FT                   /locus_tag="Bcen2424_3694"
FT   CDS_pept        547143..548759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3694"
FT                   /product="regulator of RNA terminal phosphate cyclase"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; regulator of RNA terminal phosphate cyclase;
FT                   ATPase associated with various cellular activities, AAA_5;
FT                   SMART: AAA ATPase; KEGG: bcn:Bcen_4669 regulator of RNA
FT                   terminal phosphate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3694"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10432"
FT                   /protein_id="ABK10432.1"
FT                   /translation="MRKTVAIGFLGTVLDQGGRAPRRYRKWRPTISLCEQPDLPIDRLE
FT                   LLHSLDYTRLANQVRDDLARVSPRTDVRLTPVTIHDPWDFEEVYATLHDYARAYPFDLE
FT                   HEDYLIHITTGTHVAQICWFLLAEARYLPARLVQTGPPQRTDEGPSGPGTISVIDLDLS
FT                   RYNRIAQRFTRERDETVSFLKAGIATRNARFNALIEQLERVAVRSRAPMLLVGPTGAGK
FT                   SFLAKRVYELKRGRHRLAGPFIEINCATLRGDAAMSTLFGHVKGAFTGAQSARAGLLRA
FT                   ADGGLLFLDEIGELGLDEQAMLLKAIEEKRFLPVGADVEATSDFELIAGTHRDLRQMVA
FT                   AGTFREDLYARINLWTYELPGLAERREDIEPNLEFELDRFGREQGEQVRFNVEAKRRYL
FT                   AFAASPRATWAGNFRELSASVTRMATLADAGRITEALAEQEVERLTRTWSSPGGASMAD
FT                   ACVDAVFGARAAELDLFDRAQLERVLDVCRTSASLSEAGRTLFAVSRQSKKQPNDADRL
FT                   RKYLARFGLDWDGVRRALDGV"
FT   gene            548843..549382
FT                   /locus_tag="Bcen2424_3695"
FT   CDS_pept        548843..549382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3695"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10433"
FT                   /protein_id="ABK10433.1"
FT                   /translation="MIEIPLTVRPLFVAAGWCGPADGRLSARDGEHPGDAILREFGTLI
FT                   VGAEPARRSGETCAPMGIAFRALERQDEQIAAWERALDTTMIGIAEDDLGYVEFYVDTQ
FT                   GRVFTTNCVMDGVYLAGFTFGDAIERTLLGRVSIPLLLDKQASIAYYGAHLTGDDPRVM
FT                   TAAQLRAGNDGSRAAP"
FT   gene            complement(549395..549991)
FT                   /locus_tag="Bcen2424_3696"
FT   CDS_pept        complement(549395..549991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3696"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3696"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10434"
FT                   /protein_id="ABK10434.1"
FT                   /translation="MPFPLHPATVRALLECYLRAKDLNQAALIADCFAANAELSFSLAN
FT                   DDIDFPPRVTGAAAIAHTLVEAFGERFEQCRTYYVCTTPPVDEHGVSSMPWLVVMRQKD
FT                   SGALRIGHGTYRWQFAIDGENDDVARVAALHIHIARMDTIDDPQSLKLDRLHAAFGYPW
FT                   LPVHAFARGLADIAAAHSDWAFLAPFQEAAASAIG"
FT   gene            550131..550673
FT                   /locus_tag="Bcen2424_3697"
FT   CDS_pept        550131..550673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3697"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: bcn:Bcen_4666
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3697"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10435"
FT                   /protein_id="ABK10435.1"
FT                   /translation="MAKQQEESVLTITNPACLIDGTDTEFRHLINGLLPFAARLLSVRD
FT                   GFGSLIGLTGIQYSLLVSVAHLSHDDVVTVNRLADHLHLSGAFVTIETGKLKKLGLIDK
FT                   RPDPDDKRKMRLTVTPAGSKLLKALVDTQQRINNVLFEGVTKTEFKALCSVIDRLVTNG
FT                   DRATLDLAHMIARQEKG"
FT   gene            complement(550693..552003)
FT                   /locus_tag="Bcen2424_3698"
FT   CDS_pept        complement(550693..552003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3698"
FT                   /product="cysteine desulfurase IscS"
FT                   /note="TIGRFAM: cysteine desulfurase IscS; PFAM:
FT                   aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   bcn:Bcen_4665 cysteine desulfurase IscS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10436"
FT                   /protein_id="ABK10436.1"
FT                   /translation="MLRGSRECPRTLRQPYSPALATHAKRRFPESLSMQSRPIYMDYSA
FT                   TTPVDPRVVDKMVPFLHEQFGNPASRSHSYGWDAEQAVEEARAHVAALLGADPREIVWT
FT                   SGATEGNNLAIKGAAHFYQGQGKHLVTVKTEHKAVLDTCRELERQGFDVTYLDVREDGL
FT                   LDLDGLRQALRADTILVSVMLANNETGVIQPVAEIGALCRARGIVFHCDAVQAAGKIPV
FT                   DVNALNVDLLTVTAHKVYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPTHQI
FT                   VGMGEAFRLAKKEMAEESRRVGALRDRLLAGLSTLDEVYVNGDLARRIPHNLNVSFNFV
FT                   EGESLIMGIKGVAVSSGSACTSASLEPSYVLRALGRSDELAHSSIRFTLGRFTTEAEVD
FT                   SVIAQVRDTVGKLRELSPLWDMHLEGVDLDTIEWAAH"
FT   gene            552132..552707
FT                   /locus_tag="Bcen2424_3699"
FT   CDS_pept        552132..552707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3699"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: bcn:Bcen_4664 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3699"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10437"
FT                   /protein_id="ABK10437.1"
FT                   /translation="MRIPQGNPEMQPKENEMSENHAGTGADADEQRRFRAALSMFATGV
FT                   AVITAPRKEGMPIGITVASFNSVSLDPPLILFSVDRRSLSLGDLAGADGYAVNVLDETQ
FT                   QHLSNSFAKANGDKWGWRGGAAGDDGMVLLPDALATFECEPYAQYDGGDHVIFVGRVTR
FT                   HRARSDGRPLIFFGGRYRALDGAHAPSM"
FT   gene            552743..554221
FT                   /locus_tag="Bcen2424_3700"
FT   CDS_pept        552743..554221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3700"
FT                   /product="4-hydroxyphenylacetate 3-hydroxylase"
FT                   /note="PFAM: 4-hydroxyphenylacetate 3-hydroxylase; KEGG:
FT                   bcn:Bcen_4663 4-hydroxyphenylacetate 3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3700"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10438"
FT                   /protein_id="ABK10438.1"
FT                   /translation="MIKNGTQHIASLRDGRQVYLNGQPVGDVTAHAAFRNSIRSYASLY
FT                   DYQARDENVEKMTFVSPDSGNRVSRIWQLPTSYDELVERRAALEAWSELHYGFMGRSPD
FT                   HVASCLSGMYMGADVFEQYDPARAGALRDYYRYARDNDLFLTYVIVNPQANQSKAAHEQ
FT                   EDKYLAVGIVDQDAEGITVRGAKMLATSGIMANEVFCSCIQPLREGDEMYALSFAVPMN
FT                   AKGMKIMSRKSYEESATSVFDNPLSSRFDENDAVLYFDDVKVPWERIFVAGNTAMCAKQ
FT                   FHATPAHVYQNYQCQVRLMTKLRFLVGLGLKISEVNGTNTFPQVRETLGQLAAEASMVE
FT                   AWVYGMEAKGTVVNGFYVPDRNMLYGSQVVTQQLYSKVLNTLRELAGGGMIMLPSSVRD
FT                   FENPDLLRIIEKTQKSPVCSSEERVKFFKLAWDAVGSEFASRHNQYELFYAGASFVTKG
FT                   HAYRTYDWQRASHLVDSMLGSYSLNQELSTPRAA"
FT   gene            554218..554658
FT                   /locus_tag="Bcen2424_3701"
FT   CDS_pept        554218..554658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3701"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3701"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10439"
FT                   /protein_id="ABK10439.1"
FT                   /translation="MTSRIATPFTRYRNQERQMAINKLHDEFHTLDMQRDWRLPEGYDP
FT                   ASGAQELILSGALDTERKRGSRTRLLRLPAGLHTKQPFVHDYWEEVFLVEGDLTVGNDE
FT                   HGDGGTPFKGYTYAVRPPGAWHGPFKSNGGCVLLEIHYYDPA"
FT   gene            554672..555412
FT                   /locus_tag="Bcen2424_3702"
FT   CDS_pept        554672..555412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3702"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10440"
FT                   /protein_id="ABK10440.1"
FT                   /translation="MTDGGPLYRAARDEEHSMKTITFAIDGRDGRTERAIAIHTLVIAG
FT                   WTGRDTVAMERHIRELEALGVKRPAATPVFYRVAADRLDPSPAIQVSGGQSSGEAEFVL
FT                   VRDGGDTFVGIASDHTDREVETYGITVSKQMCGKPCANTLWRLDDVTGHWDRLVLRAYA
FT                   TIDGERVLYQEGSVTAMRTPDDLLAQFARDGGRFEDGTAMLCGTLAAIGGIRPAERFEV
FT                   ELEDPVLGRTIRHVYAVDTLPVAG"
FT   gene            complement(555438..556190)
FT                   /locus_tag="Bcen2424_3703"
FT   CDS_pept        complement(555438..556190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3703"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bcn:Bcen_4660 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3703"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10441"
FT                   /protein_id="ABK10441.1"
FT                   /translation="MTRADADLLYTDPRLVAVYDLFNAGDRDFAFYAAAIGAARRRILD
FT                   LGCGTGTFARRLAAAGHDVVAIDPAPAMIDYARRQPGADAVRWFACALDGLPPGAPFDA
FT                   VVMTGHAFQCLLTDDDIDATLRGVRRVLDDGGCFLFDTRNPRTEPWRAWTPAQSARSVE
FT                   SHELGIVDLHHAARAIDGAIVTFDTHYRFRRDDTLLANTSRLRFIAHAELQARVTAAGF
FT                   VSADWYGDWEHAPFDEATSAEIIAICRA"
FT   gene            complement(556204..556830)
FT                   /locus_tag="Bcen2424_3704"
FT   CDS_pept        complement(556204..556830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3704"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bcn:Bcen_4659 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3704"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10442"
FT                   /protein_id="ABK10442.1"
FT                   /translation="MFDLTTLTTFTAVVLGLFLIPGPAVLLVLSRTVQGGRKTGILTGL
FT                   GVASGDFVHTLFAAVGLSALLMTSALAFNVVKLVGAAYLIYLGVRALLEKPSDPSLPQV
FT                   SPVTPLKAYLQAIPAEVLNPKTALFFLAFMPQFVHPERGSTFVQFAVLGLIFVVLSSLY
FT                   TTLIACSIRPLGRIVKRLTWLTRWQGKIIGSIFIALGLRVAVQQR"
FT   sig_peptide     complement(556750..556830)
FT                   /locus_tag="Bcen2424_3704"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.446 at
FT                   residue 27"
FT   gene            556997..557797
FT                   /locus_tag="Bcen2424_3705"
FT   CDS_pept        556997..557797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3705"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   Cupin 2, conserved barrel domain protein; KEGG:
FT                   bcn:Bcen_4658 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3705"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10443"
FT                   /protein_id="ABK10443.1"
FT                   /translation="MRDLPSITDPAADADVYHVPRPLVVFGGSVVEPEWRLERHSHRQA
FT                   QLLYTLSGVIYCEIDGGVWTAPPQCTVWIPGDVPHAARGSAGATFYAVLVEPDAALDLP
FT                   TRCCTLAMSPLLRELLLKAASFPNLYDVDGPQGRLVATLLDELVAAPVEDLYLPMPADR
FT                   RLRKLIDHLLDDPADKSPLPELARRAGISERSLTRLATKELGMSLGDWRRRLHVALSLR
FT                   MLTTGRRVHQIAIDLGYESASSFVTMFRKATGKPPTQFLTDRQR"
FT   gene            557918..558337
FT                   /locus_tag="Bcen2424_3706"
FT   CDS_pept        557918..558337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3706"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3706"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10444"
FT                   /protein_id="ABK10444.1"
FT                   /translation="MQITTTEFPFVWLRYSGSTHTDPARLIAELDALLARRERFVLLTD
FT                   DAPSGDDRADNDHEMRKQLAKWSKANRALSREWIPGMIAIEPNAARRVALNAFSGAFEK
FT                   VWGYPLNAAASRDDALALAQRLLAEPAPGIAAANA"
FT   gene            558444..559448
FT                   /locus_tag="Bcen2424_3707"
FT   CDS_pept        558444..559448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3707"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4656 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10445"
FT                   /protein_id="ABK10445.1"
FT                   /translation="MDNPIRAMRIFTRIVEMNSFTRAAQALGISRATATRTVQELEAAL
FT                   GMPLLVRTTRALRPTPEGDAYYRRCVSITADVDELEASIRGAALHPSGPLRVELPASVA
FT                   STIVLPALGEFHARHPDLELTLAVAGRAGDRIGDAIDCSIRLGALPDSSLVARRLGSLE
FT                   RVTCASPAYLDRFGVPRTPDDLGAHRAVGGSHVFGQRSAELEFVVDDAVRKVRLDGIVS
FT                   VDDEQAYLACGVHGLGLIQPTRVAAQPLIDAGRLREVLAGWQPDALAVSAVYVKRPHVS
FT                   PGVRAFVDWIAERFVQAGYEQEGLAAAGAVGWRPALPGAAATGDRYSGLVAVA"
FT   gene            complement(559680..560600)
FT                   /locus_tag="Bcen2424_3708"
FT   CDS_pept        complement(559680..560600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3708"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4655 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10446"
FT                   /protein_id="ABK10446.1"
FT                   /translation="MADTVQPADLGFFSTLAASGSLSAAARELGLTAAAVSKRLTQMER
FT                   RAGVTLVNRTTRRMMLTPEGDVYLEYARRILDQMDELGELLGSAKQRPKGLLRVNATLG
FT                   FGRSHVGPAISRFVARYPEVSVQLQLSVMPPPLTDDAFDVCIRFGEPPDTRVVARRLAP
FT                   NRRLLCAAPAYLARHGVPGTPHDLTRHNCIGIRQGDEGYGVWRLTSGRGAARHTEAVRI
FT                   NGNLTTNDGEIAVKWALDGHGILMRAEWDLRDYLADGRLVVVLPDHETPSADIYAVYAQ
FT                   RHQMSTRIRAFVDFLAEELGRLRAV"
FT   sig_peptide     complement(560520..560600)
FT                   /locus_tag="Bcen2424_3708"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.593 at
FT                   residue 27"
FT   gene            560709..561791
FT                   /locus_tag="Bcen2424_3709"
FT   CDS_pept        560709..561791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3709"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="KEGG: bcn:Bcen_4654 tartrate dehydrogenase; TIGRFAM:
FT                   tartrate dehydrogenase; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3709"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10447"
FT                   /protein_id="ABK10447.1"
FT                   /translation="MKTYRIATIPGDGIGKEVVPAGKQLLEALARSSDRFAFEFEDFDW
FT                   GADYYRRHGAMMPADGLDALRGKDAILFGSAGDPDVPDHVTLWGLRLKICQGFDQYANV
FT                   RPTRILPGIDAPLKRCGPDDLNWVIVRENSEGEYAGVGGRVHQGHPIEAATDVSILTRA
FT                   GVERIMRFAFRLAQSRSRKLLTVITKSNAQRHAMVMWDEIAKQIAQEFPDVTWDKELVD
FT                   AATARMVNRPASLDTIVATNLHADILSDLAAALAGSLGIAPTGNIDPERRYPSMFEPIH
FT                   GSAFDIMGKGLANPVGTFWSVVMLLEHLGETEAAARVMHAIEAVTADPSLHTRDLGGSA
FT                   TTAQVTAAVCERVANAAIAA"
FT   gene            561967..563277
FT                   /locus_tag="Bcen2424_3710"
FT   CDS_pept        561967..563277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3710"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4653 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3710"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10448"
FT                   /protein_id="ABK10448.1"
FT                   /translation="MQADLETRVARKLMWRIIPFVMLLYFVSFLDRVNVGFAAMTMNNA
FT                   IGLSPTAFGFGGGLFFIGYFLFEVPSNLILHRVGARIWIARVMITWGIVSAVSAFAAGP
FT                   TSFYVLRFLLGVAEAGFFPGIILYLSLWFPAKQRAVAAAWFMAAAPISTAIGSPLSGAI
FT                   MQMPPMFGLADWQMLYIVEALPAVVLGFVVLKRLTDAPSQAAWLRADERDWLIAKLKAE
FT                   ADARHTHAGHTAGAWQALRDPRVLALALIYFGTSAGLYTLGLWAPLMVKQFGFSALQTG
FT                   LLTGIPSIAAVVAMIGWARHSDRTGERTWHVVIPCVLACIGFVFAGQASTALLTVLALV
FT                   VVNIGISAAKAPLWAMPSAFLSGAGAAAGIAMINSIGNLGGFVGPFAIGWLKHATGGYA
FT                   AGLYVVAGTLAVSAVVTLMLSRKGVREAAVPGVRHHS"
FT   gene            complement(563398..564078)
FT                   /locus_tag="Bcen2424_3711"
FT   CDS_pept        complement(563398..564078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3711"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3711"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10449"
FT                   /protein_id="ABK10449.1"
FT                   /translation="MRHGRAGCPCGASLRTQPAASPLPACPLSRRIRIPPRDASTALHR
FT                   RASHGKLRIVRFLRRLMTILTVIHLNGPINSGKTTIGRALARVLPDARFIDGDDHDAPE
FT                   DAPFDVQWAIALERLVTQVTTARERHLVIAYPIGEAEFERLRAACDARDARLFVVTLAP
FT                   PEAVAASNRGSRALTDWERNRIAEMYREGYAARAFSEMVLDTSDATPDACAARIAQQVA
FT                   ATAS"
FT   gene            complement(564112..565449)
FT                   /locus_tag="Bcen2424_3712"
FT   CDS_pept        complement(564112..565449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3712"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG:
FT                   bcn:Bcen_4651 argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3712"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10450"
FT                   /db_xref="GOA:A0AYH4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AYH4"
FT                   /protein_id="ABK10450.1"
FT                   /translation="MSTILESLPTGQKVGIAFSGGLDTSAALHWMKLKGAVPYAYTANL
FT                   GQPDEDDYDAIPKRAIEYGAAGARLIDCRAQLVAEGIAALQSGAFHITTAGVTYFNTTP
FT                   IGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLVNPDLKIYKPWLDQTFI
FT                   DELGGRAEMSEFMNQAGFAYKMSAEKAYSTDSNLLGATHEAKDLESLESGIKIVNPIMG
FT                   VAFWRDDVKIAAEEVTVRFEAGQPVALNGVEFKDQVELLLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGLALLYIAYERLVTGIHNEDTIEQYRENGRRLGRLLYQGRWFDPQ
FT                   AIMLRETAQRWVARAITGEVKIELRRGNDYSILSTKSPNLTYQPERLSMEKVASTFSPR
FT                   DRIGQLTMRNLDITDTRDKLRVYSQVGLLTPGETSALPQIKGDGDK"
FT   gene            complement(565767..566837)
FT                   /locus_tag="Bcen2424_3713"
FT   CDS_pept        complement(565767..566837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3713"
FT                   /product="membrane protein"
FT                   /note="KEGG: bcn:Bcen_4650 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3713"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10451"
FT                   /protein_id="ABK10451.1"
FT                   /translation="MTAPLPTRLPPLVRHALRPLLDPYRRYRHAKLIHAARVALAVLVS
FT                   IALSTGLNVPHGEWSTITVLIVVGGLQHHGNIRKKAAERALGTSIGALAGLGLILLYSF
FT                   LHAPFAIYLLMAVWCGVCAYHAIGKAGYIALLSAITMVIVAGHGDNEIVDGLWRAVNVL
FT                   AGIAIALAFSFALPLYATYSWRYKLADALRACAAVHARLAGDRQVTDDAHLKEMAALST
FT                   LLVQLRSLMPSVSKECETSMTQLEAIQRSLRLCIGYLEILSSALPAADDVAAREYMRVE
FT                   MKTLNRRIRDTLVGASRALKFGTPSRLAPRRRPVDPLHDAPPPQLSGYVSITAKLAGEV
FT                   DQLRERLLDTARSWNI"
FT   gene            complement(566986..568518)
FT                   /locus_tag="Bcen2424_3714"
FT   CDS_pept        complement(566986..568518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3714"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bcn:Bcen_4649 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3714"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10452"
FT                   /protein_id="ABK10452.1"
FT                   /translation="MKSFPLPATLRRHTASIVARILSPRGVLVAGIVLLMFSWGLSTSL
FT                   LIEARRDAYGHAVENARNLMLLIERDIARNIELYDLSLQNVVDGVADPELMTLPPRQRH
FT                   RLLFDRAATGAYLGSIFVMDAHGNIAIDSSASPARQGNFADRDYFTVHRDRLAPGLYIS
FT                   RPYASRLRGGALTIALSRRINRPDGTFGGIVVGTLSIDYFRALLDGLAVGRHGSAAIVE
FT                   DNGTLVSRLPYDTRVVGLDLHDSPLFIDAQRSRTGELTGVGAIDGVRRVYVYKHLAGLP
FT                   LIVDVAPAEIDIYASWHHRAIWTIVLMSLFTAFIAWGSLALSRELKRRQEAEAKLYRLA
FT                   HTDSLTGLDNRGTFDTVLAKETQRASRSGRPLSVLFVDVDHFKAFNDYYGHPAGDDVLR
FT                   QVAQSLSRCLRRDSDHVARYGGEEFVVTLPDTDGPGAATVAEGIRRAIAELGIEHVKSQ
FT                   YGRVTVSIGTATADDGRMNAATLLRRADEALYRAKSGGRNRVLDAQSTAADA"
FT   gene            569023..570639
FT                   /locus_tag="Bcen2424_3715"
FT   CDS_pept        569023..570639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3715"
FT                   /product="lysine:proton symporter, AAT family"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bcn:Bcen_4648 amino acid permease-associated region; TC
FT                   2.A.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3715"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10453"
FT                   /protein_id="ABK10453.1"
FT                   /translation="MHRRTRPALRYRMRRLRMPACSTFVSFMSAIPNSDPPGSSANPPK
FT                   LHRALKARHLTMIAIGGSIGTGLFVASGASISQAGPGGAMVAYMLIGLMVYFLMTSLGE
FT                   MAAFMPVSGSFATYGAKYVDEGFGFALGWNYWYNWAVTIAVELVAAQLVMHYWFPDVPG
FT                   VWWSAAFLAVMFLLNALTVRGFGEAEYWFALIKVVTVVAFIGVGLLMIFGILKGAPANG
FT                   WGNLTIGDAPFAGGLPALMGVAMIAGFSFQGTELIGVAAGESENPRTTIPRAVRQVFWR
FT                   ILLFYVFAIFVIGVLIPYTDPNLLKTDVTDIGVSPFTLVFRHAGLAFAAGVMNAVILTA
FT                   VLSAGNSGMYASTRMLYNLATEGRAPKVFAKLSPGGVPRNALYATTAVGALCFFTSLYG
FT                   DKTVYLWLLNTSGMTGFIAWLGIAVSHYRFRKGYVKQGYSLDQLPYQSKWFPFGPLFAF
FT                   VLCLVIALGQDYQAFLANRIDWAGVAATYVGIPLFVVVWLGFRFLKKSRFVRYEDMEIA
FT                   PWIAASRGAQRQPVTNRETTG"
FT   sig_peptide     569023..569127
FT                   /locus_tag="Bcen2424_3715"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.902 at
FT                   residue 35"
FT   gene            570871..571149
FT                   /locus_tag="Bcen2424_3716"
FT   CDS_pept        570871..571149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3716"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3716"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10454"
FT                   /protein_id="ABK10454.1"
FT                   /translation="MARGARNPEESMSASPAERKAGPVSIVRIEAAINAWREVYPPAPD
FT                   GEDGYALDAGSNCLAELYGTMICYQLPDVPLDSLSHEQRDALYATEV"
FT   gene            571349..572329
FT                   /locus_tag="Bcen2424_3717"
FT   CDS_pept        571349..572329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3717"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4646 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3717"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10455"
FT                   /protein_id="ABK10455.1"
FT                   /translation="MRTLSARRRMSVRCLSREDSNMELRHLRYFVAVAEERNFTRAAER
FT                   LHIAQPPLSRQIQQLEEALGVPLFERTARPLKLTDAGRFFYSHAVQLLAQTTELESMTK
FT                   RVGKIERSMSVGFVGSTLYGMLPKIIRRFRSEYPAVELSLHEMSTMDQIKALKEGRIDV
FT                   GFGRIRHEDPSVRRVVLREERMIVALPVGHVLDSAKPVLSLHDLVNDTLIIFPKAPRPS
FT                   YADQVLAAFHDRALQPRRIYETRELQIALGLVAMGEGVSVVPQSVYGLKRDDISYKPLD
FT                   DPNLVSPIIMSMRMLDESEDIRAMQALIYRLYDEAQMEYLPPQPE"
FT   gene            572440..573237
FT                   /locus_tag="Bcen2424_3718"
FT   CDS_pept        572440..573237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3718"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_4645
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10456"
FT                   /protein_id="ABK10456.1"
FT                   /translation="MTDIVTEETTIETPQGRLFAKRWHAGPARHAAAPIVLLHDSLGCV
FT                   DLWRDFPAQLARVTQRDVIAYDRLGFGRSDRHPGTLGTTFVRDEADHAFAAVLEQLGVD
FT                   AFVAFGHSVGGGMAVGCAAAHPARCRSLVTVAAQAFVEDRTLAGIRDAGRQFDEPGQLD
FT                   RLARYHGDKAEWVLRAWVDTWLSPAFRDWSLDDDLPRVQCATLAIHGEDDEYGSDVHPK
FT                   RIAARVAGASSFLLLARCGHMPHRERTDDVLAAVATLLRDAGA"
FT   gene            complement(573276..573629)
FT                   /locus_tag="Bcen2424_3719"
FT   CDS_pept        complement(573276..573629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3719"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3719"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10457"
FT                   /protein_id="ABK10457.1"
FT                   /translation="MATTHQHFHPELRHATAPTYFISYLFPALLFVYELLRVGQWIRDH
FT                   GMQFVAFKQMGYEYLLMLLFVGLQIVVEAIFLLGAAMRKDHRDFEHRLPNVILGIGLSI
FT                   VLLAIDLAIQLSF"
FT   gene            complement(573816..574436)
FT                   /locus_tag="Bcen2424_3720"
FT   CDS_pept        complement(573816..574436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3720"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_4643
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3720"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10458"
FT                   /protein_id="ABK10458.1"
FT                   /translation="MTIPTDDPGRRARKRIQMLAHLAGTGARLFDAHGYEAVTMEQIAA
FT                   EADVAKRTLYNHFPTKEAVLAHWLEGELARDLAYLQRDVARRKTFASRMGCVLDASAAW
FT                   CEQHPVYLLAYLRHRFLSIGAAEPERAGENGSDIALVWQQLIAAGQQSGELNAALRADQ
FT                   LATWFHHLYLAAMLRWLTVPGLSLKREFQSVAKLFIEGAEAKR"
FT   gene            574532..575773
FT                   /locus_tag="Bcen2424_3721"
FT   CDS_pept        574532..575773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3721"
FT                   /product="glycosyl transferase, family 28"
FT                   /note="PFAM: glycosyl transferase, family 28; KEGG:
FT                   bcn:Bcen_4642 glycosyl transferase, family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3721"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10459"
FT                   /protein_id="ABK10459.1"
FT                   /translation="MKLVIATYGTEGDTRPLAALGRALMDAGHEVRLLADAATLGSAAA
FT                   LGVPSAPLSGDIRHAIAPEGALADAVRGRGGFNDTSKALAAIANANTAAWMREVVDASA
FT                   GCDALLVSGLVSFVGLSVAEYRSIPAIGTGMIPITPTAEFASPFLPPGKVPRWLNRASH
FT                   RLVNALLWQAFRKSTNAARAGVCGLPPRQHVWTDHPMLYGVSPALLSGPADWPSNVQAC
FT                   GQWRIDARAWAPSPELAAFLDAGEPPVYIGFGSMAGFDRAAMAAALTQALAGRRALFYP
FT                   GWSGIDASLLPAHVRVIGDTPHDWLFPRVAMAVHHGGSGTTHSAARAGIASVVVPFAGD
FT                   QFFWGNRLQRLGVAAAPVAGRRMDAVALARAIAFAEQGETKARATELGARVAQEDGLKR
FT                   AVSAIERWVRPRAR"
FT   gene            complement(575794..576489)
FT                   /locus_tag="Bcen2424_3722"
FT   CDS_pept        complement(575794..576489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3722"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR, HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG: bcn:Bcen_4641
FT                   transcriptional regulator, histidine utilization repressor,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3722"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10460"
FT                   /protein_id="ABK10460.1"
FT                   /translation="MTTPIYQEIKDFILARIHAGEWAEGDQVPSENELAREFNVARMTV
FT                   NRALRELTAEQVLTRTRGSGTYVASPKYESTLVAIRSISDEVAARGHGYRAQVLQVGAA
FT                   VADAKLADELQLDTGSPIFHSRVLHFENDTPVQLEERWVNPACAPEYALQDFTTTTPNQ
FT                   YLTRVAPLQRVEYRIEAAMPDAETRRHLTMDDREPCLLLHRRTWSQGLVASVANLWHPG
FT                   SRYRFTGHF"
FT   gene            complement(576671..577798)
FT                   /locus_tag="Bcen2424_3723"
FT   CDS_pept        complement(576671..577798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3723"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_4640
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10461"
FT                   /protein_id="ABK10461.1"
FT                   /translation="MKKAVVGTLSLAFVSAVAHAQSSVTLYGMLDAGIAYTNNQSGKHA
FT                   WQQGSGLLSNTVFGLSGNEDLGGGLHALFRLESGFNLNNGMQSYRNTLFGRRAYVGLQS
FT                   DQYGTLTLGRQYDAVVDYLGPLAMANNGDGNNLASHPFDNDNLDDSFYIDNAVKYASPT
FT                   LAGWQFGGLYGFGNAAGGFANNRAYSAGVSYANGPVSLGAAYLQLNRGGLTTGGALSAN
FT                   DAPNFPAVRQRVMGAGGSYAFDRLTIGALWTHTMFDETAASSLPGALNALRFDNYEVNA
FT                   RYALTPAVSFTGAYTFTDGRYDDATDSHRPKWHQATLMADYALSKRTDAYAETVYQHAF
FT                   GVPSGATLGFANVTGLAASSTRTQVVATVGIRHRF"
FT   sig_peptide     complement(577736..577798)
FT                   /locus_tag="Bcen2424_3723"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            complement(577935..578165)
FT                   /locus_tag="Bcen2424_3724"
FT   CDS_pept        complement(577935..578165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3724"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3724"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10462"
FT                   /protein_id="ABK10462.1"
FT                   /translation="MLLSIRIEADDLALVRRRLHQAVGAALNFYTAALDHRTGCACIEL
FT                   EVPRSQASPAILSILRVLPAAEFGTIRLLQH"
FT   gene            578916..579605
FT                   /locus_tag="Bcen2424_3725"
FT   CDS_pept        578916..579605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3725"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_4638 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3725"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10463"
FT                   /protein_id="ABK10463.1"
FT                   /translation="MIFQGFGPLLWAGTVETVKLAVLSLAASLILGLAGAAAKLSANRV
FT                   LKSVGTFYTTLIRAVPDLVLMLLLFYGIQILLNNVTDLLGWDQIDIDPFAAGVVTLGFI
FT                   YGAYFTETFRGAFLAVPRGQLEAGFAYGMSGWRVFHRILFPQMMRFALPGIGNNWQVLV
FT                   KATALVSIIGLADVVKASQDAGKSTLDFFFFTLAAGAIYLAITTVSNVVLHHLEKRYSV
FT                   GVRRLAL"
FT   gene            579602..580315
FT                   /locus_tag="Bcen2424_3726"
FT   CDS_pept        579602..580315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3726"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_4637 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3726"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10464"
FT                   /protein_id="ABK10464.1"
FT                   /translation="MIELVGQYWQSYLYSDGYRFSGLAITLWLLVVSIALGFALAVPLA
FT                   IARASSNRWISGPVWLYTYVFRGTPLYVQLLMCYTGIYSLQVVHDHVLLDTFFRNAMNC
FT                   TLLAFVLNECAYATEIFAGAIKATSAGEIEAGMAYGMSRFKLYTRIVLPSALRRSLPSY
FT                   SNEVILMLHATTLAFTATVPDILKVTRDVNSATYMSFQAYGIAAVLYAVVVFALIWAFR
FT                   KLETRWLAYLSPRGH"
FT   gene            580349..581116
FT                   /locus_tag="Bcen2424_3727"
FT   CDS_pept        580349..581116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3727"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_4636 ABC transporter related; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3727"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10465"
FT                   /protein_id="ABK10465.1"
FT                   /translation="MYKLTVDNLHKKFGDNEVLKGVSMRAKAGDVISIIGSSGSGKSTF
FT                   LRCINFLEQPCSGQITIGSEPIQTTRDRNGSLRVADQKQLQRMRTKLSMVFQHFNLWAH
FT                   MTVLENVIEAPMAVLGVGKDEAIDRARKYLEKVGLAPRVEGMYPSHLSGGQQQRVAIAR
FT                   ALAMEPEVMLFDEPTSALDPELVGEVLKVMQKLAEEGRTMVVVTHEMGFARNVSNHVIF
FT                   LHQGKIEEEGDPQQILVNPKSERLGQFLSGRLK"
FT   gene            581200..581634
FT                   /locus_tag="Bcen2424_3728"
FT   CDS_pept        581200..581634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3728"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: bcn:Bcen_4635 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3728"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10466"
FT                   /protein_id="ABK10466.1"
FT                   /translation="MSTPTTTAFSHVKPQDTVFQGEGLRDFFLYRDLGIAAATNGKVVA
FT                   QLVRANHAPEAGTGWHRHEAEFHIVIMLKGWARFMYGEQETLVAAGDCVHQAPGIVHYL
FT                   FDYSPDMEYLEIVGPADFKSIDVDGPCAVPEPTPWGEAGA"
FT   gene            581929..582066
FT                   /locus_tag="Bcen2424_3729"
FT   CDS_pept        581929..582066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3729"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10467"
FT                   /protein_id="ABK10467.1"
FT                   /translation="MNRIAKILTATALACAVLVPALAEAHSHRVCHFDHHHHRVCRWVR
FT                   "
FT   sig_peptide     581929..582000
FT                   /locus_tag="Bcen2424_3729"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.608 at
FT                   residue 24"
FT   gene            582129..582593
FT                   /locus_tag="Bcen2424_3730"
FT   CDS_pept        582129..582593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3730"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3730"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10468"
FT                   /protein_id="ABK10468.1"
FT                   /translation="MKKTMLIAALVAGMGVSIGAFAQVPASAPAGTTGLCKDGSFYSGA
FT                   SKKGACAGHKGVKTWYGASAAAAASAPAAAPATAASAAPASGTAPAKSAAATTAAAPGG
FT                   GAGKVWANDASKVYHCSTDKYYGKTKHGSYMSEADAKAKGYHASHGKACS"
FT   sig_peptide     582129..582197
FT                   /locus_tag="Bcen2424_3730"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(582701..584056)
FT                   /locus_tag="Bcen2424_3731"
FT   CDS_pept        complement(582701..584056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3731"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /note="TIGRFAM: polyhydroxyalkanoate depolymerase,
FT                   intracellular; PFAM: PHB de-polymerase domain protein;
FT                   KEGG: bcn:Bcen_4633 polyhydroxyalkanoate depolymerase,
FT                   intracellular"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3731"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10469"
FT                   /protein_id="ABK10469.1"
FT                   /translation="MNLLAYPFYQWSAECLRPARAWAAATRATMSLWPPATSTPTGRMV
FT                   DALCELLECCAFSHRRPPFGIASVVVDGETVPIVEEAATTTPFGTLLHFRKARPVARQP
FT                   RVLIVAPMSGHFATLLRGTVRTMLADHDVYITDWHNPRDIPLAAGRFGFDEYVTHVIDF
FT                   IRHIGPDAHVLAICQPTVASLAAVSLMAAGGDPAQPASLTLMAGPIDCRVNPTKVNELA
FT                   TSQPIEWFARNLISVVPTGFVGAQRCVYPGFVQVGAFMSMNPDRHAASFADLYYERAKG
FT                   DPAKADTLRHFYDEYFATADLTAEFYLETVEKVFQQYALARGELAVSDTLVEPAAIHRT
FT                   ALLTIEGEKDDICAVGQTVAAQELCSGLPSYLKTHHVQTGVGHYGVFNGSRWESQIYPI
FT                   VRATIHDNEPYDRTADAQGDTSGTHYVTLRALLDARAAAIDTATEAQSDHAH"
FT   gene            584287..585006
FT                   /locus_tag="Bcen2424_3732"
FT   CDS_pept        584287..585006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3732"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: bcn:Bcen_4632 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3732"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10470"
FT                   /protein_id="ABK10470.1"
FT                   /translation="MRRVRLRCRGTNDIQQGSNMESNARTTLTISSRNYSSWSMRGWLL
FT                   AKLSGLTFETISVPIDATSRAELLLLSPSILVPCLTHDGNAVWDTLAIAEYLNEIRPQA
FT                   RLLPEDRHARAHCRSICGEMHSGFSALRSALPMNLRGHFPGFRIWSRAQHDIERIVTIW
FT                   RECLAEYGGPWLFGAEIGIADAMYAPVVTRFLTYDVKLEPDVAEYCMRVLAHPFVAEWI
FT                   EEAKAEHEDIDELDMEF"
FT   gene            585248..586498
FT                   /locus_tag="Bcen2424_3733"
FT   CDS_pept        585248..586498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3733"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: bcn:Bcen_4631
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3733"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10471"
FT                   /protein_id="ABK10471.1"
FT                   /translation="MNRQQSWTRTAAPGEIIYSEGFAGEPVLFLITDGKVELSTRCDDK
FT                   RVIVATLGRGEFFGESALLAAEPRAHTAKALSFCQLTVVPAGVLDEEIERVSALLRHIV
FT                   RTMIRRVKRKDDQLATYTHADFMPGVLSYAHVLSLMAGADAREAGDTWARRPMQAHAAE
FT                   TSVPLAEVIRKCRAIAGHSRPHVLAMLRRMEKLNLVTIEAAQADGAGSASDYAASSDAR
FT                   QVVTFDAARVIDRAQQVADHDLDLSINSELELIELADLESLIGVDKTLLLNKLSNGEIA
FT                   EEVFAFRKSKVLNYVEQKGVAYFSRRNGRRGGDVRALEDLVWIDQRTLFDVISAFDTYD
FT                   LAKLIANLDDRAVADKLFSVMTEARRNEVSWVMRRELKLDPVEIEDIEQRVLEAVRAAK
FT                   APAAGATAVASASASDA"
FT   gene            586513..587277
FT                   /locus_tag="Bcen2424_3734"
FT   CDS_pept        586513..587277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3734"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   bcn:Bcen_4630 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3734"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10472"
FT                   /protein_id="ABK10472.1"
FT                   /translation="MDLLTLVGVVLGGAAIVFGFALEGGHFSMLFQFEALVIVLGGTLG
FT                   AVMIQNTWARFFDAVKQLRLAFVRAREVDRKNLSDLLEWGDRAKLDGLLAFESMDVSGI
FT                   HPFARRGLELLANGVSTAVLEDALQRELDAYERSRLAAVRVWQQAGGYAPTFGILGSVL
FT                   GLVQVTSHILEPAQLGPGIAVAFIATLYGLAFANLVFLPLYGKLRAQIDSEMRFRKLYL
FT                   DGLLAISRKESPHTIETRLTGDVRGRAAESLA"
FT   gene            587351..588022
FT                   /locus_tag="Bcen2424_3735"
FT   CDS_pept        587351..588022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3735"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bcn:Bcen_4629
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3735"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10473"
FT                   /protein_id="ABK10473.1"
FT                   /translation="MTARTDGASAADRDDDELEGAQSGRWLISYADLITTLMVLFLALY
FT                   VLQLAKYNALDARYQTLARQAGGAATASVDAAKSDPAPPWLALLDSLKSNGRIALVKAP
FT                   HGIEIGIDAKILFNVGDARLLPHSSPVLNQIAQALSEHATGDILVEGHTDSVPIANAKY
FT                   ESNWELSSARAGSVVRYLTERGVAPHRLAAIGRADTQPLVAGDDAGSRARNRRVTIFVA
FT                   Y"
FT   gene            588195..590057
FT                   /locus_tag="Bcen2424_3736"
FT   CDS_pept        588195..590057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3736"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bcn:Bcen_4628
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10474"
FT                   /protein_id="ABK10474.1"
FT                   /translation="MHFWRKLSIQNKLILSMTSCLLVFVAISSGLSVRLIGNAVRDRVV
FT                   REELPTAVNGIRADVQRQMAGPIAASRILARDAFLLQWEADGEPDAGTRNWIQLAKNVK
FT                   DEQKAASVQWVSVKSGNYYNEAGLQRKVTDKDQWLTNFLSSGKAYDVNMDREVTVGGYM
FT                   MFINSRVELDGVPIGAASMSLSVDALAKGISAYRIGETGFAYLVRPDGAIMMHRDTSLI
FT                   DGKHFLKDERGLPGDASSTLLAGKPYAYLSYEGDGGARFIATSFIPELNAYVVVQVPQA
FT                   ELLGPVTRAIRSAALVAAVVGLGVALLVIWLVGRAIAAPIRRAATLLSEIASGQGDLTR
FT                   RMTVESEDEIGQLSDAFNRFVSSLSTLVHRIRAASASIATGSAQIASGNADLSERTEGQ
FT                   SSNLERTASSMEEITAVVRNNTETATTAAKMINGAADTAARGGQVVGEVVTTMEQISDA
FT                   SQRISEIIVMIDSISFQTNILALNAAVEAARAGEQGRGFAVVASEVRNLAQRSAQAAKE
FT                   IKSLIEHSAGTVGAGSRLVSEAGKVMSDVVAQVQGVSAMMSEIAEASLEQSAGIDQIGD
FT                   AVQSLDQMTQQNAALVEESAAAAESLKQQAAELTKLVSAFKVDE"
FT   sig_peptide     588195..588281
FT                   /locus_tag="Bcen2424_3736"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.564 at
FT                   residue 29"
FT   gene            complement(590762..592009)
FT                   /locus_tag="Bcen2424_3737"
FT   CDS_pept        complement(590762..592009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3737"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: purine and other phosphorylases, family 1;
FT                   response regulator receiver; KEGG: bcn:Bcen_4627 response
FT                   regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3737"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10475"
FT                   /protein_id="ABK10475.1"
FT                   /translation="MIKILIVEDETEKRRLLIETLIEVEGVALDQITYVDDALSAKKQI
FT                   SARRFDLLILDINIPPRADKPTETGAGLEVMSFVRNNNNAIPPGCIIGMTAYDDGAEAA
FT                   EEVFASPLWKLVRFSYSELGWQAHLKEAVRYMINMQRPPYSNDGQTYHVDLGIVVALED
FT                   EELKSILALPADWKELPVNYDHSRYFSGNFSNGNCQISVIAVAAPKMGMPAAAVAASKL
FT                   IQSFRPRLLAMSGICAGVKGKVEIGDILIADPCFDWGSGKWVRETPESELKFRPAPYPW
FT                   RLDEGLRGIVKRLDNEEWLKAVYRDFDGKQVVDRAPKVLVEAMASGASVLQAASLMDDV
FT                   KDQHKNLVGVEMETYAVFTAAQYASEPRPKCISIKSVCDFGDEDKKDGAHLYAAYTSAR
FT                   FLYRFAIGALGDQNFQ"
FT   gene            complement(592011..592463)
FT                   /locus_tag="Bcen2424_3738"
FT   CDS_pept        complement(592011..592463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3738"
FT                   /product="response regulator receiver protein"
FT                   /note="SMART: response regulator receiver; KEGG:
FT                   bcn:Bcen_4626 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3738"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10476"
FT                   /protein_id="ABK10476.1"
FT                   /translation="MKIYVIEDNQLKADLICAYLQEHFTDASIRLYGSFQTGLKAIETT
FT                   CPDIVLLDMNLPTFDRGPNVREGRNRPLGGYDLMRKLRLRDISTRVVVITQLEHFGEGE
FT                   DEMSFAEMTTLCTKEFPSMFVGSVYFSPSDNEWQDDLNNLIPNNYI"
FT   gene            complement(592460..595882)
FT                   /locus_tag="Bcen2424_3739"
FT   CDS_pept        complement(592460..595882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3739"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3739"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10477"
FT                   /protein_id="ABK10477.1"
FT                   /translation="MAKSKKRKTISKGFGAETQLRTFRRAIHSVANPRAGLSKARSLVS
FT                   ASHFPRIVNELGRQSAYKYIFAPTTFPKSLENFPIRTRLHELDTETELLWTASVLSIFK
FT                   SDIYEFIIKKEEFERAFATEHPTRALEILEQIEVKFGFSLWLIGFKLQLLQLDKGLQAQ
FT                   KEYLESIFAADGMSAQATWIAYYFSIRSEENVSYSKIESDISQLGTGELADYCIHHVLG
FT                   HGSKRIEHLRTPINYEEPNPIIDRFETFVTIAQQHLSRTRGEISDSFRTAVQLLGSLGD
FT                   RRITNMMSALGQTILPNCDSAELRAADNYTIGQYLDVVSSDAESLELIARSRALLGNLP
FT                   RSTQSSLRDRVIESMEEALSTSANAVHARHTLRKLALTLSKHPYSTQIWGFLERGHDHI
FT                   FLREYSDLDRYVALNGHVSNPWNAAVYAAISNDKEWTKTLAAACPKSPAMLLRVALSSS
FT                   AEGTHTLPPALPTYRKDAYEGHIAFRASDFKFAIEKYTRCAASEISYVAMTGKTYLFKA
FT                   LYTAKCYAQCLALIVDQAVAGESLPLQLPLAELAKKCLDESALLSSLDLSILLQILSKH
FT                   VHPRWDRELSDIYENVIGQQRANRPTDLFNKPDFCSKSRFIYFLRNVCTTRILDDCTAF
FT                   ESMDDVESERIAICQHLLKIDAHNSASYQDEIRIITRDLNVALLLKKVQTSKIFVDEVG
FT                   IRNAFEASLTDSLARYKELQNSPALTYQAQKLSKRIEEMIHTQGLLEFRDFKLPTSELE
FT                   GLFHTMYLEVASQFAYSPAYGLDTHLSTTIRHGAFEGHLRGPLATEGLLCRTRNKAHYI
FT                   PELTMRRLSHLVETEIDHVRRCLVRFTTRVEEMISTYLERRLRIKSSPTPDGMFALFVE
FT                   PDSLAEISNTINSETTLDEVADRLVAKCWALADSSMEEIRLELGTSARSHVESAFTALI
FT                   QNLEEKISRERLLPLTDAIARARTQYDAAVDVVSEWFRRPTDLIREPFEFDIAAHVALR
FT                   QIANCYVGYEIVPILNVDVQGKLPGFMLDGICEILFILLQNVLLHSGYEDFVPETKVSA
FT                   RRENSYVVIEITNSLSESIDLIERRAQAEAAMARYSRDSALRLARKEGGSGLSKVWRIA
FT                   EFDLRKSHSLNLSVTDDRQFTTTFRLGDVGETA"
FT   gene            596452..596748
FT                   /locus_tag="Bcen2424_3740"
FT   CDS_pept        596452..596748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3740"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3740"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10478"
FT                   /protein_id="ABK10478.1"
FT                   /translation="MADANTKPRRRKNKPVNMQKTFELVLRNYPDLPKRGWPYLPWMKA
FT                   IDIDLKIFGFKPGDRVYLRVSDVDRLITISPDSSQLALREQPYHDPDWVPPPL"
FT   gene            complement(596955..598196)
FT                   /locus_tag="Bcen2424_3741"
FT   CDS_pept        complement(596955..598196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3741"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bur:Bcep18194_B2354 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3741"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10479"
FT                   /protein_id="ABK10479.1"
FT                   /translation="MTITVLQGGNVLDLERGVLLEHHHVVIEGERIVEVTDRPVDLPNA
FT                   QVIDVRGKTVMPGFIDCHVHVLASNANLGANATQPNILAAIRSLPILDAMLSRGFTSVR
FT                   DAGGADWSLMQAVETGLIPGPRIFPSGKALSQTGGHGDFRPRGDVLEPCSCCFRTGAIA
FT                   RVVDGVEGVRLAVREEIQKGATQIKIMASGGVASPTDPIANTQYSEDEIRAIVDEAEAA
FT                   NTYVMAHAYTGRAIARAVRCGVRTIEHGNLVDEAAAALMHERGAFVVPTLVTYDALAKH
FT                   GAEFGMPADSVAKVASVQQKGRESLEIYAKAGVKMGFGSDLLGEMHAFQSGEFRIRAEV
FT                   LGNLEALRSATTVAAEIVNMTGELGVVAVGAIADLVVLDGNPLEDIGVVADEGARVEYV
FT                   LQRGAVVKRRAGGR"
FT   gene            complement(598209..599525)
FT                   /locus_tag="Bcen2424_3742"
FT   CDS_pept        complement(598209..599525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3742"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_4621 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10480"
FT                   /protein_id="ABK10480.1"
FT                   /translation="MQGTLSPRAAPSVDAAVQQRRRAIVATVIGNGLEWFDFTVYSFFA
FT                   VIIAKLFFPTGNELTSVLLTVATFGVGFFMRPVGGIVLGVYADKVGRKAALSLTILLMA
FT                   AGTALIGIAPTYEQAGIAAPLMIVVARLLQGFSAGGEMGGATAFLTEYAPPEKRAYYSS
FT                   WIQSSIGFAVLLGAATGTFVTTSLDTQALHSWGWRLPFLLGIIVGPVGYFIRSHIDETP
FT                   AFSAVESQAKESSPLKEVLHTYPRETFASFSMVILWTVCTYVLLFYMPTYSVRTLHLPQ
FT                   STGFTAGMVGGLMIMCCSPIVGRLADAWGRRVFLSGSALAILVLAWPMFSWINHAPGFA
FT                   SLIVFQAVFGVLIATYTGPILAAFAELFPTKVLSTGLSVAYNFAVTIFGGFAPFLITWL
FT                   IARTGSNMAPAFYVMLAAAVSFVGTRFVKDAKLAAATTR"
FT   gene            complement(599658..600569)
FT                   /locus_tag="Bcen2424_3743"
FT   CDS_pept        complement(599658..600569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3743"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4620 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3743"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10481"
FT                   /protein_id="ABK10481.1"
FT                   /translation="MRITPLPPLQCLVAFEAAVRHASFTKAAAELHLTQSAISRQIQQL
FT                   EEFLGRSLFVREHRSLRLTIAGEQYAAQVHHLLTQCAEATHDVMKPYGDLELTIACSSG
FT                   VALLWLTPRLPNFRAAYPNIKLRLIVRDGLASMSPAEFDVGVYYVRQQAPAEYTARRLF
FT                   DEEVFPVCAPGYLAGRTLDAADLANETLLRLEDGQRQWMSWSEWFDMNDVDRQKAQPQD
FT                   ITINSYPQIVQMTILGQGVSLGWRYMIDACIEAGLLVRVTEASASHGGGYYVISPNDRA
FT                   QNQAARLFTRWLFEQAEQQTGA"
FT   gene            600712..601173
FT                   /locus_tag="Bcen2424_3744"
FT   CDS_pept        600712..601173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3744"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   bcn:Bcen_4619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3744"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10482"
FT                   /protein_id="ABK10482.1"
FT                   /translation="MTLSNPESKVKAAHPPWMSVALAELGIRRHPPGSVNPRIVEYNNQ
FT                   TNLVGYDDKISWCSSFVNWCMAHAGFRGTGSALARSWLEWGKPLERPVYGCIAILTRDD
FT                   PTSWKGHVGFYLRHDAEHVHLFGGNQLEEVRELAYPLHEVIGYRWPATE"
FT   gene            601218..601340
FT                   /locus_tag="Bcen2424_3745"
FT   CDS_pept        601218..601340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3745"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3745"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10483"
FT                   /protein_id="ABK10483.1"
FT                   /translation="MQTGNLRLYADAQYTSPYAMSVFVALEVAMLHKIWLACYF"
FT   gene            601713..604265
FT                   /locus_tag="Bcen2424_3746"
FT   CDS_pept        601713..604265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3746"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG: bcn:Bcen_4617
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3746"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10484"
FT                   /protein_id="ABK10484.1"
FT                   /translation="MGRLPNSLMLDAGIEQTNRALVLETPLGAKVLLPQRAMGESRVGR
FT                   DFELTVDVVSRERALHLKKLMAQPVTLWVRQADESYLPWHGYVHATRRLGADGGLTYYQ
FT                   LSFSSWMRFLQYRKDARIFQDLTTADILTKVFSGHSPARGHFRLDVKDPGAVRSYCTQY
FT                   ETDHNFVHRLMESEGWFTYVEHAEDGKSHTIVVTDDLFNCKALATQRVPFYRGDRDGQA
FT                   GTLVEWSGERTTQSVGYAFSTADYKRPARTLQRADRSTVDQGDIPQELEVYEYAGHYSF
FT                   PVTGESYDRGERAMRIRLEEMASRSKRFFGVGSVPCMDAGRWFTLEDHPEHDADKPEDR
FT                   EFAILGVRWAIQNNLPLGNSRPFPGSLQRRLSRLRAEYKDRQAAFVSKDPLGNESFVLA
FT                   EIEVQRRSVPFRSPFEHRKPVMHMQTATIVGPAGEEVYTDELNRVKAQMHWDRLGSNNE
FT                   TSSCWMRVILPHAGKGFGGVFVPRIGQEVAVNYLDGDCDRPVVSGVLFHSVNTPHWHSN
FT                   GLLSGFKSQEYSGQGFNQLVFDDSTSQNRAQLFSSTANSYLHIGYLIDHSGNTRGNYLG
FT                   TGFELKTEASGALRAGRGLYVSTYARGGTSSQPLDVKEATQHLIDSSGVIQHRSLAAAD
FT                   GQAETLDDAQDAIKDFAATTQSDAQGSMAGGRTAGGGTGSANAFSQPVMLLASPADMGL
FT                   STQKSLHAAATQHVNLVSGESTYVSVARSWIASIGEKLSFFVQNAGIKLFAGKGKVEVQ
FT                   AQSDNIELTADKTVKVVSTSDSVNVTAQKEITLTAGGASIRIAEGKIFIHAPGLVEVKG
FT                   SPLIFDGPAGDSASAQLAPSKSCAQQFAAAAQAGSALV"
FT   gene            604276..605079
FT                   /locus_tag="Bcen2424_3747"
FT   CDS_pept        604276..605079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3747"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3747"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10485"
FT                   /protein_id="ABK10485.1"
FT                   /translation="MVHYVIVEVVNGKPELPGVPPAYEVGELVPAARPELEGVAPVLYC
FT                   AEHPELQLPALRERAESDLENGLPPVVCAILECGKATGRLQQHLSNRLILQAPISGDAV
FT                   FRYYDPRVFPHLGRILKAEQMDALLGPVATWTYLDPVSGWTVVNGAAEPEAAFAVTADQ
FT                   HARIARIELVQRGLDLLRCNGTAPRPDMSALLDAQLAKGEAHGLAGGDLLAFALHGTLV
FT                   SPCFDRHPRVRAILQAPRKGPYAEAVANWSAADWEAIARESIQYQ"
FT   gene            605110..607686
FT                   /locus_tag="Bcen2424_3748"
FT   CDS_pept        605110..607686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3748"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3748"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10486"
FT                   /protein_id="ABK10486.1"
FT                   /translation="MALDTNFASISQLTQSAMQTSSRAPNSCNMCKKKGLPILPVRYGV
FT                   VANSKAHSSAGAMSLMGGKFGDGVVGIALKKAKYTLRTLRYGYVYIFYPKTQRWQIYAV
FT                   TAEGYLYDYPVGIKLDRSFEKPFSCHQPGHAQLAQCITVEDAEHAGTVYLAFSDELWTQ
FT                   KVRDTYAKNFMGCRDKRMQKFDATAWYNGSMNQPHADSLDHLEGLLSEYKGGRPDALVT
FT                   GCFPYHDRAGQQPALKKAMDSILPDKGLFFALWDPVGITQELNFEQRVAFGAALAPYEH
FT                   GIWAASAIDALQKAVAVSAKEDVERAAGMLEANTYEGMGLGALFDGGKALEKRLKSIEA
FT                   QKESELATAGPEAWKPYTTHYRQQAIVDFRQQMANAMKSEQASTLIPLSQDHQAWLSSA
FT                   ALLNVFESDYEPGSWRCGLNYTNTFTRCIEGSADRKNAVDVLVKWAKGSVSDTRNPLLR
FT                   AFVLNSPVLAEKVKEASGYPYMELREFVAKLIESYSKIEGVEESKDKGIKVAVAKALAW
FT                   LLHETGGPVAEAISASVDTAATKVLYATLCMRTKQLFEFKVVYGSVNQWVNYIARQMQE
FT                   VMPGRQKISVQDLKKQLQDKANAGGGADPQIKAKQFVPVESPATEAAALAGVKAKPGFE
FT                   KLASATLTPDVVETIYMPKFRLMTKGEPGFAGIGAIFSAINLRFAREELKKANRFNQSE
FT                   AGIKFDNAIGGLVASVAQYGSAAIDTVGKAGAQLGTGWLRLERFLNVAGRYGGAVVGLV
FT                   SAAIDIYHAVQDFKEGNVTMFILDAASAVVGLALAYSVIFLSASAAAVVALPLLLIAAL
FT                   IGILINYFKGKEVDEWLERCFFGLKEAKERFPTLAEDQKAFTAMLS"
FT   gene            607699..608667
FT                   /locus_tag="Bcen2424_3749"
FT   CDS_pept        607699..608667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3749"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3749"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10487"
FT                   /protein_id="ABK10487.1"
FT                   /translation="MAFDGLSWYRLNRPVSEEEQAARLAIGQPASDTAKDERSVFSMSD
FT                   TCLEVRDGNYSEKGWGVFAFMLPGLGSLAFTAALLWMMTHVPPIYEQRGQLGLIYGVLS
FT                   FFLFVALGFSGIGIWALTRDCFNYTCKPVRFNRRDRMIYAFKHNGPGGVVSVPWDSAFL
FT                   YVERKPRSGPTRTAPRVVRCLVLDDKGMVKDTFSMGTRVVLSSDEGSVGGQEVMKVLYQ
FT                   DFEFYRRFMEEGPASLPPVTEFLPKGASLRNSLRLNFDGTSGLLKSGNPIVWLVVAVGA
FT                   LPAFSQSLLHWLAQLTCREPVWPDDIERACNAATPSNGLTA"
FT   gene            608664..608948
FT                   /locus_tag="Bcen2424_3750"
FT   CDS_pept        608664..608948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3750"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3750"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10488"
FT                   /protein_id="ABK10488.1"
FT                   /translation="MSRRFIRQGDKTDRNGVVVDGIAGTSLQGQPFAYLGAPVQCPACG
FT                   TTGVIISDGSPRAMTMMGKQVALENDLCQCKCESLPKLMSSQTLGSIKT"
FT   gene            complement(609099..609741)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_3751"
FT   gene            complement(609795..611045)
FT                   /locus_tag="Bcen2424_3752"
FT   CDS_pept        complement(609795..611045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3752"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type; KEGG: bcn:Bcen_4611
FT                   transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3752"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10489"
FT                   /protein_id="ABK10489.1"
FT                   /translation="MPRKPKAQPAALPAIPAELLEQFGNGPMTAEAINAATLALKKALI
FT                   ERALGGEMNHHLGYPPGAAKPANATNQRNGKGAKTVLTEDGPIRIEVPRDRDGSFEPIL
FT                   IPKHERRFTGFDDKIVAMYARGMTVREIQGFLLEQYGTEVSPDFISSVTDEVMAEVTAW
FT                   QARPLEPMYPVVFFDALRVKIREDAVVRNKAVYLALGVLPDGTREILGLWIENTEGAKF
FT                   WMKVFNDLKTRGVHDILIAVTDGLKGMPEALAAAFPATTLQTCIVHLIRNSLDYASWKD
FT                   RRGLAAAIKPIYAAPSAEAAQAELDAFADGPWGQKFPTVSSAWRNAWDRVIPFFAFPPG
FT                   VRKIIYTTNAIENINSQLRKIIKTRGHFPSDEAATKLIWLALRNITANWGSAAHDWKTA
FT                   MNQFAILYADRFVRPSV"
FT   gene            complement(611169..612611)
FT                   /locus_tag="Bcen2424_3753"
FT   CDS_pept        complement(611169..612611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3753"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_4610 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3753"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10490"
FT                   /protein_id="ABK10490.1"
FT                   /translation="MKKLLVALAVSAFAAGCAVQPAQHPALNDSVQTLAPTAWDTDVPR
FT                   ADIDAAAWWAQFHDPVLDRLIATVLDGNLDLQAAAERVKQAQALTVQKRAVLLPELDAT
FT                   AHAANARQNTPPPLGYVRQAGAGLALSWSPDVFGGERLDLLAAQAELVGQKHAEDAMRL
FT                   ALAADAASAYVDLRWAQQELKILQENAKIRQHALELTRKRQAFGLSTELDVTRAQNQLD
FT                   ALEARIPPTQAQISHQLNLIAVYSGRTPESVDRLVLAQAGEIPAPPVGAPGTLPSQALL
FT                   RRPDVLTAYAQVERRAAQVGVAKAERYPKFSLNLTDGILAASYLGLPTLTDNLFSAALS
FT                   ATSPIFNAGRITADISQSESRMRESELGLRQTMLQALREVEDARANLVSSDEATRRLGS
FT                   ALAASDKALGLANQLYKGGATDFLDVLSAQEVYLRDSDSLNQVKREHALAAVALYRSLG
FT                   GGWSRNDAAGGTQTETDAVAKN"
FT   sig_peptide     complement(612552..612611)
FT                   /locus_tag="Bcen2424_3753"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.564 at
FT                   residue 20"
FT   gene            complement(612629..614203)
FT                   /locus_tag="Bcen2424_3754"
FT   CDS_pept        complement(612629..614203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3754"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4609 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3754"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10491"
FT                   /protein_id="ABK10491.1"
FT                   /translation="MTTAFSGDPASQPTKQRVFAFALMCVGFFMATLDIQIVASSLRDI
FT                   GGGLSASQDELSWVQTAYLIAEIIVIPMSGWLSKVMSTRWLFAASAVGFTITSMLCGLA
FT                   WDINSMILFRGLQGALGAAMIPTVFTTAFVLFPGRQRLIASTTIGALASLAPAIGPVIG
FT                   GWITDQWSWHWLFYLNLVPGIAVAVLVPRYVHIDAPDLSLIKRGDYLGILLMSGFLGCL
FT                   EYVLEEGPRKNWFGDDAIVICAWISGICGFLFIVHALTAKDPIVDLRALAVRNFGIGSL
FT                   LSFVTGIGIFVTVFLTPLFLAQVRAFSSLQIGIALLSVGAFQLIALCAYAFAARYVSMR
FT                   ALLVFGLICFGLGCYLYTPITHDWGWQELLLPQALRGIGQQFSVPPIVTMALGSLPQSR
FT                   LKSASGLFNLMRNLGGAIGIAVSATMLNDRLNFHYLRLNEHVSAGEPQVASLLDRQAAY
FT                   WGSVAGNTLNTAQAGLANLHRLIYREALTLTYADAYYALSLCFVVALLAVVFSKPITLN
FT                   APPPDAH"
FT   gene            complement(614217..615311)
FT                   /locus_tag="Bcen2424_3755"
FT   CDS_pept        complement(614217..615311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3755"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_4608 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3755"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10492"
FT                   /protein_id="ABK10492.1"
FT                   /translation="MDTTQDAASSREAATTERPAKQQRRVPWMRIAVGAVVVVVAAAVL
FT                   DWLFVLRFQESTDDAYVGGDVTVLAPKVNGFVDKILVTDNQRVKAGDVLVQLDARDYDA
FT                   KLAQASAEVDSARSAVTELEAKQQLQFAVIGQHAADKNASSAELTRAASDRVRYRELVK
FT                   SDAVSNQIVERADADYSKAGAAVERSDAALLASKRQLDVLGAQLADARARVNTALAAQR
FT                   VAALNVEYTTIRSPVDGYVGNRTGRVGMLANVGVPLLTVVPASGLWIDANFKEDQLRKM
FT                   RAGDRVDVALDASSTRLHGRVDSLAPATGATFSVLPPENATGNFTKIVQRVPVRVHLDP
FT                   QPGIEHVLRPGLSAVVTVHTDHQH"
FT   gene            complement(615375..615806)
FT                   /locus_tag="Bcen2424_3756"
FT   CDS_pept        complement(615375..615806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3756"
FT                   /product="regulatory protein, MarR"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: bcn:Bcen_4607
FT                   regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3756"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10493"
FT                   /protein_id="ABK10493.1"
FT                   /translation="MHKTTLTDDDCFAVRQAARRISQFYERYLSRAGVTPSQYSILALL
FT                   RERPGLTMATLSNVLVIERTALLRALKPLVGAALVTGRIEPPCRGQTFALTAHGETKVA
FT                   DAHVHWLAAQEAFERCFGSTQAARLRDELFRITHNLPER"
FT   gene            complement(615916..616836)
FT                   /locus_tag="Bcen2424_3757"
FT   CDS_pept        complement(615916..616836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3757"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4606 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3757"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10494"
FT                   /protein_id="ABK10494.1"
FT                   /translation="MDYIDKLRIFRSVVEMRSFTRAADMHGLARPVVSRAVADLEARFG
FT                   SRLLHRTTRQVSLTETAERIYERCAAVLDELDALEVEAQTHTREPEGLLRLVAHTTAAL
FT                   NRLVPLIAGFKSAHPNVRLDVTLTERPVDLVGEGYDIGIVVPYMLTSESTVVRLVERIP
FT                   VVIVATPAYLQAHARPETPADLANHPFVPISPSLRRPALSFRVDGNLLTVPFRFDISSN
FT                   SPVFNREMVMHDFGIGVVPKTLVQAELASGALVQLLEDADLVDAFVEIKLAYANRALLP
FT                   AKVKAFIDYTAAYCDREGWIVPAAA"
FT   gene            616929..617357
FT                   /locus_tag="Bcen2424_3758"
FT   CDS_pept        616929..617357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3758"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: bcn:Bcen_4605
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3758"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10495"
FT                   /protein_id="ABK10495.1"
FT                   /translation="MNDTSIAQACNCLALRQAARFVTQLYEHHLAPVGVTPAQFSIMAN
FT                   LTRHPGLLMSELAEMLVMDRTTLLRALKPLQRDGFVSTAASEHDARAHALHLTKLGERT
FT                   FAQAKVAWQAAQDEFDTQFGRERAKALRNELFSLTAER"
FT   gene            617564..618811
FT                   /locus_tag="Bcen2424_3759"
FT   CDS_pept        617564..618811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3759"
FT                   /product="predicted aconitase subunit 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: protein of unknown function DUF521; KEGG:
FT                   bcn:Bcen_4604 protein of unknown function DUF521"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3759"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10496"
FT                   /protein_id="ABK10496.1"
FT                   /translation="MLQLSDRDDAMLRGDFGDGVARAMRIVVRTAQVMSAPHLIDITSA
FT                   HIDGCLYHGQTSLDFVDYFVDTGAKVAVPTTLNVGSLDLIHPELYHGDRTIQRDAQRLM
FT                   DAHLLLGCESSFTCAPYQLKNRPALGEQIAWAESNAIVFANSVLGARTSRYGDFLDLAA
FT                   AITGRAPYAGLHVDANRAARIVFNAPDFSGLPSRDIYFAALGLAVGKIAGAVVPAIVGL
FT                   PADTTEDELKALGAAAASSGAVALFHAVGVTPEAPTLDAALHGRAAQRRVDIAMADLDE
FT                   IRRTLNHGAAGDALVAVALGTPHFSLAEFRTLDTLLDAFDGKPACDFYVNTSRFILWEL
FT                   EEAGLAEKFAARGVQIVVDTCTYITPVMKQLSGLVMTNSGKWASYAPANIGVTVAYGSM
FT                   RECVRSAYEGKVRFDD"
FT   gene            618804..619283
FT                   /locus_tag="Bcen2424_3760"
FT   CDS_pept        618804..619283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3760"
FT                   /product="predicted aconitase subunit 2"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   bcn:Bcen_4603 protein of unknown function DUF126"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3760"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10497"
FT                   /protein_id="ABK10497.1"
FT                   /translation="MTETTGTFLTGDTLVPGSACARPFVLDKPLSFWGGYDSGAGRIVD
FT                   RGHPQAGASLAGKVMVMPHAKGSSSSSSVLAEAVRNGTGPVGIVLKERDLIISIGAIVA
FT                   AELYAIAVPVVCVSDEVYDAIVAATGDVRIETGEGDGGARIHLGTDARSGGSGLT"
FT   gene            complement(619383..619985)
FT                   /locus_tag="Bcen2424_3761"
FT   CDS_pept        complement(619383..619985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3761"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3761"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10498"
FT                   /protein_id="ABK10498.1"
FT                   /translation="MTNHDMQTVSGRVTAISQQSIETKVWSNNLGTTTQSIEEITLKLD
FT                   SLASPLVFRTNRTTRLFIADGDRLNVAYVGDQDRQSVYGIRNMTDGSAYLLRPAKVAGA
FT                   RTDLFVMLICVIGAAVVSGIVSVVTLSMESMFDVFALISASVIGLCVLSAILRILFGVI
FT                   VWPEIRRLAQPGGKREMNAAAQALSLTQEETRHVRFI"
FT   gene            complement(619982..620581)
FT                   /locus_tag="Bcen2424_3762"
FT   CDS_pept        complement(619982..620581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3762"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10499"
FT                   /protein_id="ABK10499.1"
FT                   /translation="MMGATSKRRRADPRPLRPMPNRTTLIEATIDRVDTNLIRVKANVR
FT                   KNPPYRLTMQNVCYFVTANDVDEEAFKQIEKLRPGMSVRACTFEHRGRRRIAWIRSGSL
FT                   AIAPYDVRAQKRRNLSLLAWASCLVVLSLGTAAAALHSGWAFTSALATVVSIVGLVGDL
FT                   VAIGGLSDLIFQPQRREAQDCWLGEPSGFSAERSGP"
FT   gene            complement(620737..621807)
FT                   /locus_tag="Bcen2424_3763"
FT   CDS_pept        complement(620737..621807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3763"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_4600 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3763"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10500"
FT                   /protein_id="ABK10500.1"
FT                   /translation="MLVIFGQIDMTSPSRKDRLGLRRPTIPVAYTRLLLQALAARGVDL
FT                   AAVRAGTGLRDAVLAEPDARVAPSQWGRLVLNAIEIGGDPGIGLAFGLLLKPTVHGFLG
FT                   YATLTARDIREALSVMQRYFRMRNRQYRLTYAEDARGATLELHGVQANPVLQHHVMFEF
FT                   VLTGLAQNISQWSGRASPPIRLQFAWPEPAYFARYRDQLPPVAFGCAANALWIARDVLD
FT                   WPLPLADEVAHRQALVQVEREYAQVRQEEGDLVERVRAELARAAGDYPGPDMLADALLV
FT                   STRTLRRRLEEAGSSYRQLLDEARFRDARQLLAASDLDLKTIAERLQFTDPANFTRAFR
FT                   RWAGQTPSAFREAAAR"
FT   gene            621883..623916
FT                   /locus_tag="Bcen2424_3764"
FT   CDS_pept        621883..623916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3764"
FT                   /product="2,4-dienoyl-CoA reductase"
FT                   /EC_number="1.3.1.34"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; KEGG: bcn:Bcen_4599
FT                   NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3764"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10501"
FT                   /protein_id="ABK10501.1"
FT                   /translation="MTTPFPHLLAPLDLGFTTLKNRVLMGSMHTGLEDSRKTLPRLAEY
FT                   FAERARGGVGLIVTGGFAPNVAGWTKPFGGTLMTSAAARRHREITGAVHAEDGKIALQI
FT                   LHTGRYGYHPFAVAPSKIKSPISPFAPHELSARGVERQIRAFVRCATLAREAGYDGVEI
FT                   MGSEGYLINQFISMHTNKRTDQWGGSYENRIRLPIEIVERTREAVGRDFILIYRLSMLD
FT                   LIPDGSDWSETVQLAKVVERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGE
FT                   VGIPLVTTNRINRPEVAEQILADGCADMVSMARPLLADAEFVVKAAQGRADEINTCIGC
FT                   NQACLDHAFKNKIASCLLNPRACHETELKYTPAPQPKRIAVVGAGPAGLACSTVLAQRG
FT                   HQVDLFDGAAEIGGQFNMAKRIPGKEEFHEALSYFGRQVELTGVKLHLNRRVDASDLIA
FT                   GGYDEIVLATGVAPRDPKIPGQDGPNVFSYIDVLAGKQPVGRRVAVVGAGGIGFDVAEY
FT                   LVQEGESPALDLDEWKAEWGVTDPATTRGGVTRAQVSAPTREVTLLQRKAAPLGKGLGK
FT                   TTGWIRRATLKMKQVKMIGGVNYELIDARGLHVSYGEQRTDHELIEADTIVLCTGQEPQ
FT                   RALLAPLQAAGRSVHLIGGAELAAELDAKRAIDQGARLAARL"
FT   gene            complement(624101..624505)
FT                   /locus_tag="Bcen2424_3765"
FT   CDS_pept        complement(624101..624505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3765"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10502"
FT                   /protein_id="ABK10502.1"
FT                   /translation="MFQASAFDPEQPGFNPVHFERAAQRAVVDLQRVAGGPAQRALGLR
FT                   RRTHPAAVRTMSWQALLNVEELAFSNPGFLNRNDPAVVDAFIRLRGSRLVAADVEEPVD
FT                   WRRDDDDLPAIYLIVKAMLEAEEEERAEAA"
FT   gene            complement(624684..625577)
FT                   /locus_tag="Bcen2424_3766"
FT   CDS_pept        complement(624684..625577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3766"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4597 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3766"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10503"
FT                   /protein_id="ABK10503.1"
FT                   /translation="MNNLRRLDLNLLVTLDVLLAEHNVTRAAEKLNMSQPSVSVQLQKL
FT                   RDVFGDPLLLPGPRGMRPTARAEALREPLRNALEAVERAVIPATPFDPATATHTWRVAA
FT                   TDYGESTIVLPALRTLRSTAPGTRLAVVELVPPRIEQDAERNGIDLAFHTTEGSPPGMR
FT                   RLPLFVERYVLIGRAGHPKLKRRPTLAQFATLEHVIVSPDGGGFFGVTDEVLAKAGATR
FT                   RVVLSVPHFLFVMSAVASTDLVAMLPERLVRDVPALRVVDAPVEVPGYEMSMLWHERVH
FT                   RDPAHRWLRETIAAAV"
FT   gene            625664..626443
FT                   /locus_tag="Bcen2424_3767"
FT   CDS_pept        625664..626443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3767"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   bcn:Bcen_4596 NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3767"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10504"
FT                   /protein_id="ABK10504.1"
FT                   /translation="MNVLIVYAHPEPRSLNGALRDFAVAHLEAAGHAVQVSDLYAMNWK
FT                   ATLDPNDVTDRVPDARFDPSLDSKRAFAAGTQSEDIAREQDKLKWADAVILQFPLWWFS
FT                   MPAIMKGWFERVYAYGFAYGVGEHSDTHWGDRYGEGMLAGKRAMIVVTTGGWESHYSRR
FT                   GINGPIDDLLFPIQHGVLYYPGFDVLPPFVIYRTGKMNAARFDQTCTALGQRLNDLWTT
FT                   PPIPFRRQNAGDYEIPALTLKEDIAPGKVGFAAHLTA"
FT   gene            complement(626624..626914)
FT                   /locus_tag="Bcen2424_3768"
FT   CDS_pept        complement(626624..626914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3768"
FT                   /product="muconolactone delta-isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /note="PFAM: Muconolactone delta-isomerase; KEGG:
FT                   bcn:Bcen_4595 muconolactone delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10505"
FT                   /protein_id="ABK10505.1"
FT                   /translation="MLFHVEMTVRLPADMDPVKAATLKAEEKAMCQRLMNEGVWRHLWR
FT                   IAGQYANVSIFDVESVQQLHDVLSQLPLFPYMEMEVRALCRHPSSVRDDDR"
FT   gene            complement(626958..627860)
FT                   /locus_tag="Bcen2424_3769"
FT   CDS_pept        complement(626958..627860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3769"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /note="TIGRFAM: catechol 1,2-dioxygenase; PFAM: intradiol
FT                   ring-cleavage dioxygenase; Catechol dioxygenase, N-terminal
FT                   domain protein; KEGG: bcn:Bcen_4594 catechol
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3769"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10506"
FT                   /protein_id="ABK10506.1"
FT                   /translation="MNKQAIDALLKTFDDAAEKPGNPRVRAIVNRIVKDICYTIEDFDV
FT                   QPSEFWTALNYLNEAGREFGLIAAGLGLERFLDVRMDEAEAKAGIQGGTPRTIEGPLYV
FT                   AGAPESVGHARLDDGTDPGQTLIMRGRVLGQDGAPLANALVEVWHANHLGNYSYFDASQ
FT                   PAFNLRRSIRTDAEGRYSFRSVLPVGYSVPPGSKTEQLLDQLGRHGHRPAHIHFFVSAD
FT                   GYRKLTTQINIDGDPHLWDDFAFATRDGLIPPVRQAEGAEGKPYGVDGQFALIDFDFSL
FT                   LKDKQDVPGSEVERARAQA"
FT   gene            complement(627893..629026)
FT                   /locus_tag="Bcen2424_3770"
FT   CDS_pept        complement(627893..629026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3770"
FT                   /product="muconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /note="KEGG: bcn:Bcen_4593 muconate and chloromuconate
FT                   cycloisomerase; TIGRFAM: muconate and chloromuconate
FT                   cycloisomerases; PFAM: Mandelate racemase/muconate
FT                   lactonizing enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10507"
FT                   /protein_id="ABK10507.1"
FT                   /translation="MIATAATIERIETLLVDVPTIRPHKLSVATMNCQTLVLVRVRCTD
FT                   GIEGVGEATTIGGLAYGEESPESIKVNIDTYFAPLLQGLDATRPGAALARARKLFQGNR
FT                   FAKCAIETALFDAQARRLGVPLSELFGGRRTDTVDVAWTLASGDTQRDIAEAEAMLDAR
FT                   RHRAFKLKIGSNAVADDVAHVVAIKRALGERGDVRVDVNQAWSETDAIWAGARLADAGV
FT                   SLVEQPIAATNRAGLKRLTQLAQVPIMADEALHGAVDAFALAQDRAADVFAVKIAQSGG
FT                   LQGAASVASIAAAAGIELYGGTMLEGAAGTMASAQLFSTFDSLKWGTELFGPLLLTEEI
FT                   LVEPLRYEDFKLHLPATPGLGITFDWARIERMRRGAR"
FT   gene            629118..630008
FT                   /locus_tag="Bcen2424_3771"
FT   CDS_pept        629118..630008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3771"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4592 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3771"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10508"
FT                   /protein_id="ABK10508.1"
FT                   /translation="MELRQLRYFIAVAEEMNITRAAERLHMTQPPLSRQLQAIEEEIGL
FT                   PLFERGARPLKLTDAGRVFYAQAKRLVDQADELGPLTRRLAQLSERIVIGFVPSALYGA
FT                   LPDVIRAFREAQPDVELSLIEMFTLEQLGALKGGRIDVGFGRLRFDDDQLVREALIEEK
FT                   LIAALPAGHRLADPARPLTLADLANETMIVYPSTPRPSFADQQLSALRDGAVVPAAVHE
FT                   VRELQTALGLVAAQVGVSLVPESVEGVRVKGVVYRRLPEPGATSPIIMSRRLHGESAAT
FT                   AAFCAIAREMIVPAA"
FT   gene            630177..631874
FT                   /locus_tag="Bcen2424_3772"
FT   CDS_pept        630177..631874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3772"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bcn:Bcen_4591
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3772"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10509"
FT                   /protein_id="ABK10509.1"
FT                   /translation="MSRFGKSIKFRIFFALAACVALMVAIGVFGLFGLSRLNANVHDAY
FT                   TGNTLPISELSEIRAATFETQLRLRGASSERDPARLRSGIDETRAEQRRLDTIWNRYYG
FT                   QSITSEKEQRIADRIRDVLPRFRAGVDAALAAVDGGDRDAATAAIDRLAPAAGALKQAL
FT                   DDDIALNIDQAKSFVDDSASTFVMILWIAIGLIGIGVLVAAWVSAHLMRHISTPLGQAV
FT                   SVADEIAGGSLDNRIDIASHDEFGRLLGALATMDRQLGTTVRGIKRSAEAVAVASRQIA
FT                   SGNADLSARTEEQAASLEETASSMTQLTETVRQNADNAQQANTLATRATGMADAGNDAV
FT                   QSMVATIGQISSSSSQVSDITGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVASEV
FT                   RSLAQRSAAAAKEIKELIGASVSMIRDSAQQATGVGATMGDVKLAIKQVSDIVAEIAAA
FT                   SREQSQGIGQVNLAIEQMDQVTQQNAALVEQAAAAAHSLEEQAGRLQAAMATFKLAPNA
FT                   VDVPAVTSVAPAPASALALAPTKPPVVEPLAAGLSVPVAGGAVDWKAF"
FT   sig_peptide     630177..630302
FT                   /locus_tag="Bcen2424_3772"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.482 at
FT                   residue 42"
FT   gene            631919..632230
FT                   /locus_tag="Bcen2424_3773"
FT   CDS_pept        631919..632230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3773"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3773"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10510"
FT                   /protein_id="ABK10510.1"
FT                   /translation="MKGSTRSAHVVLTLDALVDACVRFDPSDGDQRLIVRTLVVPMLAR
FT                   RLKWLGLLLRASPRSEATRTMLERIEGALACAAARLEAARRPSADTATNAVPRRGPRA"
FT   gene            complement(632378..633337)
FT                   /locus_tag="Bcen2424_3774"
FT   CDS_pept        complement(632378..633337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3774"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_4589 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3774"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10511"
FT                   /protein_id="ABK10511.1"
FT                   /translation="MSPTSFEPLALRAHRLFESRDLDETRERISRVMQPHALLPSGRVR
FT                   GASHMDFVKLGGLGIGTIAFGDAMRVQVDAVDGYYLLMFCLSGQAEVRAMGRQLGVDGQ
FT                   TGVLCAPGERFDAVLSADCEQFVLRIDAATVGALTGNPRAMLDPVLHVSDTALAAWRQQ
FT                   LMLVARSPELLERANANPRVASQLEHLLIDLLIEGHPPSVLQAAHRDPAPGFVRRAQEF
FT                   VDAHYAQPLQLADIVQAANVPERTLRDAFLQFRGMSPMQYLRATRLAHARELLRGAASD
FT                   RRIADIALDCGFTHLGRFAIAYREKFGESPSETLDARR"
FT   gene            633514..634821
FT                   /locus_tag="Bcen2424_3775"
FT   CDS_pept        633514..634821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3775"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: bcn:Bcen_4588 Rieske
FT                   (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10512"
FT                   /protein_id="ABK10512.1"
FT                   /translation="MHSTQRNHKESDMEQTESPVVFAARGDASDVTFPHDDGSRVPYKV
FT                   FSSRAVYDREQERIFRGPTWNFVALEAEIPNAGDFKSTFVGDTPVVVTRTEDGTLSAWV
FT                   NRCAHRGAQVCRKSRGNASSHTCVYHQWSFDNQGNLLGVPFRRGQKGMTGMPADFDPKQ
FT                   HGLRKLRVDSYRGLVFATFSDEVAPLPEYLGEQMRPWIDRIFHKPIEYLGCTRQYSKSN
FT                   WKLYMENVKDPYHASMLHLFHTTFNIFRVGMKARSIPDANHGLHSIITVTKTGDDTSAA
FT                   YKQQNIRSFDEGFHLEDESILDLVSEYDEDCTNHIQPIFPQLVIQQIHNTLVARQILPK
FT                   GPDNFELIFHFFGYADDTPELRALRIKQANLVGPAGYISMEDTEATELVQRGTVRDADA
FT                   TSVIEMSRGNPDQQDTVITESLIRKFWVGYQKLMGY"
FT   gene            634836..635312
FT                   /locus_tag="Bcen2424_3776"
FT   CDS_pept        634836..635312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3776"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: bcn:Bcen_4587 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10513"
FT                   /protein_id="ABK10513.1"
FT                   /translation="MTEDMKTWFEIYMLQNRYIGHLDNDRLEHWPEMFTEDCTYEIVPK
FT                   ENADLGLPVGIVHCTNQRMLRDRVVSLRHANIYEEHTYRHMTSGLTIVAERDGEFDTES
FT                   NYVVVQTRSNGESNVYQAGKYYDTVVRTPDGWRYKTKRVIYDTSRVQTLLATPI"
FT   gene            635348..635674
FT                   /locus_tag="Bcen2424_3777"
FT   CDS_pept        635348..635674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3777"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bcn:Bcen_4586 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3777"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10514"
FT                   /protein_id="ABK10514.1"
FT                   /translation="MTEATLAEWHPLGAFDEFSEDEPAARVAGQKPIAVFRIGDELFAM
FT                   HDLCTHGHARLSEGYVEDGCVECPLHQGLIDIRTGAPKCAPITEPVRTYPIRIVDGQVE
FT                   VNVG"
FT   gene            635664..636884
FT                   /locus_tag="Bcen2424_3778"
FT   CDS_pept        635664..636884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3778"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bcn:Bcen_4585 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3778"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10515"
FT                   /protein_id="ABK10515.1"
FT                   /translation="MSADPFVIVGAGHAARRTAEALRERDATARIVMIGAERELPYDRP
FT                   ALSKDALLTDGGERRAFIRDAAWYDTQRIELRLGTRVDAIERDARRVRLDDGATVPYGQ
FT                   LVLATGSRVRPFGGAIDEGVAVHYVRTVDDARALRARLAPGRRVAVLGGGFIGLEVAAA
FT                   ARQLGCDVTVIDPAPRLLQRALPEVVGAYARRLHEARGVIFQLATLPRAIRRAPGGDAV
FT                   VETDRGDVPADIVVVGIGVVPNVELAQAAGLDVDNGIRVDAGCRTADAAIFAAGEVTMH
FT                   FNPLLGRHVRIESWQVAENQPAVAAANLLGADETYAELPWLWSDQYDCNLQMLGLFGSE
FT                   RTIVVRGDPASGPFTVFGLGDDGRIVAVAAANLGRDIGASRRLIAAGAVPDPVKLADPA
FT                   VNLKTFL"
FT   gene            637037..638323
FT                   /locus_tag="Bcen2424_3779"
FT   CDS_pept        637037..638323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3779"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   bcn:Bcen_4584 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3779"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10516"
FT                   /protein_id="ABK10516.1"
FT                   /translation="MTPDKALELKRSKRRALWLLLAAVAVFVTTILLPRGPWVDGFKAV
FT                   AEAAMVGALADWFAVVALFRRVPIPFVSRHTEIIPKNKDKIADNLAVFVREKFLGPDAL
FT                   AAQIRQHDPAQKLGAWLGEPANTDALGGYVTKLMSFALDMTDDARIQSFVHDAFRAVID
FT                   RVDLSQSAGAILDTLTKDGRHQALLDDAIEQVVDVLDKEENREVIAGFIVEWLKTQYPK
FT                   VEKIMPTQWFGENGARMLASAVSRVLEGVAADPEHELRQRFDRTVVRLTERLKHDPAFI
FT                   AKGEEIKRYIRDGDAFNEYVRDLWDQLRAWLKADLARPDSALHRQAATLGGWLGARLAG
FT                   SPALRASLNEHVERAVHEMAPDFADFLMRHIRDTVRNWDAREMSRQIELNIGKDLQYIR
FT                   INGTLVGGLIGLGLYLVSLVPRWAAGWLH"
FT   sig_peptide     637037..637129
FT                   /locus_tag="Bcen2424_3779"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.330 at
FT                   residue 31"
FT   gene            complement(638372..638671)
FT                   /locus_tag="Bcen2424_3780"
FT   CDS_pept        complement(638372..638671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3780"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: bcn:Bcen_4583 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10517"
FT                   /protein_id="ABK10517.1"
FT                   /translation="MDKIKTRPWDSAEHLKTEDDMADYFDACLQEAGDDPAFIAHALGV
FT                   IARARGMSQVARDAGLSREGLYKALSHDGNPSFGTILKVIKALGLQLHGAKAAA"
FT   gene            complement(638675..639013)
FT                   /locus_tag="Bcen2424_3781"
FT   CDS_pept        complement(638675..639013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3781"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   bcn:Bcen_4582 protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3781"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10518"
FT                   /protein_id="ABK10518.1"
FT                   /translation="MVDILQSVPYSAPTFSIRTTDVFEAWFAGLPDRVARRRIQARIDR
FT                   LSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILLCGGDKSTQQADIRAAHA
FT                   MPAHLDME"
FT   gene            639392..641032
FT                   /locus_tag="Bcen2424_3782"
FT   CDS_pept        639392..641032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3782"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: bcn:Bcen_4581 thiamine pyrophosphate enzyme-like
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3782"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10519"
FT                   /protein_id="ABK10519.1"
FT                   /translation="MKASDLFVKALEAEGVEYVFGIPGEENLDLLESLRRSKIKLVLTR
FT                   HEQAAGFMAATYGRLTGRTGVCLATLGPGATNFVTAAAYAQLGGMPMLMITGQKPIKSS
FT                   KQGHFQIVDVVDMMQPLTKFTRQIVSIGNIPSAVREAFRRAEEERPGAAHLELPEDIAH
FT                   EEGDGKPIPRSYSRRPVAEEKAVAHAVDAIQAARHPLLMIGAGGNRKTTCKMLLEFVDK
FT                   TGIPFFTTQMGKGVIDETHPLWLGNATLSDGDFVHRAIEQADCIINVGHDVIEKPPFFM
FT                   RTDDKTVIHVNFLGAQVDPVYFPQIEVVGDIANAVWQMKEALTPQSHWDFERFKMIKAH
FT                   FDAHLEKGQHDPRFPMYPVRIVNDLYNALPVDGIVCLDNGMYKIWFARYWRAHEPNSLL
FT                   LDNALASMGAGLPSAIATKIVHPQRKVIAVCGDGGFMMNSQELETAVRLKLDIVVMILR
FT                   DDAFGMIRWKQENMNFPDFAMTLQNPDFVSYAQSYGAHGHRVESADDLEPLLRECFSSP
FT                   GVHVIDVPIDYSDNERVLNREIKRLSAQL"
FT   gene            641061..642494
FT                   /locus_tag="Bcen2424_3783"
FT   CDS_pept        641061..642494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3783"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_4580
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3783"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10520"
FT                   /protein_id="ABK10520.1"
FT                   /translation="MLKETYPYYLANEAVYANTDLEVTDKFSGKVATRVALADAKAIDA
FT                   AIAAAVDATKPMREMPAYQRQAVLDHCVARFRERFDELAEALCIEAGKPINDSKGEVTR
FT                   LIDTFRVASEESVRIDGEIVNLEISARAQGYTGYTKRVPVGPCSFISPFNFPLNLAAHK
FT                   VAPALAAGCPFVLKPASRTPIGALIIGEVLAETDLPKGAFSVLPAHRDGADLFTTDERF
FT                   KLLSFTGSPAVGWALKEKAGKKKVVLELGGNAAAIVDADQRDRLDYVVERLAFGAYYQS
FT                   GQSCIGVQRILVHADLYDALREKLIAKTRSLKMGDPKDPSTFVGPMISESESRRLSGWM
FT                   DAAVAAGAKIVAGGKVDGAMFEATLLENVGREQDLYRKEAFGPVAILEKFDRFDDALAR
FT                   VNDSDFGLQAGVFTDSLTHAHRAWDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREG
FT                   IRYAIEDMTEPRLMVVRRR"
FT   gene            642724..644307
FT                   /locus_tag="Bcen2424_3784"
FT   CDS_pept        642724..644307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3784"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: bcn:Bcen_4579 Na+/H+ antiporter; TC
FT                   2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3784"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10521"
FT                   /protein_id="ABK10521.1"
FT                   /translation="MSPVSAFKLVLLSFLAIVALECIAKRLRLPPAAALLIGGIGIAFI
FT                   PGLPPINLDPELVLLVFLPPLLMDGAYFSVWEEFKRNVGGILMLAIGAVVFTTFAVGFA
FT                   VHWVVPALPWAACFALGAIVSPPDAVAAKAVLERVALPRRLMVLLEGESLLNDAAGLVL
FT                   FRFAVAAALTGAFSLEHAVVRFAELGLGGVVVGFVVGKLVVWFLKLLDDDYLVITVAVI
FT                   AGWIAYIAGEMVEVSGVISTVTAGMIIGWHQHEVFSAAVRTRGTAFWQVIVFLLEAMVF
FT                   VLIGLSLRGAIHRLGGFEQVLGTMVPPVLAVLAAVVLSRFVWIYAVEALKWPVRGLARR
FT                   GEAPDWKAATIMSWAGMRGVVTLAIALSLPEALPGRDVILVASFAVILVTVLLQGTTIG
FT                   PLIRLLRLPQREERAAHHLTEPQTWAYVEAAQLAAIQPLVRDENGVVIHPRLLEQYTYR
FT                   AELTERTKNEPAYPAEVRMAHYDVVLAAIRAGRAELLRLHRSGRIHDEMLHALERDLDL
FT                   QEVSAQHARG"
FT   gene            644792..645925
FT                   /locus_tag="Bcen2424_3785"
FT   CDS_pept        644792..645925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3785"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: bcn:Bcen_4578
FT                   response regulator receiver sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3785"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10522"
FT                   /protein_id="ABK10522.1"
FT                   /translation="MKESIGDSAFETVFMKESSSDNASDCLESGLSVLLVDDQPFVGEV
FT                   IRRALRSEHDIDLHVCTDAHRAMAVARDVKPTVILQDLVMPEIDGLDLVRAWRADAGTA
FT                   RVPIIVLSAKEEPIVKREAFIAGANDYLVKLPDAMELTARIRYHSNSYLMSRQRDEALD
FT                   FLSHDMRSPQTSILALLDVYRTEHGDMPAIMERIAGHARRALALADGFIHLTRAQSERR
FT                   AHEVVSLNEIVLDAVDQLWEKAAGLGCRVIAHVPDTECVTMGDRMMLTRAVANLVDNGL
FT                   KYGPAGMDVHCTLTGEGGAWLIGVEDAGTGIAPEQRTAATESFVQLESAHGAARGGFGL
FT                   GLAFVRATAARHRGQILMRNTARGFMVALRLPAQAER"
FT   gene            646050..647726
FT                   /locus_tag="Bcen2424_3786"
FT   CDS_pept        646050..647726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3786"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bcn:Bcen_4577
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10523"
FT                   /protein_id="ABK10523.1"
FT                   /translation="MATVTPRATNESLHPTIGAARLTLGNRILLSFGVLFVLMLVTAGV
FT                   SYERLRAINAEAVSIERDSLPGVYLASSLRAAVNETFVMLQQATFVETDPDAVQRDLAK
FT                   IADATKQVESLSVDYQASIFRDDDRARFATFRGAYDRYLPLLTDAVQRHRGSRDEAIAA
FT                   YAKVLPGWAEVVQDANIMVQENRKFADQSARVIRESVQDAEVVLVGALTIMLLSALGLG
FT                   YMLYRSVTVPMARLVEVHDVMRTGNLTHRLDLRRRDEFGTLETGFNRMADELTELVARA
FT                   QQSSMQVTTSVAEIAATSREQQATANETAATTTEIGATSREIFATSRDLLRTMNEVAGV
FT                   AEQSATLAGVSQSGLTRMGETMRSVMDAAGSVNAKLAILNEKALNINQVVATITKVADQ
FT                   TNLLSLNAAIEAEKAGEYGRGFAVVATEIRRLADQTAVATYDIEQTVKEIQSAVSAGVM
FT                   GMDKFSEEVRRGMLDVQQVGGQLSQIIAEVQTLAPRFQMVNEGMQTQANGAEQITQALS
FT                   QLSEAAQQTAESLRQSSQAIDDLTLVANQLRTSVSRFKVDA"
FT   gene            647723..648235
FT                   /locus_tag="Bcen2424_3787"
FT   CDS_pept        647723..648235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3787"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bcn:Bcen_4576 CheW
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3787"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10524"
FT                   /protein_id="ABK10524.1"
FT                   /translation="MTRADPQNGAHALFLMFELDGERYALDAAGIDEVLPLAVMKAVPG
FT                   APDWIAGLLMRGGQPVPVIDVPMLALGRRAQALRSTRLVMVRHRAGHADGERTIGLIVE
FT                   RATQTMRIDRAAFRASGISTARTRWLGRVANTPDGVVQQVSVPDLVDDVARLYLFDGLP
FT                   GHGEESA"
FT   gene            648232..649650
FT                   /locus_tag="Bcen2424_3788"
FT   CDS_pept        648232..649650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3788"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /note="PFAM: MCP methyltransferase, CheR-type;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG: bcn:Bcen_4575
FT                   MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3788"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10525"
FT                   /protein_id="ABK10525.1"
FT                   /translation="MNMSESRFRGWLLRETGIDPDSLGNDFLMRALADRVHALQADGER
FT                   VPSAARPPVTPEALDAYWQQLNASADERRALIELFVVPETWFFRDREAFATLARLAAER
FT                   LAAMPGRVIRVLSAPCSTGEEPYSAAMALLDAGLEPASFTIDAIDLSARAIEQARLGCY
FT                   GRNAFRGTATEFRTRYFTPTRDGWLLDERVRACVQFSHANLVEPVADTGIRYDFVFCRN
FT                   VLIYFDRDAQDRVIRSLDARLADDGMLFVGPAETGVAMRHGMRSARVPLAFAFHREPAG
FT                   AAADACAARPAAPLSAAAPYPGAERFTVAPLAAPRPVLAVAPPAWLGDVRQPFAVPPPA
FT                   VTTAAIDARADLAVAAAAAAAPANDGIAPTLDEAPTLEDAQALANAGAFDEAERVLAQF
FT                   SARVGPHADAFYLNGLIADARGRAAEASDFYRKALYLRPTHHEALTHLATLLDVGGDRA
FT                   GAQWLLERARRSAG"
FT   gene            649681..650121
FT                   /locus_tag="Bcen2424_3789"
FT   CDS_pept        649681..650121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3789"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10526"
FT                   /protein_id="ABK10526.1"
FT                   /translation="MTRGTLDVLHRLKAEDSHTWRCTSASENVQRSVDITIMLDTTVTA
FT                   GPFSYSQSRDTFRPRRAVFRSARRTGLGRTAFVDFLERGPVRDRFVAKLVSEGRPGCVV
FT                   DALRHPGSGEFCGRHVADRDVIEAPHQIVLPAINGGVSRRKF"
FT   gene            650121..650822
FT                   /locus_tag="Bcen2424_3790"
FT   CDS_pept        650121..650822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3790"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bcn:Bcen_4573 CheW
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3790"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10527"
FT                   /protein_id="ABK10527.1"
FT                   /translation="MNRAATDDATLDVDDCWNRIGTRGDRSCERLNDCLRCLNCPVYAS
FT                   NAAKLLERPLDVAEMTDVTRRMSAFGTAHASDDDGVARHAALAFRVADEWLALPIGVLR
FT                   EIAGTRPIHSLPHRRNSAVRGVVNIRGTLRIAISIGALLGLDAGKAGSGSDDGRFTRLL
FT                   VAAHQGEPVVFPVDEVEGVLRFGASDWVPVPATVGRASAGLSRGVLSWRGKSVGLLDDD
FT                   RLFDAVTRSMR"
FT   gene            650819..653128
FT                   /locus_tag="Bcen2424_3791"
FT   CDS_pept        650819..653128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3791"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; Hpt domain protein; KEGG: bcn:Bcen_4572 CheA
FT                   signal transduction histidine kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3791"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10528"
FT                   /protein_id="ABK10528.1"
FT                   /translation="MSGDDDLSHLSLLELYREETRTQTQALSERLLALESGEPDAVALE
FT                   ACMRAAHSLKGAARIVGVPLGVEIAGRMEECFVAAQAGTIALTATHVDVLLAGVDLLVR
FT                   VGDPQGQPVSQTEIDVFAAALTGADGAQTIQAPAAAPPPVPPSFAPYRDHDGAANEPVG
FT                   ASAAVPPLAVSGAVPHPAQAGRVSGAGAMRRVRADTLNRLLSLSGESLVESRWLKPFAE
FT                   SMLRVKRAQRDAARSLDLMVEQFADDLDAGMLASMNEVRHMLNDLQRSLAERMDEFDRF
FT                   ERRSTHIAEQLYDEALQCRMRPFGDATRAYPRIVRDLARSLGKQVRFSIVGEGTQVDRD
FT                   ILDLLDAPLGHLLRNAIDHGVDSPDARHARGKPAEASVTLEARHSAGSLLVSVIDDGPG
FT                   VDMDALRAAVVRQRLTDDETAARLSDPELLEFLLLPGFSMRDAVTDVSGRGVGLDAVQE
FT                   MVRGVRGAVRIFNEPGAGMRFVLQLPLTLSVIRSLLVEVGGEPYAFPLAHVRRTLELAH
FT                   DDIDVLEGQPHFPFDGRRVGLVAAHQLLDAGEPDVARASTAVVVVGGEPELYGVAVDRF
FT                   LGERMLVVQPLDSRLHKIQNIAAGALLENGDPVLIVDVEDLIRSVDKLVRGGQLARLTR
FT                   DPQLALADRRRRVLVVDDSLTVRELERKLLEKRGYDVTVAVDGMEGWNAVRSDAFDLVV
FT                   TDVDMPRMDGIELVTLIKGDPMLKRVPVMIVSYKDRDEDRRRGLDAGADYYLAKSSFHD
FT                   EALLDAVHDLIGDARG"
FT   gene            653125..654144
FT                   /locus_tag="Bcen2424_3792"
FT   CDS_pept        653125..654144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3792"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: bcn:Bcen_4571 response regulator receiver
FT                   modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3792"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10529"
FT                   /protein_id="ABK10529.1"
FT                   /translation="MNIGIVNDLPLAVEALRRVIALRADHRVLWVATDGDEAVDFCVAH
FT                   PPDVVLMDLVMPKVDGVAATRRIMARAPCAILIVTASVSANTSSVYEAMGAGALDAVDT
FT                   PTLALGLSTDASPQALLAKIDQIGRLLESRTTALVPPGPAPTRGQPTLVAIGASAGGPT
FT                   ALTALLRALPADFPAAIVIVQHVDQAFAYGMAEWLDGYTRLPVRVARQGSVPEAGAVLL
FT                   AATNDHLMLSPRGVLGYTRHPAETPYRPSIDVFFNSVADGWQGDALGVLLTGMGRDGAL
FT                   GLKAMRAKGCYTIAQDQATSAVYGMPKAAAAIGAASAILPLDQIAPQLIARIALTSRD"
FT   gene            654408..655649
FT                   /locus_tag="Bcen2424_3793"
FT   CDS_pept        654408..655649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3793"
FT                   /product="Cl-channel, voltage-gated family protein"
FT                   /note="PFAM: Cl- channel, voltage-gated family protein;
FT                   KEGG: bcn:Bcen_4570 Cl-channel, voltage gated"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3793"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10530"
FT                   /protein_id="ABK10530.1"
FT                   /translation="MFFTTSADLFATVRYVCRWLALSALLGALAGTASALFLIALDWAT
FT                   GTRVAHPWLLWGLPAAGFATGWVYHRFGQSVARGNNLLIDEIHDPKALVPKRMAPLVLV
FT                   ATVVTHLFGGSAGREGTAVQMGGALADRITHVLRLDREHRRVLLMGGIAAGFASVFGTP
FT                   LAGAVFGLEVLAIGRLRYDALLTCVASAIVADVVCRAWGVHHTAYAIPFVPAVSATGLA
FT                   VTVVAGIAFGVVGRLFAFATHALTAWFRRVIRHAPLQPVLGGLLVAVAATVLNVPQYLG
FT                   LGIPTIEAAFHGPLPLYDFAGKFAFTVVTLASGFKGGEVTPLFYIGATLGNALGQVLAL
FT                   PVPVLAGLGFVAVFAGAANTPIASTIMAIELFGADIGVYAIVACVVAYLFSGHAGIYRA
FT                   QRVAVGKGAQGEAE"
FT   sig_peptide     654408..654515
FT                   /locus_tag="Bcen2424_3793"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.576 at
FT                   residue 36"
FT   gene            655670..656314
FT                   /locus_tag="Bcen2424_3794"
FT   CDS_pept        655670..656314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3794"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3794"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10531"
FT                   /protein_id="ABK10531.1"
FT                   /translation="MMSLDRGGSMRYPGCKTTDGHPMTLDDFLTEAKRLARPSRQYRFA
FT                   DDGEPVTGYWHGVDAGALCISVERDGVWLNVCLDESGTSGRVETATQPVRSDRPLCRSD
FT                   AMSLPSVDAVFRFGSAAIGAYLDAHGWQRDWGFNGNFKGAAAHDYEREWMAQCPLYTGG
FT                   VVAVAGGWNMPWPEDDELDDRELVLWTFEASEPWVEVFSDGSRYSVIQRIT"
FT   gene            complement(656333..657046)
FT                   /locus_tag="Bcen2424_3795"
FT   CDS_pept        complement(656333..657046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3795"
FT                   /product="riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: bcn:Bcen_4568 riboflavin
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3795"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10532"
FT                   /protein_id="ABK10532.1"
FT                   /translation="MFTGIVQGVGTIDAIKDHGELRTFSIAFPERFTDDIEIGASVSVD
FT                   GVCLTVTTIHSPVLIDFDVMLPSLRITTLADLATGARVNVERAAKDGAEIGGHPLSGHV
FT                   DFTGTIAHIASSEHNRMIRIGVPAEFKRYVFAKGYIAINGCSLTVSDVNRDEGWFDVWL
FT                   IPETRRATTFDAKGVDDKVNIEIERSTQVVVDTIRESVKETLGELNGVVTALLAEKGID
FT                   IEELLARNVARLPKQ"
FT   gene            complement(657205..657822)
FT                   /locus_tag="Bcen2424_3796"
FT   CDS_pept        complement(657205..657822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3796"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_4567 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3796"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10533"
FT                   /protein_id="ABK10533.1"
FT                   /translation="MTRRHGFNRRVMPAIRLAWSMHDEEMMLQPDETRIESNRLWLTPF
FT                   SAKDADATLACITPSLTRYMGWDPPANRESFDRIWQTWLHAQTDGTDYVFVIRQRDGGS
FT                   FLGLVGVHHVKQAIPELGVWIREDRHREGIGREAVRLVVEWACSTLNVQRFNYPVAEEN
FT                   HPSRRIAESLGGTVTGHSETSKFVSVIYQIPAPVTCESPGQA"
FT   gene            complement(657840..659702)
FT                   /locus_tag="Bcen2424_3797"
FT   CDS_pept        complement(657840..659702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3797"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: bcn:Bcen_4566
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3797"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10534"
FT                   /protein_id="ABK10534.1"
FT                   /translation="MTRKTSHLGGQAFQAVFGFTIRYWRKQPARIATVASLALLAALAD
FT                   VLTPLFAGRLVDALSTGLTDRAAAWHSALVAFGTLAALGIGATVLRQGVYLNIITLTLK
FT                   MMSEIAAASFHRVQRFSTDWHANSFAGSTVRKITRGIWALDLLNDTVLIALLPSVAMLV
FT                   GATVLLGTHWPVMGLVVGAGSLLYIAVTVAVSLGIVAPAARLGNLWDTRMGGALADAVS
FT                   CNAVVKAFGAETREEARLARVIDKWRQRTRRTWVRGTFNGGLQGAMLVAMQAAMIGVAL
FT                   RLWMNDEASVGDIAFALTMFFMLQGYLRDVGMHIRNLQRSVNDMEELVALERQPLGIDD
FT                   RPGAPAIRIGQGEIRFEHVTFRYGNHPVPLYDDFSMRIAPGERVGLVGHSGSGKTTFIK
FT                   LIQRLYDVSGGRITIDGQDIAQVRQDSLRSQIAIVQQEPVLFHRTLAENIAYARPGASR
FT                   ADIERAARLASAHDFIAALPDGYDTLVGERGIKLSGGERQRVAIARAFLADAPILILDE
FT                   ATSSLDSESELLIQQAMERLMVGRTTLVVAHRLSTVRALDRLLVLDRGKVIEEGNHDAL
FT                   IRIDGGIYRRLFERQALELAKGLADSPRRVADRDAGALGEPAKV"
FT   sig_peptide     complement(659568..659702)
FT                   /locus_tag="Bcen2424_3797"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.694) with cleavage site probability 0.674 at
FT                   residue 45"
FT   gene            660195..661076
FT                   /locus_tag="Bcen2424_3798"
FT   CDS_pept        660195..661076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3798"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; PFAM: Dyp-type
FT                   peroxidase; KEGG: bcn:Bcen_4565 Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3798"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10535"
FT                   /protein_id="ABK10535.1"
FT                   /translation="MSDVQQGILAPIDTAARYLTFTMSNDGNIAAALAALREIVDGRDT
FT                   VVGFGHALAAWLGHSVPGLTEYPAFAVNDRTLPRTPADVWVWLRSDDRGEIVLRAREIE
FT                   RALAPAFTLQEAVDGFRYSNDRDLSGYEDGTENPEGDDAVAAAIVTGQGAGLDGSSFVA
FT                   VQQWVHDFDQMERIPSGEMDHIIGRRRSDNEELDDAPEFAHVKRTAQESFEPEAFMLRR
FT                   SSPWSDTRRAGLYFVAFGCSFRAFDVQMRRMSGAEDGIVDGLFRFTRPLTGAYFWCPPM
FT                   KDGKLDLAALGL"
FT   gene            complement(661181..661582)
FT                   /locus_tag="Bcen2424_3799"
FT   CDS_pept        complement(661181..661582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3799"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcn:Bcen_4564
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3799"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10536"
FT                   /protein_id="ABK10536.1"
FT                   /translation="MSLIHAAAVLDADAPDYVVQLQAGTHTLTGDEAPREGGQDRGPAP
FT                   YEFVLAGLAQCTAATLRMYMQRKTWPAARIAVRTELHADREGVQYVRRVVTLDGPLDDA
FT                   QRQRLTEICEKTPVTQFIKRGTRIETTLN"
FT   gene            complement(661680..662603)
FT                   /locus_tag="Bcen2424_3800"
FT   CDS_pept        complement(661680..662603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3800"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4563 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3800"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10537"
FT                   /protein_id="ABK10537.1"
FT                   /translation="MPADHRLDLNLFRVLDAVYVHGGIGAAARALHLTQPAVTHALNRL
FT                   RAHFDDPLFVRQGNRVVPTERTRSIIADVQLHLKGLQGTARDPSAFDPATLDLSIAVGI
FT                   RDVLESIALPRIVAAFADEAPGLRLVSRRIAVPDIERELASGNLDLVVDRRVQTGPRIA
FT                   TEHLLDDSLVVALRRDHPLAHDPLRRGDYFAAQHIAVSSLGEPQSLDVLLGNDGRFRDI
FT                   RLTCQHYFAACQIAAAGNLLVTLPHTYALRMAALLPIVVRPLPLRLKPFPLLAYWHESR
FT                   DTDRAHQWVRERIATLVRSSAGIADA"
FT   gene            663045..664163
FT                   /locus_tag="Bcen2424_3801"
FT   CDS_pept        663045..664163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3801"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_4562 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3801"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10538"
FT                   /protein_id="ABK10538.1"
FT                   /translation="MNAADQRWVVIYLSTGFSLAQAARLGEAFNLANRLHAYSADYQLK
FT                   YVSESGGLLQSSSGVRIAAEPFGDEHSRRARAFFHLHGERAAVNWDDALQRRLSDIRQH
FT                   ARWIVDAMELPALAATRRPSSSIDVRPGRAGRRATTTIELQAGETDVFAAALDMFRVDL
FT                   GDGAAQEIASNMMRPVEQRYAQSMWAFRELSASPSIRMSAQRLRAQSVNRISIANAAQA
FT                   AAMSERNFLRRFKKEIGVTPTEFVQHVRLERACHMLIHTTLPADKVARRTGFGSGERLA
FT                   KLFRQRLLMSPTEFRVAEREKILAHGAASPDPDERLAAACCDGDGADCDACVAARGKTG
FT                   RIPVKSTDRDLDSRFPCPSSPLPPPPLSARRK"
FT   gene            664112..665428
FT                   /locus_tag="Bcen2424_3802"
FT   CDS_pept        664112..665428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3802"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   bcn:Bcen_4561 NRAMP family Mn2+/Fe2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3802"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10539"
FT                   /protein_id="ABK10539.1"
FT                   /translation="MPFLPTTATAPFCPSEVKGSITIDAAAPRWQKLRRFFGPGLLVAI
FT                   GYMDPGNWATDIQAGSQFGYSLLWVVAFSSLAAIFLQMLAARLGLVAGKDLAQASYERY
FT                   GRFGRVVQWITAEVSIIACDIAEVLGCALAFKLLLGVPLAWGVVLTALDTVIVLGLQGK
FT                   GFRQIEAIVLGLIATMAFCFVAQVAITPPDWHAVVGGLVPGDPGHDRKDAIVLALGIVG
FT                   ATIMPHNLYLHSSVVQTRHVVGGARGVIRDTLALVRIDTCVSLFVAMLVNAAILVVAGA
FT                   AFHATGQHNVTDIEQAYRLITPIAGGAAALLFGIALLASGQSSTLTGTIAGQVIMDGFL
FT                   HTKIPCYQRRLITRGLALVPALIGVLWLGDGSVGQLLVWSQVLLSLQLPFAMWPLIRSV
FT                   SDRRTMGEHAIGRGMQVAAWALFAVITGTNLLLITGVAG"
FT   gene            665509..666099
FT                   /locus_tag="Bcen2424_3803"
FT   CDS_pept        665509..666099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3803"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   bcn:Bcen_4560 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3803"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10540"
FT                   /protein_id="ABK10540.1"
FT                   /translation="MWSEISNIGDAALTLPIAVTCAAWLALTDWRLAARWGVLLAAGMG
FT                   VVGATKILYAGCGIELARFDFRVISGHTMLSTSVWTVALSMLWQAFRPGKAPGVAAGLA
FT                   IGAITAVARVFDHSHTVPEVVIGWLLGALVALVFLRGYDGVRQRAFSPRVAAVCLLLVS
FT                   GIAYGHRAPFQQMIDTHSPQLCAFVRAPSGEGF"
FT   gene            666572..667360
FT                   /locus_tag="Bcen2424_3804"
FT   CDS_pept        666572..667360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3804"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: bcn:Bcen_4559 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3804"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10541"
FT                   /protein_id="ABK10541.1"
FT                   /translation="MTILSPRLAGKCAYITGAAGGLGRAIARRMVEQGARVFVTDIAEA
FT                   AVLDAFAQELNAGHATPVAFAATQDVRDEARWQALLAQATDAMGGLSVLVNNAGVGSIG
FT                   SPAQIELDEWRRVMAINVESIVLGCKHALSYLAESYPASIINISSVAAFKVEPDFTAYN
FT                   ASKAAVASLTKSVAIDCARREIDVRCNSIHPAFIRTGIVEPLFQSLGERDATRKLARGI
FT                   PLRRLGEPDDVAHAAVYLASDESRFVTAAELVIDGGMCAV"
FT   gene            667398..668414
FT                   /locus_tag="Bcen2424_3805"
FT   CDS_pept        667398..668414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3805"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcn:Bcen_4558 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3805"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10542"
FT                   /protein_id="ABK10542.1"
FT                   /translation="MSTPVNRQLLLKTRPEGRVGRDHFSLVETPVPALADGEVLVRVLY
FT                   LSMDPTNRVWMSDVPQYLPPVAIGEVMRALGIGRVVASRHAGFAEGDLVQGLVGWQDYA
FT                   VVPAEQVAQLVKLPAQSGLPLPTLLGACGMSGLTAYYGLTDIAPVQPGETLVVSAAAGS
FT                   VGSIAGQIGKIHGARVVGIAGGADKCRYLTETLGFDAAVDYKADDFRQQLKAATPDGVH
FT                   VNFENVGGEVMRAVLSRMVIGGRVALCGVISNYNSGRAADDVGVLISKRLTMRGFLILD
FT                   YRKSREAVQTLAGWLRDGRLKAEETVADGLENAPDVLNRLFDGDHRGKLVLRVDPDA"
FT   gene            668610..669122
FT                   /locus_tag="Bcen2424_3806"
FT   CDS_pept        668610..669122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3806"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3806"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10543"
FT                   /protein_id="ABK10543.1"
FT                   /translation="MRNNAKRSASVTAMSAGAVRKRVFGLGIVLAMSIAMSSAMAAGQP
FT                   ASDGVVRFTGSLVDLYDVTLDAPVGALVDAGQAADGGATATVRFDAHGRRLPGAQVALV
FT                   KPDGAAFAPDDGTAVRATWRDAHTERSMPLAPGRVHRVGPYGGVMTVAADEATGAVAPV
FT                   VIHIRHP"
FT   sig_peptide     668610..668735
FT                   /locus_tag="Bcen2424_3806"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 42"
FT   gene            complement(669166..670227)
FT                   /locus_tag="Bcen2424_3807"
FT   CDS_pept        complement(669166..670227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3807"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bcn:Bcen_4556 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3807"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10544"
FT                   /protein_id="ABK10544.1"
FT                   /translation="MPLMDSGQDHQKFFYFLLFAVTVGLCWILAPFSGAVFWGTILAIL
FT                   FQPVQRWLAARFGKRRNLAALVTMSLIILIVILPLVFVTATLVQEIAYVYQELKDAQPN
FT                   YSQYFHDIIHALPTSIQNLLQKYGLTNIPGIQKKLTDGAAQISQFAATQALSIGQNTFQ
FT                   FVVSFGVMLYMVFFLLRDGGEIGRRVRRALPLDEEHKNLLLAKFTTVVRATVKGNIAVA
FT                   LVQGALGGLIFWILGIEGVVLWGALMAFLSLLPAIGASLVWVPAALYFLMIGAVWKCVI
FT                   LVAFCVGVIGLVDNLLRPILVGKDTKMPDWVVLISTLGGMALFGINGFVIGPLVAALFM
FT                   ASWDIYARSEQGE"
FT   gene            complement(670454..671038)
FT                   /locus_tag="Bcen2424_3808"
FT   CDS_pept        complement(670454..671038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3808"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3808"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10545"
FT                   /protein_id="ABK10545.1"
FT                   /translation="MQKSLAMKAAAAVMLGSLALAGCTTTPGKPDSAAASASKRQSIDA
FT                   SVNATLSRLYSTVPGSRDLVSKARGVLVFPNVLQAGFIVGAQSGNGALRVGGSTVGYYN
FT                   TSSLSVGLQAGAQSKAVVFLFMTQDALDSFRKSDGWSAGADASVAVVKVGANGAVDSNT
FT                   ATAPVEVLVLTNAGLMGDLSVNGTKVTKLNI"
FT   sig_peptide     complement(670970..671038)
FT                   /locus_tag="Bcen2424_3808"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.379 at
FT                   residue 23"
FT   gene            complement(671098..671484)
FT                   /locus_tag="Bcen2424_3809"
FT   CDS_pept        complement(671098..671484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3809"
FT                   /product="protein of unknown function DUF883, ElaB"
FT                   /note="PFAM: protein of unknown function DUF883, ElaB;
FT                   KEGG: bcn:Bcen_4554 protein of unknown function DUF883,
FT                   ElaB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3809"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10546"
FT                   /protein_id="ABK10546.1"
FT                   /translation="MALTDSIEHKLDRGLSDIRRTGRRVGRTTRAAARDLHADVTDDLR
FT                   GLVDELEDLLKNDGDGDIAALRKRVQSRLDEARGALDYASGSAAARLRDSAERVSQVVH
FT                   ENPWQTAGVVAGLAFVAGLLLSRR"
FT   gene            complement(671782..673581)
FT                   /locus_tag="Bcen2424_3810"
FT   CDS_pept        complement(671782..673581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3810"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bcn:Bcen_4553 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3810"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10547"
FT                   /protein_id="ABK10547.1"
FT                   /translation="MALLAPPAAAAALPVSSGCGGAATAIAELRRGGGPSPLAGQTTSI
FT                   EAVVTAAFGGADGLGGFFVQQADAQRQRRPGVPEGLFVYAPNTRATPGDLVHLTGKVDE
FT                   KYGRTQFTLTSRMAVCARGQTVTPATLTLPVASLAVLAAHEAMRVRLPQTLTVSDTYAL
FT                   GRYGSIVLSNGRLRVPTQVAPPADAAAQAAANALNRIVLDDGSSRRDPATVRYPPPALS
FT                   AANTLRAGTTVRGVEGVLEWRYGAWRLQPVAGAAPVFDAAANPRPAPPARHPDADVRIV
FT                   SFNVFNYFNGDGHGGGFDAPGNRGAKTPAAFARQEAKIVASLRALRADVIGLMEIANNG
FT                   HGDTSAIRRLAAQLGDGWRAVDPGTARLGRDAIAVALLYDSRTVEPVGRAVTVALGGRH
FT                   RPPLAQTFRRIDGTRTFTVAVNHLKSKNCPHASGANLDQSDGQGCWNAARTRAAARVAD
FT                   WLATSPTGIAADGVLLIGDLNSYAKEDPLRTLEARGYANLVVRFVGDAAYSYVFRGEAG
FT                   NLDHALATPALAARVKAVRFWHINADEPVVLQPVPDYKTSAQRSAYYAPDAYRSSDHDP
FT                   VVIDVALDDAATQPAPGTNRAHR"
FT   sig_peptide     complement(673513..673581)
FT                   /locus_tag="Bcen2424_3810"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.478 at
FT                   residue 23"
FT   gene            673851..674204
FT                   /locus_tag="Bcen2424_3811"
FT   CDS_pept        673851..674204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3811"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: bcn:Bcen_4552
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3811"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10548"
FT                   /protein_id="ABK10548.1"
FT                   /translation="MSYMLLIVEPTEQRAERTLDEGQALYARMVDFAESLKARGVLRGV
FT                   ESLERSERGTRVQVRDGETRLLDGPFAEAKEMVGGFFLVDVPTREEAIEIARQCPAAQW
FT                   CTVEVRAVGPCFL"
FT   gene            674330..674749
FT                   /locus_tag="Bcen2424_3812"
FT   CDS_pept        674330..674749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3812"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: bcn:Bcen_4551
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3812"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10549"
FT                   /protein_id="ABK10549.1"
FT                   /translation="MRFMIMIRANAVSESDALPDNRLVEAMTVYHEELAKAGVLLDANG
FT                   LRPSAHGWRVRYTGGKGTVIDGPFAETKELIAGYTLIQVRSRDEALEWTRRFPAPFGAE
FT                   LDCEIEVRPLFELDDLTPSDAVERFRDLHVGRSHA"
FT   gene            674776..675192
FT                   /locus_tag="Bcen2424_3813"
FT   CDS_pept        674776..675192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3813"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bcn:Bcen_4550
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3813"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10550"
FT                   /protein_id="ABK10550.1"
FT                   /translation="MHKMVFINLPVADLPRAKTFYQALGFEVVPAYTNEQAACIQISDT
FT                   IFAMLLVRPFFQTFTDKTIIDPATHIQVLSCLSCDSRAEVDTLVAKALAAGGAAPQAPR
FT                   EYPNMYGHGFTDPDGHTWELMAMPLDASAQGQAS"
FT   gene            675189..676457
FT                   /locus_tag="Bcen2424_3814"
FT   CDS_pept        675189..676457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3814"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: sigma-70 region 2 domain protein; Sigma-70,
FT                   region 4 type 2; KEGG: bcn:Bcen_4549 putative RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3814"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10551"
FT                   /protein_id="ABK10551.1"
FT                   /translation="MTHEATHRAIEAVWRIEAPKIIARAARVVRDVGVAEELAQDTLVA
FT                   ALEHWPVDGVPDNPAAWLMTAVKRRALDRVRQESLHAAKRDQLGHEMDALEAHVVPDIA
FT                   DAIADAGDDDIGDDLLRLIFTSCHPVLSTDARVALTLRLLGGLTTGEIARAFLTPEPTI
FT                   AQRIVRAKRTLAAAHVPFEVPAADARPARLASVLEVIYLVFNEGHAATAGDDWMRPALC
FT                   DEALRLGRVLAGLAPDESEVLGLVALMELQASRMHARVDAQGRPVLLLDQDRSRWDPLL
FT                   IRRGLAALERATKLGGVRGPYALQAALAACHARARQAADTDWAQIVALYDALAEVAPSP
FT                   VVELNRAVAVGMAFGPAAALELVDVLRDDPALARYHWLPSVRGDLLAKLGRADEAKLEF
FT                   RRAAELTRNERERELLLKRAMDA"
FT   gene            676719..677141
FT                   /locus_tag="Bcen2424_3815"
FT   CDS_pept        676719..677141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3815"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: bcn:Bcen_4548
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3815"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10552"
FT                   /protein_id="ABK10552.1"
FT                   /translation="MAQLKGSKTEENLKAAFAGESQANRRYLYFASKADVEGQNDVAAL
FT                   FRSTAEGETGHAHGHLEYLETVGDPATGLPFGSSRLNLESAIAGETHEYTDMYPGMAKT
FT                   ARDEGFDEIANWFETLAKAERSHANRYTKALDSLVD"
FT   gene            677266..678603
FT                   /locus_tag="Bcen2424_3816"
FT   CDS_pept        677266..678603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3816"
FT                   /product="Fe-S oxidoreductase-like protein"
FT                   /note="KEGG: bcn:Bcen_4547 Fe-S oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3816"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10553"
FT                   /protein_id="ABK10553.1"
FT                   /translation="MPHKEGSLEAPTRHPLDWQSEAFYDQAAIDAEMTRVFDICAGCRR
FT                   CVSLCGAFPALFDLVDDTPMGDVEEVPKAAFGKVVDQCYLCDLCYMTKCPYVPPHAWNV
FT                   DFPHLMLRAKAARYKRGEAPLRDKVLSNTDALGHFAGIPVVTQTINAVNRTPPARHALE
FT                   AALGVDRHAWLPEFAPRTFRRAATRSDDPPVRDGERTPGKVAIYATCYVNFNEPGIGHD
FT                   LLAILAHNEIPYELVTREACCGMPLLEQGNLDGVAAKKAINIPVLERYAREGYALIGAI
FT                   PSCVLMYKSELPLMFPGDAAVRAVADAFWDPFEYVIARHRDGLLKTDFKTGLGTVSYHV
FT                   PCHARVQNIGRKTADALSLVPDTRVNVVERCSGHAGTFGVKKAFHADAMRIGAPVFKAM
FT                   AEPRPDVVSSDCALAGHHIAQGIDEKGLPEAPLAHPLTLLRRAYGI"
FT   gene            678633..679214
FT                   /locus_tag="Bcen2424_3817"
FT   CDS_pept        678633..679214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3817"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3817"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10554"
FT                   /protein_id="ABK10554.1"
FT                   /translation="MTLTRDSLLTLEAYAKIRKAEHARLVAYKRRRAVALGNHLRFLFE
FT                   DETTIRYQIHEMLHIEKIFDEAGIEGELEAYLPLVPDGTNLKATMQIEYEHEIERRAAL
FT                   ARLIGVEDRVYLQVDGYASVYAIADEDLERDNAEKTSAVHFVRFEFDAPMRAALKGGAA
FT                   LSIGCDHPAYTMPPQRVDADVAASLAGDLR"
FT   gene            679950..680891
FT                   /locus_tag="Bcen2424_3818"
FT   CDS_pept        679950..680891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3818"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3818"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10555"
FT                   /protein_id="ABK10555.1"
FT                   /translation="MFFDELNDEEWFRLSALIADEPIRLNRRGRPRAEPRVVANAVLWI
FT                   LTTGEAWSKLPGRYPSGPTCRRRYEEWLANGTLLKMIDVLTQFSGRTFAYIPPPPEAVV
FT                   PARRAEPVPDNDRLRGVFWQNPESWQLPVAQANVWEGEGASLSTLSADQVDGRADVSFA
FT                   VPGAPAAELRHVRASAASFAAAEPQVDEYRGYTISGIAQPVQNLMYRAWAEISQDDRRV
FT                   ERSGLIGPRFTDAEAAEQYALEWARQWIDRHGASDAPAREPQGEVLAGLSALARAESDI
FT                   KRFIAERRAGVLSESRNDPVQSERREYAYRVG"
FT   gene            complement(681010..682566)
FT                   /locus_tag="Bcen2424_3819"
FT   CDS_pept        complement(681010..682566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3819"
FT                   /product="mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="5.3.1.8"
FT                   /note="KEGG: bcn:Bcen_4544 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase, type II;
FT                   Nucleotidyl transferase; Cupin 2, conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3819"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10556"
FT                   /protein_id="ABK10556.1"
FT                   /translation="MNAPAVVAETRHSSSAAPAAGTPAAGMPAVGTRLAVQPVILAGGS
FT                   GTRLWPMSRERFPKQLIGLLGDHSLLQSTALRLDGLTADYPLNDDVLIVCGEDHRFTTA
FT                   EQLRLTARNATIMLEPLGRDTAPALTLAALRLVANGNDAVMTVMPADHAVADLPRFHAA
FT                   VAAGVHCAAQGKIATMGIVPKHAETGYGYIRVGAPLGDAGTGTLDVRRLDRFVEKPHLE
FT                   LAQQYVASGEYWWNSGIFIVRASVWLNAIRQLEPAIYAACAQAVAQGKEDGDFFRVDRD
FT                   AFAASPSNSIDYAVMEPLASQPQLCESVVVPLDAGWSDVGSWDAIWQISPKDESGNVGR
FT                   GHVLFEGADSTFAHSESRLVACVGTQNLVVVETPDAVLVADKSRVQDVKKIVGHIKARQ
FT                   GTEATDHRKVHRPWGHYDSVDTGERFQVKRIVVKPGAQLSLQMHHHRAEHWIVVRGTAR
FT                   ITRGDETFLLSENESTYIPLGVSHRLENPGKMPLELIEVQSGAYLGEDDIVRFDDTYGR
FT                   Q"
FT   gene            682935..684371
FT                   /locus_tag="Bcen2424_3820"
FT   CDS_pept        682935..684371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3820"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: bcn:Bcen_4543 sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3820"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10557"
FT                   /protein_id="ABK10557.1"
FT                   /translation="MRHGLHKALFGKRLFKEEETDMLSVLARVIDIAMVVTGALIAAAL
FT                   HGGSIGLSDLQRTTVLFDCLLVVVFFPAFGIYQSWRGKRLVGLMGRVVFAWLAVELAGI
FT                   LMSFSFHQSGDLSRLWLGYWALATTVLLAGSKACVHVVLRQLRRGGYNLKAVAIVGGTP
FT                   AARRLIAQMRARPEAGFNPVCVYDESEAPGEVALDDVRIERQFESLVWLVRSRAISELW
FT                   LTLPITEERRIHQIVTVFRHDFVNIRFIPDVRTLSFFNQEVVEVLGVPAINLAASPITD
FT                   VRILPKFVFDRLFALAALTALAPVMVLIAALIKLTSRGPVFFRQKRKGIDGHEFEIYKF
FT                   RSMKVHQEVAGQVTQATKNDSRVTPVGRFLRRTSLDELPQFINVLKGEMSVVGPRPHAL
FT                   AHDDIYKDLVKGYMFRYRIKPGITGWAQINGYRGETDQIEKMMGRVKLDLYYMQNWSFW
FT                   LDIKIVVLTLWKGFTGSNAY"
FT   gene            684447..685859
FT                   /locus_tag="Bcen2424_3821"
FT   CDS_pept        684447..685859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3821"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   bcn:Bcen_4542 UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3821"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10558"
FT                   /protein_id="ABK10558.1"
FT                   /translation="MNLTIIGSGYVGLVTGACLADIGHDVFCLDVDQAKIDILNNGGVP
FT                   IHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTPPDEDGSADLQYVLAAAR
FT                   NIGRYMTGFKVIVDKSTVPVGTAERVRAAVAEELAKRGGDQMFSVVSNPEFLKEGAAVD
FT                   DFTRPDRIVIGCDDDVPGERARELMKKLYAPFNRNHERTLYMDVRSAEFTKYAANAMLA
FT                   TRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRT
FT                   ADEHGQSLQILKAVSSVNATQKRVLAEKIVARFGEDLSGRTFALWGLAFKPNTDDMREA
FT                   PSRELIAELLSRGARVAAYDPVAQQEARRVIALDLADHPSWLERLSFVDDEAQAARDAD
FT                   ALVIVTEWKAFKSPDFVALGRLWKTPVIFDGRNLYEPETMSEQGIEYHPIGRPGSRQAV
FT                   AARVPGAARASA"
FT   sig_peptide     684447..684509
FT                   /locus_tag="Bcen2424_3821"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.729 at
FT                   residue 21"
FT   gene            685890..686333
FT                   /locus_tag="Bcen2424_3822"
FT   CDS_pept        685890..686333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3822"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bcn:Bcen_4541 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3822"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10559"
FT                   /protein_id="ABK10559.1"
FT                   /translation="MFRNILIVCHANVCRSPAAEMLFKSHAASRGGPRPTFHSAGVHAN
FT                   DGDGIDPVMRRLLAERGVDATTHRSRRLSRRIVRDADLILVSEREQIKAVEAVDPFARG
FT                   KVHLLGKWEGAEIADPHGGPEADYRESYSLIERLVQGWLQKLC"
FT   gene            686342..687505
FT                   /locus_tag="Bcen2424_3823"
FT   CDS_pept        686342..687505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3823"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   bcn:Bcen_4540 polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3823"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10560"
FT                   /protein_id="ABK10560.1"
FT                   /translation="MRPVALAVALTTFLSACATAPGNYLDSSNLKDEGRQEAAETYPVH
FT                   YIDAKVVMDQLQKAQVDHPLPPGRYTDPSQYTYRVGPQDILGVTVWDHPELTTPQGQSF
FT                   SSGGNTTQSVAGALQQPYTTALPGQADPYGQTVAADGTIFFPFVGRIRVAGKTVAQIRD
FT                   EMASSLSRYVKNPQLDVRVLSFRSQKVQVTGEVKQPGPLAVSDVPLTLVDAISRSGGST
FT                   AEADLQRVRLTRDGKLYTLDANGVLDRGEVKQNVMLQPGDIVNVPDRSDSRVFIMGEVK
FT                   TPVTVPMLKGKLTIADALTAGGGILDTDANPRKIYVMRGMRDNPTKPEVYRLDMTQPDA
FT                   LMLSSRFPLQPLDVVYVSTAGSVQFNRVLQQVLPTIQTIFYMRQITR"
FT   sig_peptide     686342..686398
FT                   /locus_tag="Bcen2424_3823"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.820 at
FT                   residue 19"
FT   gene            687556..689781
FT                   /locus_tag="Bcen2424_3824"
FT   CDS_pept        687556..689781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3824"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis; KEGG:
FT                   bcn:Bcen_4539 protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3824"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10561"
FT                   /protein_id="ABK10561.1"
FT                   /translation="MVNTQAKHSYADLTAKTEEEDFVLGQLLQVIMDDIWLLIGIAVTV
FT                   VALAGLYCFIAKPVYQADVHVRVEGNDNTSQALTQTQTGASINSGPQQAPTDAEIEIIK
FT                   SRGVVTPVVEQFKLNFSVAPKTLPVLGSLAARLATPGEPSRPWLGLKSYAWGGEVADVD
FT                   SISVVPALEGKKLTLTAGPNGTYSLVDENGTRLLAGRVDEAAQGGGVTLLVRKLVARPG
FT                   TQFTVVRYNDLDAISGFQAGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQ
FT                   HVVAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQRTSGSINASDEAKVYLEGSVQ
FT                   YEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQ
FT                   LQRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLIDSALRPGAPVKPKKVLILSAAVF
FT                   LGLILGTGVVFLRRNLFQGIEDPDRIERTFNLPLYGLVPQSAEQVKLDAAAEKGGSRAR
FT                   PILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVIVLTGPTPGIGKSFLTVNLAVLLAH
FT                   SGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSPLEEAIRETPVQGLSFIAAGTR
FT                   PPNPSELLMSTRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMH
FT                   TEGEIADAIKRLRTAGVDLEGGIFNGVPPKARGYGRGYAAVHEYLSA"
FT   gene            689844..690803
FT                   /locus_tag="Bcen2424_3825"
FT   CDS_pept        689844..690803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3825"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bcn:Bcen_4538 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3825"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10562"
FT                   /protein_id="ABK10562.1"
FT                   /translation="MKISVLVPTYRRPADLARCLLALQRQQRLPDEVIVVARPEDDATH
FT                   ERLADPAVGGALPLRIVPVDVGGQVAALNKGLDSANGDIVAITDDDAAPRPDWLARIEA
FT                   VFQADPRVGAVGGRDWVHEKGRLLDESRELVGQLTLSGKIIGNHHLGVGGAREVDMLKG
FT                   ANMSYRRAAIERLRFDTRLRGAGAQMHNDMGFSMHVQREGWKLVYDPAIAVDHFPAERF
FT                   DDDRRDAASLNAISNGAHNLHLILREHLSPLRREIAWWWWALVGTRVYPGFAHLLLALP
FT                   TARRARVLAHWRAVRRGARDARRTNLAPHRAAMPPVTS"
FT   gene            690847..691992
FT                   /locus_tag="Bcen2424_3826"
FT   CDS_pept        690847..691992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3826"
FT                   /product="glycosyltransferase-like protein"
FT                   /note="KEGG: bcn:Bcen_4537 glycosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3826"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10563"
FT                   /protein_id="ABK10563.1"
FT                   /translation="MTTKAATQVHVHLFYGADPRTYRKGDDIGCLYGYHHAESDEFRLT
FT                   YSQDVGENRVVSVARRALKAALGFDIVHAWRNRAALLATDVIWTHTEQEHLAAALILKL
FT                   AGAQGKRPLLLAQSVWLFDKWGSFGGPRRWLYRKLLARADALTTLARDNADLCRRYLGR
FT                   EAEFVYYGLNTQDFPPVEPRQWQPNRPLRIAAIGNDRDRDWRTFLAAFGGDERYEVRLA
FT                   TRRRVPREWHAPNVKIGPASGLAKQHELYAWADVIVVPLRPNFHASGITVILEAAAVGK
FT                   PMIVSDVGGLSDYFPHDTAAYVPAFDAQAMRQAADRFVADPAAALDCARAAAACLRERD
FT                   LTTQAFAEQHVRITRDMLRRRRTPAPAGVAMPLADSSASSQ"
FT   gene            692003..693469
FT                   /locus_tag="Bcen2424_3827"
FT   CDS_pept        692003..693469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3827"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3827"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10564"
FT                   /protein_id="ABK10564.1"
FT                   /translation="MSTIAAERAPSRARSWFAEPKHWAGQAGLWALTAALIAIHQGKVL
FT                   TLAFPVLAIGVGIWLYFKSPARYVGFMWWVWFLSPEVRRLADWSKGAFTPTSLIQVAPL
FT                   AVTMIAGLGLVRHYRVLAQRRGIPVLLILFGLVYAYLVGIVSSGVMAATYDLANWLYPI
FT                   LIGFHIMVNARNYPEYRDVLLSTFMWGMLVMGLYGVVQYFVMPQWDVLWMVGSQMGSQG
FT                   EPVPYGVRVFSTMNSSGPFAFAMMGALVFVLVAPQKIRWFAGAAGFVSFALCLVRSTWG
FT                   GWVIALAIQLVQSSNRVRMRILISGVVLVGLCVPLLTVGPVADRLGARLQSITNLKDDR
FT                   SYDDRNKFYATFAQTAFTDVAGEGMGATGASTKLSSDSGELGKYGSFDSGVMNVPFVLG
FT                   WPGTLLYLAGVVMLFGRTLRAAFKLRKDKFVGACLSLCLSTFAMLVFTNSLIGTGGLLM
FT                   FTAIFSILAAAHWQKAQRLLAAARSRGGDH"
FT   gene            693466..694650
FT                   /locus_tag="Bcen2424_3828"
FT   CDS_pept        693466..694650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3828"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bcn:Bcen_4535 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3828"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10565"
FT                   /protein_id="ABK10565.1"
FT                   /translation="MRIAIVTHVVRHNDGQGRVNYEIARAALAENYEVTLVASHVAPEL
FT                   LADPRVRWVPVKVGGFWPSNLVKQQVFALKSAAWLRAHRGEYDVLHVNGFISWIKADVN
FT                   TAHFVHGGWFKSPYYPFGPAKGLWSAYQYVYTRVNTVLERWAYKRSRAITAVSQKVADE
FT                   IAGLGIDSRKISVIYNGVDGSAFAGAQADRAAFKLPDDAFLLLFVGDLRTPRKNLGTVL
FT                   KALTKLPANVHLAVAGYLPGSPYPEEARALGIDSRVHFLGLVKNMPTLMRSVDAYVFPS
FT                   RYEAMSLSLLEAMAAGLPVVTARTAGGAEIITRECGIVLEDPDDPAALAQAIGALAASR
FT                   DTCRAMGDAARELMTRFGWAHMGAQYVALYRRIGQPTQPSAFERVEHAITQEQP"
FT   gene            694650..695816
FT                   /locus_tag="Bcen2424_3829"
FT   CDS_pept        694650..695816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3829"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bcn:Bcen_4534 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3829"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10566"
FT                   /protein_id="ABK10566.1"
FT                   /translation="MSHSSRPIKSLQIGMHWFPERAGGLDRMYYSLVGALPGAGVEVRG
FT                   LVAGSPKVADDTGGAIQGFGPASEPLARRMLAARRALRDEIRSARPDVISSHFALYTFP
FT                   GLDVTRGIPQVSHFQGPWADESQVEGAASLGQRAKRYLEQAVYTRSSRLIVLSQAFGQI
FT                   LTNRYGIDPSRVRVIPGCVDTAQFDTPLTPAEARHKLQLPQDRPIVLAVRRLVRRMGLE
FT                   DLIDAIGIVKRRHPDVLLLIAGKGKIGEELQQRIDEAGLQDNVKLLGFVPDHHLAALYR
FT                   AATVSVVPTVALEGFGLITVESLASGTPVLVTPVGGLPEAVAGLSNDLVLPSTGADAIA
FT                   EGLGGALSGAIALPDAAACKRYARDHFDNAVIARRVAGVYEEAIQAAG"
FT   gene            complement(696138..697373)
FT                   /locus_tag="Bcen2424_3830"
FT   CDS_pept        complement(696138..697373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3830"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4533 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3830"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10567"
FT                   /protein_id="ABK10567.1"
FT                   /translation="MESSCHSGTVASNASTDAIHPAEDGRLSSARVALLAVCCAASVAN
FT                   VYYAQPLLDSIARDFGVSQAAVGGVITATQLGCALALLFVVPLGDLLNRKRLIAVQLVL
FT                   LSAACIGVATAPTRGALLAGMVAIGLLGTAMTQGLIACSAALAGAGERGRVVGAAQGGV
FT                   VVGLLAARSLAGVVTDIAGWRAVYLVSGALAIAMLVVLSRLLPDMREPRTRIGYAALLR
FT                   SMVSLLRDERVLRVRGAIALLMFAAFSIFWSALVLPLSAPPHAMSHTQIGAFGLVGALG
FT                   AAAAARAGRLADRGRGEATTGAALALLACAWLPLAFGNTSIAWLVVGIVLLDVGGQAVH
FT                   VVNQSMILGARPDAHARLVGCYMLFYSAGSGLGAIAATMMYARAGWTGVCVLGAGVSVA
FT                   ALGVWVATLRRA"
FT   gene            697478..697996
FT                   /locus_tag="Bcen2424_3831"
FT   CDS_pept        697478..697996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3831"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type; KEGG:
FT                   bcn:Bcen_4532 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3831"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10568"
FT                   /protein_id="ABK10568.1"
FT                   /translation="MAGMPAKAAGTIAERKMARQKSLADSPCPVARATDIVGDRWALLI
FT                   VRDAFDGVRRFGDFRASLGVASNILSDRLKMLVDAGVFDVVPASDGTAYQEYVLTKKGE
FT                   GLFPVIVMLRQWGEANLFARGERHSVLVDRGTGRAIRKLALRHDDGRPVKAADTVVRKV
FT                   DDEASATRR"
FT   gene            complement(697956..698216)
FT                   /locus_tag="Bcen2424_3832"
FT   CDS_pept        complement(697956..698216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3832"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10569"
FT                   /protein_id="ABK10569.1"
FT                   /translation="MRSCVAGVGLDQVTPWKDVTPEVAHVPTAARLNHHELQARMRPVQ
FT                   RVGCIGIETGISQIQRGSCWPVGPSRLMLIAVSRSPRRRPS"
FT   gene            complement(698221..699687)
FT                   /locus_tag="Bcen2424_3833"
FT   CDS_pept        complement(698221..699687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3833"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4530 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3833"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10570"
FT                   /protein_id="ABK10570.1"
FT                   /translation="MSVAAYDGRMDTTTPSPAFPPALARIVATVSIGFVVTQLDVTIVN
FT                   IALAHLAADLHLPVAGLQWVVDAYTLAFAVLMLSAGALGDRFGTRRLYVAGLLLFAFAS
FT                   LACGAAVAPAMLIAARALQGVGAAAMLPNSLALLNDACRHDPRLRARAVSGWTAAGSIA
FT                   IAAGPVVGGLLIAAWGWRGIFLVNLPLCAAGLAATFAWVPARREQAAPARSTRSLDPRG
FT                   QFIAIAMLTVLTGAVIEWRPLGFTHPVVASGFVLAALAALAFVAVESRTATPMLPLSLF
FT                   RHPAFSTAVLFGICVNLTYYGTVFVLALYLQRARGESALQAGLAFLPLTGGFLLSNLAS
FT                   GRVVARHGPRVPMVAGALVAALGYGSLHFVDAATPLGVLLVPFLLIPSGMGFAVPAMTT
FT                   AVLASVAPERAGIASAVLNTARQAGGAIGVAAFGALAGGGGAAQVVSGLRIETVVSVAL
FT                   LVAAALLATRVRTDADRGAPRSRQTLSAHD"
FT   gene            699802..700245
FT                   /locus_tag="Bcen2424_3834"
FT   CDS_pept        699802..700245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3834"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_4529 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3834"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10571"
FT                   /protein_id="ABK10571.1"
FT                   /translation="MTPSNLTTRDAQIADHADIARLMHQLGYDATPEMIRDKLATLLPS
FT                   AVDRILVATIAHRVVGCISLHALALFHAHGNLGRITSLVVDESCRGQGVGGALIAAAHS
FT                   WFESVGCVKLEVTSGDHRLDAHRFYARYGFMRDGQRLSKRVRP"
FT   gene            complement(700305..701078)
FT                   /locus_tag="Bcen2424_3835"
FT   CDS_pept        complement(700305..701078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3835"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_4528 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3835"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10572"
FT                   /protein_id="ABK10572.1"
FT                   /translation="MERIASPAIALRRYDTCEASDVHDFHQVVLGVDGAMVMAVDGIGR
FT                   RIDRHAAWLIPAGARHDYAGLGDNRQLVIDLPAASLAVPQRLFDHARAVSIDPALTSLV
FT                   AQVAAAAAQHDAPDGDARQAAAHRFQWQAAARLCDALLDDAGIAAPASGLDFARIDRWL
FT                   RARLADPLRIADLAAHCGYGMRRFHQLFVDAFGETPHRYLQRLRLDAAVVLLADGRHAL
FT                   VDIAGSVGFADQSTFTHAFTKRFGVAPGRWRGERH"
FT   gene            complement(701104..701445)
FT                   /locus_tag="Bcen2424_3836"
FT   CDS_pept        complement(701104..701445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3836"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   bcn:Bcen_4527 peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3836"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10573"
FT                   /protein_id="ABK10573.1"
FT                   /translation="MSVITTESGLKYEDLTEGTGAEAQAGKTVSVHYTGWLTDGQKFDS
FT                   SKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGPRGAGGVIPPNATL
FT                   VFEVELLDV"
FT   gene            702025..702942
FT                   /locus_tag="Bcen2424_3837"
FT   CDS_pept        702025..702942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3837"
FT                   /product="metal-dependent hydrolase-like protein"
FT                   /note="KEGG: bcn:Bcen_4526 metal-dependent hydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3837"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10574"
FT                   /protein_id="ABK10574.1"
FT                   /translation="MKSAASATAAGIMPVRRDLRFDLPVERAKDWHGLGSHVTHFFNAL
FT                   SLLFPAGERFFMDSVRNYRDRIDDPVLKQQVLGFIGQEAMHTREHIEYNELMQANRLPA
FT                   RKLDQRVWTVLGYMKRKLPHSVQLAHTVAAEHYTAMLADWLLRDPTRLDGSVEGYRQMW
FT                   IWHALEETEHKAVSFDVWNAAMKPGLRRYLIRIGVYLLTTLTFWPTVFLMHATLLWRDR
FT                   GAGHHVRGMLRMIAFLYGPRRGLFPRIAGEWLSFFRPGFHPWDHDNHHHLARVDALAAT
FT                   YGEHGGTPAGRGRANAPAPLASGR"
FT   gene            702985..703446
FT                   /locus_tag="Bcen2424_3838"
FT   CDS_pept        702985..703446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3838"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3838"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10575"
FT                   /protein_id="ABK10575.1"
FT                   /translation="MLRACISPLLPTIDENQPEPVARAPACPADRLRAHAPPPLVMRAP
FT                   RRSPSPCASTGAALRARRRSSPVAHGARHRDNTHLAAGLPHRYTVHGNVDLRRDSCEGG
FT                   FYSDGNTANMSVRSCPSYAAASRRAIPTPSGEQRWLQGHPTQTGRRRPR"
FT   gene            703452..704888
FT                   /locus_tag="Bcen2424_3839"
FT   CDS_pept        703452..704888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3839"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_4525 sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3839"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10576"
FT                   /protein_id="ABK10576.1"
FT                   /translation="MSVTAPEAGRKLFVIMRTPDEPLLAQLRGLGWEITVAKTAGAAQN
FT                   MTCGVSVAAGLVDFTGFTSRDYPALKMCLSQPAIGWISIAQAGITIGPAVRELIRSYCF
FT                   DYVTLPLPYEWISHVLGHARGMAALDRVDGAAYAASIGEHGMIGNCEAMQQLFSTIRKV
FT                   AKTDASVFISGESGTGKELTALAIHERSGRGKGPFVAINCGAIPHHLLQSELFGYERGA
FT                   FTGANQRRAGRIESANGGTLFLDEIGDMPVESQASLLRFLQEGKIERLGGQESIVVDVR
FT                   IISATHVDLDGAVEAGRFRADLYHRLCVLRIHEPPLRARGKDIDILAHYVLQKFKADSG
FT                   RKISGFTSAALDAMRRYEWPGNVRELINRVRRAIVMAESRLLTPHDLGLDTPGETEPVT
FT                   LEQARALAERTAIENALLRNDHRINKAAAELGISRVTLYRMMIEHGLNDHDNNGGNGGN
FT                   GDSGGHDGAPSGDAGHQRVG"
FT   gene            complement(704926..705312)
FT                   /locus_tag="Bcen2424_3840"
FT   CDS_pept        complement(704926..705312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3840"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bcn:Bcen_4524
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3840"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10577"
FT                   /protein_id="ABK10577.1"
FT                   /translation="MIRTFHAAERARLIRFGVSGVGSTALHALIAAAMFALFDATPVIA
FT                   NATAFVCSTAFSYLANTLWSFSSPVTWGNFVRFLAVAMAGLAVTMLLAHGTDALGLARA
FT                   WSIVAVVLCVPPVTFVLHRLWTYR"
FT   gene            complement(705898..706278)
FT                   /locus_tag="Bcen2424_3841"
FT   CDS_pept        complement(705898..706278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3841"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3841"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10578"
FT                   /protein_id="ABK10578.1"
FT                   /translation="MRRPQRAARRFASSFGLHIDPSRQRHATRTDVVRIDSIGENRAAR
FT                   HGRPCAHAHADRVRVQESADPARMTGNQPDPPRTGRGEMACRGMPVRCKRDARTAMSRI
FT                   TAIAACGPRRVMIDHFSTPFAV"
FT   gene            complement(706397..707179)
FT                   /locus_tag="Bcen2424_3842"
FT   CDS_pept        complement(706397..707179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3842"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TIGRFAM: cationic amino acid ABC transporter,
FT                   periplasmic binding protein; PFAM: extracellular
FT                   solute-binding protein, family 3; KEGG: bcn:Bcen_4522
FT                   lysine-arginine-ornithine-binding periplasmic protein; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3842"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10579"
FT                   /protein_id="ABK10579.1"
FT                   /translation="MKRLIAAVSIALLAVSAGPAVAKDWTTIRFGTDASYAPFESKAPD
FT                   GKLVGFDIDLGNEICARLKAKCVWLENDFDGMIPALKAKKFDAVLSSMSITPQRAQQIG
FT                   FTTKIYNQPTRLVVKKGSSLLPTAASLKGKSIGVEQGTTQETYAKAYWGKQGANVVSYQ
FT                   NQDGVYADLIAGRLDAALQDEVQAAIGFLKSPRGANYTFVGPELVDEKVLGIGAGIGLR
FT                   QEDTDLKAKIDRAIHDMVKDGTYKRLASKYFDFDIYGG"
FT   sig_peptide     complement(707111..707179)
FT                   /locus_tag="Bcen2424_3842"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            707414..707833
FT                   /locus_tag="Bcen2424_3843"
FT   CDS_pept        707414..707833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3843"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3843"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10580"
FT                   /protein_id="ABK10580.1"
FT                   /translation="MSQPAYESHSALPHASVAQMSAAGLRAFFNIARDWELTIDEQIVL
FT                   LGSPGRSTFFKWKAAPESARLPRDTLERLSLLLGIYKGLQILLPQPAAADAWVKRPNDA
FT                   APFGGKRALDRMLAGNVGDLVAVRQYLDAMRGGWA"
FT   gene            707830..708531
FT                   /locus_tag="Bcen2424_3844"
FT   CDS_pept        707830..708531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3844"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3844"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10581"
FT                   /protein_id="ABK10581.1"
FT                   /translation="MTTPIEVTRWPTTTVDWAPAYRVIPTRFPAINLFDRVASADDFDA
FT                   LYALESLTNDRIRNEVGTLELVPPAERRYGQGWGPIMAAFTHLNPLGSRFSDGSYGVFY
FT                   CTRSRDTAIAETRYHSGLFLAATKEPPMRQQMRLYTVLAHGDVADVRTWPQRDPALLDP
FT                   VDYSAGQAFGRAVRQAGGAGIVYPSVRDPRGECLAAFRTTLLRDCQHAAYLEYNWNGSA
FT                   VDAVFELNQVG"
FT   gene            complement(708592..709323)
FT                   /locus_tag="Bcen2424_3845"
FT   CDS_pept        complement(708592..709323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3845"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bcn:Bcen_4519
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3845"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10582"
FT                   /protein_id="ABK10582.1"
FT                   /translation="MTATALLCRHPANPAGRDFVVGDLHGCVDVLRALLHDVRFDPARD
FT                   RLFSVGDLVDRGPASETALDLLDRPWCHVVRGNHEEVLSLVARGKLPPDAWRGIGGDWG
FT                   ADLPPERLHAHAARVDALPLVRVIGDGPARFNVLHAEFFGSDAELDTGSYPHDVRERLI
FT                   WGRDLIQGLADPARQAGLSLTCTGHTPVREPQRIGAQWFIDTGAFAPAGRLTLAEPRTG
FT                   RTWSMTQAEARERHAGDWPLP"
FT   gene            709457..710110
FT                   /locus_tag="Bcen2424_3846"
FT   CDS_pept        709457..710110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3846"
FT                   /product="protein of unknown function DUF1345"
FT                   /note="PFAM: protein of unknown function DUF1345; KEGG:
FT                   bcn:Bcen_4518 protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3846"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10583"
FT                   /protein_id="ABK10583.1"
FT                   /translation="MTLYPQVLRNRPRMVAAFVAGVLCAVLLPFPLRPTARALIGWDCA
FT                   VWLYLVLMWVRMVTAHHHKVREVAVREDENATTVLTVVCLATVASVAAIAIELATAKSV
FT                   GFSAGLSHYAITGATLFGAWFLIPTIFTLHYARLYYGSPSNDRALRFPDRNPEPDYWDF
FT                   LYFAFTLAVASQTADVSLANRSARRSVLAQSILSFYFNMAVLGLSINVAAGLLS"
FT   sig_peptide     709457..709573
FT                   /locus_tag="Bcen2424_3846"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.638 at
FT                   residue 39"
FT   gene            complement(710117..710818)
FT                   /locus_tag="Bcen2424_3847"
FT   CDS_pept        complement(710117..710818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3847"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: bcn:Bcen_4517 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3847"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10584"
FT                   /protein_id="ABK10584.1"
FT                   /translation="MMAFPPPSGLDMLTVHHLNNSRSQRVLWLLEELDVPYEIVRYERD
FT                   PKTMLAPAELRAIHPLGKSPVVTDDGRTFAESGAIIEYLVERYGNGRLAPPPGSPERHD
FT                   YTYWLHYAEGSAMPPLLLKLVALRIAHAPMPFFARPIARKIAATLQSGFVDPQIDLHLG
FT                   HVDGALARSGWFVGDGFSAADIQMSFPLEAATARGGGSRYPAIARFLDTIHARPAYQRA
FT                   LERGGRYDLLK"
FT   gene            complement(710883..711590)
FT                   /locus_tag="Bcen2424_3848"
FT   CDS_pept        complement(710883..711590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3848"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bcn:Bcen_4516 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3848"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10585"
FT                   /protein_id="ABK10585.1"
FT                   /translation="MSLPASAAKFDPSRAHEYAEQSRIALAGYDACHELAACMLASAIG
FT                   ATDARILVAGAGGTGQEICVAAALEPGWQFTAVDPSAPMLALARSNVEAAGFGARTAFV
FT                   EDGVDALPDAPAFDGATLIGVLHHVPGDDAKAALLHAIARRLKPGAPLVLAGNHRRYAD
FT                   HPRLLDAWQQRWRMKGATSDAVRAQLAKILQGADPPASEEAVFALLRDAGFDAPLRFFA
FT                   SLFWGAWIAVRRA"
FT   gene            711906..713558
FT                   /locus_tag="Bcen2424_3849"
FT   CDS_pept        711906..713558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3849"
FT                   /product="maltooligosyl trehalose hydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /note="PFAM: glycoside hydrolase, family 13 domain protein;
FT                   KEGG: bcn:Bcen_4515 glycoside hydrolase, family 13-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3849"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10586"
FT                   /protein_id="ABK10586.1"
FT                   /translation="MSDCPHDPYAQHYIHCLPFGAQPCGALSTTPRTHFRVWAPGSTHV
FT                   QLELNTGYGPMLVPMTSAGPNWFEVFVDCGAGARYRYRLDDTVSIPDPASRSQPEGLNG
FT                   PSEVVDPRAFTWRNTFWHGRAWEDVALYAIRPHAVGGFDAVRRRLPQLARLGVTALELL
FT                   ASPHDSLPFAPLAAEGGPDELKALIDAAHGYGLAVLLELDYARFGSGTDALRHYAGPFF
FT                   HTRDDPLQAAPLALDHPEVCDFFCDNALYWIDEYRCDGLRLREADRIGVSWLREIADRV
FT                   RAAVPADRLIHLVLGSERHPAHLADTHFDAQWNGCGERALHRLTGRDPSAHEGISAHQS
FT                   IHTLARALTAAGAAYQPAASSDGMGADGGLSLTSLVLSDGAWRDGGPGDPGQAAGLAAL
FT                   ALSLLTPQIPLIFDETARDIDRAHFVQSALAVRAKLIAPRLSDCRPQAAHALKADGDGD
FT                   ADALCASWRLADDETLTIALNLSPDAVPFDAPGGRVVFETPARARDRVDEGELPPYSLV
FT                   AWLTGDVNRYALTHDVRRLDDGSWRGMRPNLNA"
FT   gene            complement(713631..714215)
FT                   /locus_tag="Bcen2424_3850"
FT   CDS_pept        complement(713631..714215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3850"
FT                   /product="thiamine monophosphate synthase"
FT                   /note="PFAM: thiamine monophosphate synthase; KEGG:
FT                   bcn:Bcen_4514 thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3850"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10587"
FT                   /protein_id="ABK10587.1"
FT                   /translation="MNAPLPRCCVITPEPASASAADRAAFLDRLSAVLARGETLVQLRV
FT                   KSLDAAAFASLAAAALARCAAAGAHLMLNGPIDAAGVMRLDGAGWHLDGTALRAAAQRP
FT                   LPAARWVSAACHTQDDLLLAARAGADFVTLSPVLPTLSHPGAPALGWARFDALAAQAAM
FT                   PVFALGGMTRAHLDDARRHGAYGIAGIRGFW"
FT   gene            complement(714238..715581)
FT                   /locus_tag="Bcen2424_3851"
FT   CDS_pept        complement(714238..715581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3851"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: bcn:Bcen_4513 protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3851"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10588"
FT                   /protein_id="ABK10588.1"
FT                   /translation="MLQIFALIGALFLVALNGFFVAAEFGLVKLRATRVKTLARKHGLR
FT                   GRILGIVHGRLDAYLSACQLGITLASLGLGWVGEPAFAQLLGPLLDLIGVHSERVVHLI
FT                   SLVFAFSLISFLHIVVGELAPKSMAIRQPEKVGLWVALPLYAFYWAMYPAIWVLNTSAN
FT                   AVLRLAGLSADHGGDAHYSTDELKLILRSRRSAAGNAAQPARGTYTNDEWNTLAHSLDF
FT                   SSMTVSDLMRPAHEMIGLRRDLPLPDNMEIVARHRFSRYPLFEDASREQVSGLIHLKDL
FT                   LLARHAGAALEDLSDYVRPVQYVKPDTPALELFRRFRKGAPHFALVGNKGEKPIGFLTL
FT                   DNLLGALVGQIHDEFRQGDADWSRLDDGTLMGKGSLPVVSLEQALGIDIDEGRAESVGG
FT                   LVIQALSDLPTEGQRVSFDRFDVVVKKMNGPRIVLVRVYPKIVKEADE"
FT   sig_peptide     complement(715510..715581)
FT                   /locus_tag="Bcen2424_3851"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.918 at
FT                   residue 24"
FT   gene            complement(715658..716437)
FT                   /locus_tag="Bcen2424_3852"
FT   CDS_pept        complement(715658..716437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3852"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: histidine kinase A domain protein domain
FT                   protein; KEGG: bcn:Bcen_4512 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3852"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10589"
FT                   /protein_id="ABK10589.1"
FT                   /translation="MTSTSVDPAADLLRERAAHYAAQAALFLRDQALSTASHDLRSPLN
FT                   AMHSWAYVLERQLANADPNLQRALAGIRTGIDQQVALIDGVLDAPRAETRTLVLAPQPF
FT                   ALRALLDETIALVRFALADARQVALDTTLPDGEPSLTVDRERVAQALWTLLTTAVEASA
FT                   AGSRVAFACTRDGAQFTARATCTVNAGVLVDPTQPHAFESFARREMLHERDAKRSAWTL
FT                   ALCQRVALAHGGTFAHDVFADGAAATLTFSIPCEAPV"
FT   gene            complement(716505..717434)
FT                   /locus_tag="Bcen2424_3853"
FT   CDS_pept        complement(716505..717434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3853"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bcn:Bcen_4511 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3853"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10590"
FT                   /protein_id="ABK10590.1"
FT                   /translation="MPMKPDARKHLRANLLMLGAAAIWGSAFVAQRLSLDVIGPFLFTG
FT                   LRFLLGALVLVPLLMVNAASRAQLAAIRREPALLLPGLALGGLLAVSISLQQVGLQYTR
FT                   IANAGFISSLYVVIVPLMGALARHRIGAGTWFGALLAAIGLYFLSIDEHFSVLYGDWFQ
FT                   LAGAVIIAAHVMAVGHLAKRHDPLVLAFLQFAVCGVACLAVGLAVEPVSAAMLRGALPT
FT                   LLYGGLLSVGVGYTLQVVAQRDAAPAHAAVIFSMEGVFAAIAGWAALGETLTLRALVGC
FT                   ALMLAGLLACQLLPNGDARKKDEDALPA"
FT   sig_peptide     complement(717345..717434)
FT                   /locus_tag="Bcen2424_3853"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.928 at
FT                   residue 30"
FT   gene            complement(717469..718326)
FT                   /locus_tag="Bcen2424_3854"
FT   CDS_pept        complement(717469..718326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3854"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_4510 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3854"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10591"
FT                   /protein_id="ABK10591.1"
FT                   /translation="MKVLDLDAVRAFVLVADLASFTRAADALGTTQSAVSLKLKRLEAH
FT                   LGKPLLARTPRVVKLAADGENFLPAARALLDAHERALGAISTGTVRLSLGVSEHVAVPD
FT                   LPAVLTSLHRQDPGLSLEMHLGASTSLLPQYDERRFDAVIARHEPGEDPPRDDATPLFT
FT                   EPLAWLAAPDWAPRAGEPLPLAVLAGPCGVRAAALRALDRAGLPWRERFTGGGVAAVTA
FT                   AAAAGLAVCPLARRVAPRTLVDVGAKFGLPPLPQSQVVLYSRVRDARAAAALRRFADSL
FT                   AISA"
FT   gene            718440..718823
FT                   /locus_tag="Bcen2424_3855"
FT   CDS_pept        718440..718823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3855"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bcn:Bcen_4509 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3855"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10592"
FT                   /protein_id="ABK10592.1"
FT                   /translation="MPFTRIALREGKPAAYRRALVDGVQRALIQTFNVPEDDIFMVVTE
FT                   HTAENFVFGRHYLDIERSDDLVIIQITANNTRTLEQKRSLYRAIADNLAQQPGVRQEDV
FT                   FIGLVEVLKENWSFGNGIAQYAV"
FT   gene            718963..720585
FT                   /locus_tag="Bcen2424_3856"
FT   CDS_pept        718963..720585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3856"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   bcn:Bcen_4508 CHAD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3856"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10593"
FT                   /protein_id="ABK10593.1"
FT                   /translation="MSRVLEIVLSLSLEGWPVKGASRARGAQRDFGAELVRAWRICPQV
FT                   RMRRGHERVTVEPCQIEEAERSPGASWWTWVESNAHGTRVVASRTRTFAPGVTQRELFD
FT                   AEHAGIVVATPLPVPATAGAADTDAPPAAETDGVAPDTDEARAQASALRLVSERRRGRW
FT                   ADDSGVVVEMTLDDITLHGGGEPPRRHVELRLAAPDWETVAARTAALHALFAAARELSG
FT                   AWPAFVQLTSVIDRACAGGPVAATLVKAQPVDLTGIRTQRAALFALSGDITAQWLGNEC
FT                   GVLDRDDPEFVHQMRVALRRLRTLMRFFPRFTDRQWRDTLGVDLRWLAKLLGTVRDWDV
FT                   FATESLPALIAADGGSSDWDGTLDAARAQSMAARVELRQALHSARYARLTLGWLEWLSA
FT                   LALPAADGDDAPSLRRHATKRVRRLFGHLYGSPSLTSLDTAARHQVRIDAKRLRYALEF
FT                   FASLASRRTRTETVKTLARVQSVLGEANDAMVALRHLEQLAAPPYQLGFVRGYGAALEQ
FT                   RAARDAETLLASLRPPKLDGKPG"
FT   gene            720630..721475
FT                   /locus_tag="Bcen2424_3857"
FT   CDS_pept        720630..721475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3857"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="TIGRFAM: Molybdenum-pterin binding; PFAM: regulatory
FT                   protein, LysR; TOBE domain protein; KEGG: bcn:Bcen_4507
FT                   transcriptional regulator, ModE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3857"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10594"
FT                   /protein_id="ABK10594.1"
FT                   /translation="MPMMTDVPPSSSSAGPLELGGELWLRAGEQTLGGATRIALLAAIG
FT                   DTGSITRAAKAVGLSYKAAWDAVDTMNNLAGEPLVARSTGGKGGGGTTLTPRATSLIAA
FT                   FRTIEREHRRFIEAASAAVAGFDVDWALIGRIGMKTSARNQLFGKVASLVRGTVNDEVT
FT                   LALPGGQAVVAVLTHESAEALGLREGAHACALVKASWVVLAVDDGGPDLKVSARNRLHG
FT                   SVEAVAAGAVNSEVTLALDGGGTLTAVVTNDSVDALQLAAGRRAIALFKASSVILAVTG
FT                   "
FT   gene            complement(721636..722337)
FT                   /locus_tag="Bcen2424_3858"
FT   CDS_pept        complement(721636..722337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3858"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_4506 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3858"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10595"
FT                   /protein_id="ABK10595.1"
FT                   /translation="MSLVVDIRKTYASAERRFTLDMSFTATTQRVVLFGPSGAGKSMTL
FT                   QAIAGLLTPDAGTITLNGEPLFDAARRIDVPTRERRVAYLFQDYALFPHLNVRQNIAFG
FT                   LTSGLRNPRAKTVPPEVAYWLRAFDLESLAGQYPSQLSGGQKQRVALARALVAQPRILL
FT                   LDEPFAALDGAMRQRMRHELAELQARLDIPMVLISHDPDDVAAFGDQVVQLSEGRVQAS
FT                   PPHAEWPTRVT"
FT   gene            complement(722402..723079)
FT                   /locus_tag="Bcen2424_3859"
FT   CDS_pept        complement(722402..723079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3859"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_4505 molybdate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3859"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10596"
FT                   /protein_id="ABK10596.1"
FT                   /translation="MQDAWVPLLLSLKVAGWATALDIVLGVAAAFVLARWRSPLRDVVD
FT                   SVLTLPLVLPPTVLGYYLLVLLGRRGVFGAWLDKFGIELVFTWQGAVIASMVVAFPLIL
FT                   KSARAAFEGVDPHLERAARTLGLGEAAVFFRVTLPLATRGILAGALLAFARALGEFGAT
FT                   LMIAGNLPGRTQTLSVAIYAAVQAGDDNTANFLVLVTSITCVLVLLATGWLVPSRARRN
FT                   QLT"
FT   gene            complement(723090..723959)
FT                   /locus_tag="Bcen2424_3860"
FT   CDS_pept        complement(723090..723959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3860"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: bcn:Bcen_4504
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3860"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10597"
FT                   /protein_id="ABK10597.1"
FT                   /translation="MRSMPSVITRPILRLRFPPVQNESTMRSTVRPLRRTLLRLLPIVT
FT                   LAAGFTFSAPASAADELVVSAAASLTNAFKAVGDAYEKQHPDTKVLFNFGASDVLMQQI
FT                   AKGAPADVFASADQKAMDRAVNEKVIVPGTRRDFAANSLVLIVPADSRAAAPTSLNDLT
FT                   APGVKRIAYGDPASVPVGRYTEGALRAAGVWDAVSAKGVLAANVRQSLDYVARGEVDAG
FT                   FVFGTDAAIMPGRVKVALTVPTQTVITYPIAVVKDSRHAAQAQSFIDFVASPQGQAVLS
FT                   TFGFKPAK"
FT   sig_peptide     complement(723783..723959)
FT                   /locus_tag="Bcen2424_3860"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 59"
FT   gene            complement(724013..724711)
FT                   /locus_tag="Bcen2424_3861"
FT   CDS_pept        complement(724013..724711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3861"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   bcn:Bcen_4503 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3861"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10598"
FT                   /protein_id="ABK10598.1"
FT                   /translation="MFDLPSHLWIMITAFGGAGLTLPLAITIAVWLALGYSWRRAAAWL
FT                   GVLAAAIGVVALTKIAFLGWGIGIRAWDFTGFSGHAMLSTSVYPVAIFLALIRTRTPVR
FT                   IAGIALGLATGVAVGVSRVALDAHSPSESITGCIVGAIAALAFIAGSWRAVPHRWSVPA
FT                   VVASLALVTVALHGLTVPSHRWVTKVALELSGHERPFVRARWKANPNYHPASQPSSLQR
FT                   TESAPPTLHA"
FT   gene            724970..726067
FT                   /locus_tag="Bcen2424_3862"
FT   CDS_pept        724970..726067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3862"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family; KEGG:
FT                   bcn:Bcen_4502 esterase, PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3862"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10599"
FT                   /protein_id="ABK10599.1"
FT                   /translation="MTKSLTKVWLGGMKRMLSPTAKRAARDAQRITRDALEAAASDLSP
FT                   PRESRVRPRAAAWAAGEWTRGEHPMTPALGRLVQNLAYGLYIPPGRRRGAMPLVVMLHG
FT                   CQQSVDEFAQGTRMNLLADKHGFAVLYPEQSLRAHTHGCWHWYEDTDRAGRGEADTVAS
FT                   LVDALVDEHGFDASRVYVAGLSAGAGLASLLALHHPDRFAAVALHSGPALGEANSGITA
FT                   MDVMRRGLRQNPAVAVDALVDAGAYPGMPALIVQGDGDHVVAPKNADQLTVQFMRLNGL
FT                   ADSRGALRGGERVETRETGAQITDVCRDGEPVVRLCHVKGLDHAWAGGDEAVPFHAAVG
FT                   PDASAMIWAFFETHRRTVATERRIV"
FT   gene            726148..726324
FT                   /locus_tag="Bcen2424_3863"
FT   CDS_pept        726148..726324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3863"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3863"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10600"
FT                   /protein_id="ABK10600.1"
FT                   /translation="MYLLSHLFLMLTKNADKAAKERADAYLAEATDIYDLEFRMRKIDR
FT                   DAAMNRPYSIGAR"
FT   gene            complement(726440..726859)
FT                   /locus_tag="Bcen2424_3864"
FT   CDS_pept        complement(726440..726859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3864"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcn:Bcen_4500
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3864"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10601"
FT                   /protein_id="ABK10601.1"
FT                   /translation="MNILYKTSATSTGGRDGRAVSADNKLEVKLAAPRELGGTGAEGTN
FT                   PEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVTAEVGIGPNDAGGFGLDIELRVSLP
FT                   GLDKNDAQVLVDKAHHVCPYSNATRNNVPVRLTVV"
FT   gene            complement(727016..727468)
FT                   /locus_tag="Bcen2424_3865"
FT   CDS_pept        complement(727016..727468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3865"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: bcn:Bcen_4499
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3865"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10602"
FT                   /protein_id="ABK10602.1"
FT                   /translation="MDRLPPLPQTLDEQLCFALYSTSHAMTKAYKPLLDKLSLTYPQYL
FT                   AMLVLWERDDMAVKDIAARLDLDPATVTPLLKRLEALGYVERVRSAADERVVNVRVTPE
FT                   GRALKDRARSVPADLFCAMQQTPEFLIRLRADLQQLRDALSVANER"
FT   gene            complement(727657..728466)
FT                   /locus_tag="Bcen2424_3866"
FT   CDS_pept        complement(727657..728466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3866"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3866"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10603"
FT                   /protein_id="ABK10603.1"
FT                   /translation="MQLIEVPAKTGYVWFRQGIWLFRRNPLAFITLFFTYLLAITLVSM
FT                   VPVIGSALPLVFIPGIAVGFMAACRDTVAGKTVMPTILVDGFRSYGTVATQRLLVLGVI
FT                   YVASMVLVFAASSFVDGGALFHVMMGAADEANTTPETLAAQGTLGALFFATLLYLPVAM
FT                   LFWFAPVLVAWHDVPPAKALFFSVVSCWRNRGAFAVYGVLWFAVALGTSLALSLLLQAL
FT                   GAGAYALTIMMPVTIIIVTMLYCSFYATYRGCFGVQEPGATTTMSGR"
FT   gene            complement(728457..729455)
FT                   /locus_tag="Bcen2424_3867"
FT   CDS_pept        complement(728457..729455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3867"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="KEGG: bcn:Bcen_4497 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3867"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10604"
FT                   /db_xref="GOA:A0AYX8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AYX8"
FT                   /protein_id="ABK10604.1"
FT                   /translation="MAVFTAVSDSDLAQWMRHYELGDVLAFRGIPSGIENSNFFLTTTR
FT                   GEYVLTIFEKLTAQQLPFYLDLMRHLAAHGVPVPDPIPRDDGALFGELHGKPAAIVTKL
FT                   DGAAELAPGVEHCIEVGQMLARLHLAGRDYPRNQPNLRSLPWWQENVPAIVPFITDAQR
FT                   ALLEGELAHQAGFFASDDYAALPAGPCHCDLFRDNVLFAHAAPGTGHDVRLGGFFDFYF
FT                   AGCDKWLFDVAVTVNDWCVDLATGVLDVARADALLRAYQTVRPFTAEERRHWSDMLRAG
FT                   AYRFWVSRLYDFYLPRAAEMLKPHDPGHFERILRERIAHTPALPEIQTACN"
FT   gene            complement(729555..729950)
FT                   /locus_tag="Bcen2424_3868"
FT   CDS_pept        complement(729555..729950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3868"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3868"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10605"
FT                   /protein_id="ABK10605.1"
FT                   /translation="MKPLIFVAAAVAFAAASVAHAAGGTPDADAQARAEANEAAGLPDL
FT                   RKINRPGAEVTSKVDFADIRRTPSFHEKSKNGTEVTEYRDRGKPVEIDVKSNFGTRYQM
FT                   SSTPDTSPKPHDAGIPITRLPSLNLRY"
FT   sig_peptide     complement(729885..729950)
FT                   /locus_tag="Bcen2424_3868"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            730080..731606
FT                   /locus_tag="Bcen2424_3869"
FT   CDS_pept        730080..731606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3869"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="KEGG: bcn:Bcen_4496 AMP nucleosidase; TIGRFAM: AMP
FT                   nucleosidase; PFAM: purine and other phosphorylases, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3869"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10606"
FT                   /protein_id="ABK10606.1"
FT                   /translation="MKNDLSRRHRVLSPESPSVEAFDDPIAAVARLSAIYDTNTGFLRD
FT                   AFARYRRHEAITEHVRACYPFVRIRTDVNTHVDSRRSYGFVAGPGVFETTVTRPDLFAN
FT                   YYREQLRLLAKNHHVKIEIGVSSQPIPIHFAFPEGIHLEGELDRDRLLAMRDIFDTPDL
FT                   SYLDDRIVNGTFEPAPGEPHPLALFTAARVDFSLHRLRHYTATSPTHFQNYVLYTNYQF
FT                   YIDEFVKLGRTMMTESDDPEVRAYRSEYSAFVEPGDVVTYNANLGGEPAEGTAPPRLPQ
FT                   MPAYHLKRADGSGITMVNIGVGPSNAKTITDHIAVLRPHAWVMLGHCAGLRNTQRLGDY
FT                   VLAHGYVREDHVLDADLPLWVPIPALAEVQLALERGVAEVTRLEGVELKRVMRTGTVAS
FT                   VDNRNWELRDHREPVQRLSQSRAIALDMESATIAANGFRFRVPYGTLLCVSDKPLHGEL
FT                   KLPGMADTFYRGQVDQHLQIGVKAMEILRTNGLDKLHSRKLRSFAEVAFQ"
FT   gene            complement(731729..732265)
FT                   /locus_tag="Bcen2424_3870"
FT   CDS_pept        complement(731729..732265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3870"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3870"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10607"
FT                   /protein_id="ABK10607.1"
FT                   /translation="MSNARSRRCAMRGNQPHRQAANVKWMVHRAPARRQSSVIITTRLF
FT                   RPATAHYFVSARRSPGGTVPLASIASRRPIHHHTTEKNMQRSLIALAFAGLGLSLSGLA
FT                   HAVNVDVNIGTPAPVVVAPAPVVVAPAPVIVGWHGDRYWDGRRYWERREWEDRERHHGH
FT                   GGYHCPPGHAKKGEC"
FT   gene            complement(732398..733156)
FT                   /locus_tag="Bcen2424_3871"
FT   CDS_pept        complement(732398..733156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3871"
FT                   /product="conserved hypothetical protein 730"
FT                   /note="PFAM: conserved hypothetical protein 730; KEGG:
FT                   bcn:Bcen_4494 conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3871"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10608"
FT                   /protein_id="ABK10608.1"
FT                   /translation="MNKRKVIPSLRSLADQERATAKKARASWQMFTIMAEFIEATEYLS
FT                   EIRPAVSIYGSARLKPDTPHYKLAVQIARKLSDAGFAVISGGGPGIMEAANKGAHAGKA
FT                   PSVGLNIELPHEQAGNHYQDISLRFRHFFTRKVTFVKNSDAVIVMPGGFGTLDELSEVL
FT                   TLIQTKKSRLVPIILVGSEFWQGLLQWFRDQLIPMGLINPEDMDLMQVIDDPDQVLDAV
FT                   LAFYEDSGEEEGSDEDDHPPRPEEDRMFYL"
FT   gene            733158..735911
FT                   /locus_tag="Bcen2424_3872"
FT   CDS_pept        733158..735911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3872"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bcn:Bcen_4493 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3872"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10609"
FT                   /protein_id="ABK10609.1"
FT                   /translation="MPEERNLEGKTLLLVDGSSYLYRAYHAMPDLRGPGGEPTGALYGI
FT                   INMLRRMRKEVSAEYSACVFDAKGKTFRDDLYADYKANRPSMPPDLALQVEPIHGAVRA
FT                   LGWPLLMVEGVEADDVIGTLAREAERHGMNVIVSTGDKDLAQLVTERVTLVNTMTNETL
FT                   DRDGVIAKFGVPPERIIDYLALIGDTVDNVPGVEKCGPKTAVKWLTQYDTLDGVIEHAA
FT                   DIKGVVGDNLRRALDFLPLGRQLVTVDTSCDLTPHLESIEASLKSDGEARDLLRDIFAR
FT                   YGFKTWLREVDSAPAEGGGADAPEGEPAPVIAADVVREYDTIQTWEQFDAWFAKIDAAA
FT                   LTAFDTETTALDPMLARLVGLSFSVEPGKAAYLPVAHRGPDMPEQLPLDEVLARLKPWL
FT                   ESADRKKVGQHLKYDAQVLANYDIALNGIEHDTLLESYVVESHRTHDMDSLALRHLGVK
FT                   TIKYEDVAGKGAKQIGFDEVALAQAAEYAAEDADITLQLHHALYPQVAREPGLERVYRE
FT                   IEMPVSLVLRKMERTGVLIDDARLHAQSTEIATRLIELEGEAYELAGGEFNLGSPKQIG
FT                   QIFFEKLQLPVVKKTPSGAPSTDEEVLQKLAEDYPLPKLLLEHRGLSKLKSTYTDKLPR
FT                   MVNPTTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTAEGRRIREAFIASPGHRIVSAD
FT                   YSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGL
FT                   IYGMSAFGLASNLGITRDAAKLYIDRYFARYPGVAQYMEDTRATAKEKGYVETVFGRRL
FT                   WLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVDGWLTRDQLASRMIMQVHD
FT                   ELVLEVPEGELSLVREKLPEMMCGVAKLKVPLVAEVGAGANWEEAH"
FT   gene            736189..737523
FT                   /locus_tag="Bcen2424_3873"
FT   CDS_pept        736189..737523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3873"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bcn:Bcen_4492 NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3873"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10610"
FT                   /protein_id="ABK10610.1"
FT                   /translation="MHRIIIVGGGAGGLELATRLGDRYGARGNRPARALVTLVDRNPTH
FT                   IWKPLLHEVAAGSMDPFTQELEYAAQARWHGFEFQQGELTGLDRAAKRVTLSPLNDSDG
FT                   AELLPARELEYDTLVIAIGSTTHFFGVQGAPENAIALDTVGEAERFRKRLIAACMRAEH
FT                   QAPAPSAPGESAEPRIQVVIVGGGATGVELSAELRNTAQVLSVYGLHKLDPRHDVGIVL
FT                   IESGPRILPALQERVSAATAELLEKLGVRLMLNERVTEVAPGFVHTASGKAVRADLTVW
FT                   AAGIKAPSVLSHLDGLQVNKLGQLDVRRTLQTFTDDNVFALGDCAACAWPGNERNVPPR
FT                   AQAAHQQASFLLKAISCRLEGRPLPEFTYRDFGSLVSLGHFSAVGNLMGGLIGGNMLIE
FT                   GLFARFMYMSLYRLHIAALHGYPRMMLDTVAHWLRRTTLPRVKLH"
FT   gene            737895..738770
FT                   /locus_tag="Bcen2424_3874"
FT   CDS_pept        737895..738770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3874"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="KEGG: bcn:Bcen_4491 twin-arginine translocation
FT                   pathway signal; TIGRFAM: Twin-arginine translocation
FT                   pathway signal; PFAM: dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3874"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10611"
FT                   /protein_id="ABK10611.1"
FT                   /translation="MLKPEVDSLVPHVPFSRRKFMQAALGGTFAAAVLPVSAQTVTTDS
FT                   TGLDVDTIEIRSGDASVPAYRAQPVDKTNLPVVIVIHEIFGVHAHIADVCRRFAKLGYL
FT                   AIAPDLFARQGNAAKYPTMKELYDHIISKVPDRQVTEDLDATVAWAGKNGGDLTRLGVT
FT                   GFCWGGRQAWLYAEHNPHVRAAVAWYGFVEGKTDEMTPFNPVDHASSLKVPVLGLYGEK
FT                   DQNITQASLADMRKAIQTSDSKLARESEIVVYPDAGHAFFADYRPSYVKGDAEDGWKRA
FT                   IEWFHKYGVM"
FT   sig_peptide     737895..738011
FT                   /locus_tag="Bcen2424_3874"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.867 at
FT                   residue 39"
FT   gene            complement(738855..739724)
FT                   /locus_tag="Bcen2424_3875"
FT   CDS_pept        complement(738855..739724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3875"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: bcn:Bcen_4490
FT                   3-mercaptopyruvate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3875"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10612"
FT                   /protein_id="ABK10612.1"
FT                   /translation="MPHTHYTTLISAANLAERLAAAPGSVALFDCRFDLADPGAGEAAY
FT                   AAGHLPGAQYLHLDRDLSGRKTGTNGRHPLPTRDALATLLASRGLKQGQQVVAYDAQGG
FT                   AYAARLWWLLRWLGHDSVAVLDGGLQAWEAAGQPLTTDVPQPVAGDFRSATPLESTVDA
FT                   AAVLANVSSPARVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLAADGRFKTGH
FT                   ELREAFATVLAGTEPNRVILQCGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSR
FT                   PIATGPNP"
FT   gene            complement(739842..740948)
FT                   /locus_tag="Bcen2424_3876"
FT   CDS_pept        complement(739842..740948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3876"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bcn:Bcen_4489 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3876"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10613"
FT                   /protein_id="ABK10613.1"
FT                   /translation="MSNLSDALQLKSAHSQLPVTAYFDEALLEREIETLFKKGPRYVGH
FT                   ELMVPEAGDYFALPSEQEGRVLVRNQTNQIELLSNVCRHRQAIMLNGRGRTQNIVCPLH
FT                   RWTYDLEGELLGAPHFPDKPCLNLGKSPLQNWQGLLFEAEGRNVARDLANLGTKHHFDF
FT                   SEYQFDHVEVHECDYNWKTFIEVYLEDYHVVPFHPGLGSFVSCDDLKWEFGDWYSVQTV
FT                   GVHNALAKPGSATYQKWHEQVLKFRNGVPPEFGAIWMVYYPGLMIEWYPHVLVVSWLIP
FT                   RGPQKTTNIVEFYYPEEIALFEREFVEAERAAYMETAVEDDEIAMRMDAGRRALMARGE
FT                   SQVGPYQSPMEDGMQHFHEFLRRHLGDL"
FT   gene            741218..741511
FT                   /locus_tag="Bcen2424_3877"
FT   CDS_pept        741218..741511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3877"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII, small subunit; KEGG: bcn:Bcen_4488
FT                   exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3877"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10614"
FT                   /db_xref="GOA:A0AYY8"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AYY8"
FT                   /protein_id="ABK10614.1"
FT                   /translation="MAKTASPGATPPGNGTEPLPDNYEMALAELETLVARMEGGALSLE
FT                   DSLAAYRRGATLVAFCQQQLEKVEQQVRVLDGATLKPLSSGTAATDGEDDDL"
FT   gene            741508..742392
FT                   /locus_tag="Bcen2424_3878"
FT   CDS_pept        741508..742392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3878"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: bcn:Bcen_4487
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3878"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10615"
FT                   /protein_id="ABK10615.1"
FT                   /translation="MTFEQWMRSVLDRVEDALGHYLPAETAMPAKLHEAMRYAVLGGGK
FT                   RVRPLLCHAAGELTGATEAARNAAAAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVQ
FT                   YDEPTALLVGDALQSQAFVALTDAEALSPVQQAALVRELALASGSIGMAGGQAIDLASV
FT                   GLKLTREQLETMHRMKTGALLRAAVRMGALAGETPSAETMAALDVYAGAVGLAFQVVDD
FT                   ILDVTTDSATLGKTAGKDAANDKPTYVSILGLEASRELAAQLRAEAHDALKPFGARAQR
FT                   LAELADLVVNRVS"
FT   gene            742438..744378
FT                   /locus_tag="Bcen2424_3879"
FT   CDS_pept        742438..744378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3879"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein; KEGG: bcn:Bcen_4486 deoxyxylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3879"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10616"
FT                   /db_xref="GOA:A0AYZ0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AYZ0"
FT                   /protein_id="ABK10616.1"
FT                   /translation="MRARLISYNGTTMYDLLKTIDDPADLRRLDRRQLQPLADELRAFV
FT                   LDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSL
FT                   RQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTA
FT                   GMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERV
FT                   LSVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELRG
FT                   PQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDEA
FT                   ERDTRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIY
FT                   STFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAA
FT                   SDENECRQMLHTALQQPNPTAVRYPRGAGTGVATVKEFTEIPLGKGEVRRRTSQPEGKR
FT                   VAILAFGTMVAPSLAAAEELDATVANMRFVKPVDAALVRELAETHDYLVTVEEGCVMGG
FT                   AGSACVEALMESGVIRPVLQLGLPDQFVDHGDHAKLLAQCGLDGAGIAKSIRERFLSPA
FT                   ADVAGHAKRVA"
FT   gene            744533..745342
FT                   /locus_tag="Bcen2424_3880"
FT   CDS_pept        744533..745342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3880"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   bcn:Bcen_4485 protein of unknown function DUF198"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3880"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10617"
FT                   /db_xref="GOA:A0AYZ1"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AYZ1"
FT                   /protein_id="ABK10617.1"
FT                   /translation="MNQMNPAFVMPDVQSTVDTRQIPIQRVGVKAVRHPLTVCTESGDV
FT                   QPTVGVWNLDVRLPADQKGTHMSRFVALLEENRAPLTVERFRAMLASMLVKLEAEAGRI
FT                   EVTFPYFVNKTAPVSGVQSLLDYEVTLAGESRNGDTRLFLKVLVPVTSLCPCSKKISQY
FT                   GAHNQRSHVTIDAELAADLPVEALIRIAEEEASCELWGLLKRPDEKFVTERAYENPKFV
FT                   EDLVRDVAQRLDADERVVAYVLEAENFESIHNHSAYALIERDKRQAA"
FT   gene            complement(745437..746477)
FT                   /locus_tag="Bcen2424_3881"
FT   CDS_pept        complement(745437..746477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3881"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: bcn:Bcen_4484 metalloendopeptidase, putative,
FT                   glycoprotease family; TIGRFAM: putative
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3881"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10618"
FT                   /db_xref="GOA:A0AYZ2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0AYZ2"
FT                   /protein_id="ABK10618.1"
FT                   /translation="MLVLGIESSCDETGLALYDTQRGLLAHALHSQIAMHRDYGGVVPE
FT                   LASRDHIRRALPLLEEVMAQSGTRRDDIDAIAFTQGPGLAGALLVGASIANALALAWNK
FT                   PTVGIHHLEGHLLSPLLVDEPPPFPFVALLVSGGHTQLMRVTDVGVYETLGETLDDAAG
FT                   EAFDKTAKLIGLGYPGGPEVSKLAETGTPGAVVLPRPMLHSGDLDFSFSGLKTAVLTQM
FT                   KKFEAAKLDGEALERAKADLARGFVDAAVDVLVAKSLAALKKTKLKRLVVAGGVGANRQ
FT                   LRAALSAAAAKRGFDVHYPDLALCTDNGAMIALAGALRLGRWPEQANADYAFTVKPRWD
FT                   LASLAG"
FT   gene            746608..747828
FT                   /locus_tag="Bcen2424_3882"
FT   CDS_pept        746608..747828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3882"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: bcn:Bcen_4483
FT                   HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3882"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10619"
FT                   /protein_id="ABK10619.1"
FT                   /translation="METYDIAVIGAGAAGMMSAAVAGQLGRRVVLIDHAPRLAEKIRIS
FT                   GGGRCNFTNLYAGPDNYLSSNPHFARSALARYTPRDFLGLLKRHHVTWHEKHKGQLFCD
FT                   HGSDAIIDVLKHECDAGGIAWRRPVVVDAVRHAPSDGFTLDTQQAGPIGARALIVATGG
FT                   LSIPKIGATDFGYRLAKQFGHKLVDTRPALVPLTFAPQDWAPFAPLSGVSLEVRVSTGD
FT                   KKRGGEFVEDLLLTHRGLSGPGILQISSYWQPGDPIRVDLLPQRDTVADLLDAKRTSKR
FT                   QIGSLLADWVPSRLAHAWLDTHRVAADARLADLPDKTLRQIGDALSGWTLTPNGTEGYK
FT                   KAEVTKGGVDTRELSSATMMSARVPGLFFVGEAVDVTGWLGGYNFQWAWASGTAAGQAA
FT                   AEYARGA"
FT   sig_peptide     746608..746676
FT                   /locus_tag="Bcen2424_3882"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.971 at
FT                   residue 23"
FT   gene            747933..748145
FT                   /locus_tag="Bcen2424_3883"
FT   CDS_pept        747933..748145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3883"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21; KEGG: bcn:Bcen_4482
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3883"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10620"
FT                   /protein_id="ABK10620.1"
FT                   /translation="MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAER
FT                   KRKKAAAVKRHYKRIRSQTLPKKLY"
FT   gene            748340..748786
FT                   /locus_tag="Bcen2424_3884"
FT   CDS_pept        748340..748786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3884"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein; KEGG:
FT                   bur:Bcep18194_B2206 conserved hypothetical protein,
FT                   GatB/YqeY family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3884"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10621"
FT                   /protein_id="ABK10621.1"
FT                   /translation="MSLKEQISEDMKAAMRAKESERLATIRLLMAAIKQREVDDRVTLD
FT                   DAGITAVIDKMIKQRKDSISQFQAAGRDDLVAKEQAELTVLGGYMPAQLSDAEVAAEVQ
FT                   AAVAQTGAAGPQDMGKVMGVLKGKLAGRADMTAVSAQVKAALTK"
FT   gene            748858..750735
FT                   /locus_tag="Bcen2424_3885"
FT   CDS_pept        748858..750735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3885"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="KEGG: bcn:Bcen_4481 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger, CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase DnaG, DnaB-binding; DNA primase
FT                   catalytic core, N-terminal domain; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3885"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10622"
FT                   /protein_id="ABK10622.1"
FT                   /translation="MIPHSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGTAIGFLMEHAGLTFPEAVQELAQSVGLTVPHEPSMRGGG
FT                   GGGGGGGDYPAPVSKSVATALSDAMTAACDYYRKQLRGATVAIQYLKNRGLTGEIAARF
FT                   GLGYAPDGWQNLEAAFPDYRDESLVEAGLVIVSEKTDAQGVARRYDRFRERIMFPIRNV
FT                   KGQVIGFGGRVLGSGEPKYLNSPETPLFNKGSELYGLFEARLAIRERKYVLVVEGYMDV
FT                   VALAQLGFPNAVATLGTACTPIHVQKLLRQTDTVIFSFDGDSAGRRAARRALEACLPHA
FT                   GDNRTIRFLFLPTEHDPDSYVREFGAEAFSEQVERAMPLSQFLLNEAIAGKALDQPEGR
FT                   AKALFDAKPLLQALPANALRAQIMHMFADRLDIPFEEVAALSDVDTRIATPPRQAPARS
FT                   ERRRVTDSEKRALRTLVMHPRIASQLDDEQIATLRALPRIGELFAEVVDHARALGDGAE
FT                   FRLLSDVLRTSSNGATYEEIFREILDYDENVRDLLLQNPEDETVPERQREQERIAGEEL
FT                   QAAVLKMRYDACCDRLDRLARQSTFTPEELAELTELNQQRTDMKRRLGL"
FT   gene            750824..753241
FT                   /locus_tag="Bcen2424_3886"
FT   CDS_pept        750824..753241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3886"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; PFAM:
FT                   sigma-70 1.1 domain protein; sigma-70 region 3 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   4 domain protein; sigma-70, non-essential domain protein;
FT                   sigma-70 region 1.2; KEGG: bcn:Bcen_4480 RNA polymerase,
FT                   sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3886"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10623"
FT                   /protein_id="ABK10623.1"
FT                   /translation="MAKTTGGKKATGKGSTEPTKKVTAAKSASSTRTTSSATSAPAGKK
FT                   TAAGTAQAAPAPAARTRAAARPDSGPAKPAAKRASAKSARDTTADADETAVRTTHAPTV
FT                   QPAVVQQPRVDIAGTANSMTKKLNEVSVEDDANQSDEQPAAAAAPGKSKVRDRRAKEKA
FT                   LLKEAFATSTPGTAEELEERRVKLRALIKLGKERGFLTYAEINDHLPDNFTETEALEGI
FT                   IGTFNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVR
FT                   MYMREMGTVELLTREGEIEIAKRIEDGLRHMVMAISACPTTIADILAMAERVANEEIRV
FT                   DELVDGLLDPNASDSADTDGFSAKEAEAIENEDEEAEEEEEEEEEEEDDGAAQASANAA
FT                   QLEALKRASLEKFSQISEWFDKMRRAFEKEGYKSKAYLKAQETIQSELMTIRFTARTVE
FT                   RLCDTLRAQVDEVRQVERQILHIVVDKCGMPRSEFIARFPGSETDLDWAEKITAEGHPY
FT                   SAVLSRNVPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLR
FT                   LVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIA
FT                   DQARTIRIPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKE
FT                   PISMETPIGDDDDSHLGDFIEDTNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMR
FT                   FGIEMSTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
FT   gene            753380..753458
FT                   /locus_tag="Bcen2424_R0075"
FT                   /note="tRNA-Met1"
FT   tRNA            753380..753458
FT                   /locus_tag="Bcen2424_R0075"
FT                   /product="tRNA-Met"
FT   gene            753584..755266
FT                   /locus_tag="Bcen2424_3887"
FT   CDS_pept        753584..755266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3887"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bcn:Bcen_4479 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3887"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10624"
FT                   /protein_id="ABK10624.1"
FT                   /translation="MAIEVCCGAAGHGAIRAHVRTADQCRLHSAARTNGFHPGAGTAIM
FT                   IRLRSWGAILSLLMLAACASLPPQADRAPTHAFTDTDDTRLGVAFRQQAAAHPGQDAFH
FT                   LLTDPVDALDARVLLADRAERSLDLQYYIWHDDLTGHELADAVMRAADRGVRVRALLDD
FT                   LGTNADDRKLLEISAHPNIEIRLFNPVASRRFKKLGTLFEFSRVNRRMHNKAMIADNQA
FT                   AIVGGRNIGDEYFGASSMLEFGDLDVVVHGPVVKDISTEFDTFWNSPYAYPVDTLVGHD
FT                   AAPGGLERERERLRDYLRAMEDNPYVLEARQRLDRIVHGQGTELSWGHATVLYDDPSKI
FT                   AHPPKDRDGHLMPQLRALALQPRHDLLIVSPYFVPGKEVVERLRALTARGVRVTVLTNS
FT                   LASTDVAAVHAGYRRYRSDLVNAGVRLYERRPSGDKSISKQVIIGSSRASLHAKTYVFD
FT                   HTSIFIGSMNLDPRSLNLNTEIGVYCESPAIASQVADDLEARLDQIAWRVEARTDPAGS
FT                   GRLKWVQTDADGKVTEIDHEPEVSAPRRMEVWFLGLFPIESQL"
FT   gene            complement(755274..756740)
FT                   /locus_tag="Bcen2424_3888"
FT   CDS_pept        complement(755274..756740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3888"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bcn:Bcen_4478
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3888"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10625"
FT                   /protein_id="ABK10625.1"
FT                   /translation="MDLALLISSLARQDGATTHSRQEALYRSLRNMLLDGHLPPGTRLA
FT                   STRVLAAELGIARNSAVYAYERLAEEGFVAATRNGTITLWDGCDRSNVAKEDGPAPVHL
FT                   SARVHGLENADPEPERMLPFVPGLPSLDEFPVAQWRRCIERAWKTITPARLAYGPVEGL
FT                   PELRRAVAAYIRVSRGVRCDTGQVFITDGTQSSLELCARMLANPGEYGWLENPCYNGAR
FT                   TAFRSTGLNPVPIEVDREGMAPTHAQWRTHPPRLIYTTPSHQYPLGALMSPRRRAALVE
FT                   HARACGAWIIEDDYDSEFRHGGQPLPAIQGLHADAPVCYLGTFSKTMFPALRLGFMVVP
FT                   PVLVDRFTRTLRELVHRGHSADQLAMAEFIDTGLFARHLRKMRALYAERRGGLEAALAR
FT                   HLGTSLSVRESPGGMHLSADLAAPLHDTDVARTAAARGLLLQPLSSYCIGDGRRYNGFV
FT                   LGYSGLSDATIETAAMQFADVIEQHRRARH"
FT   gene            756975..757625
FT                   /locus_tag="Bcen2424_3889"
FT   CDS_pept        756975..757625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3889"
FT                   /product="flavin-nucleotide-binding protein"
FT                   /note="KEGG: bcn:Bcen_4477 flavin-nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3889"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10626"
FT                   /protein_id="ABK10626.1"
FT                   /translation="MNEKTDLSSTPRTTIRRLPELASHDRTMLHRIVDEAYVCHIAFGD
FT                   GQNTHCIPTAHWRRGDALYIHGSNGSRMVKALSAGAQACVAMTLLDGLVLARSAFNHSM
FT                   NYRSAVIYGQFDVIEGSAEKLAALDALMDKIAPGRKHEARPGNSKEINATSVLRISMAE
FT                   AAVKISDSLPSDKEEDLGLAVWAGILPLKTTRGAPVHADGNVVVPDYVRNWAD"
FT   gene            complement(757695..759377)
FT                   /locus_tag="Bcen2424_3890"
FT   CDS_pept        complement(757695..759377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3890"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3890"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10627"
FT                   /protein_id="ABK10627.1"
FT                   /translation="MNHARAHRPVRTLIASSVIVSLLGLSACNKRDESSAAAPASDASA
FT                   ASAAQPASTPVAYTPPSADQLYQMVAPIALFPDKLVALVLAGATYPDQIAAANTWVTQN
FT                   PSLKGQALASAADAQPWDPSVKALTAFPAVLSQMASNPAWTTSLGQAYYNDPTDVMNAI
FT                   QVMRQRAQKSGHLRSSGQMRVTQVAQAAPAGYTPATDAPVVYSGPAIVPPPEQAIEIEP
FT                   AQPDVVYVPSYNPTVVYGEPVSSYPGYVYRPPVYSTGEVVTAGVITFGIGIAVGAAIFG
FT                   HHDWGWHAWGVNWGAPRPEGPAWHGGWQRPAVVYNHTTYVTKSTTVINNITNIRNTRIT
FT                   NNYGGNVTNNNTTIERNTVRPGAEPMRGQALEQRPGAAPMTIPHFGANDARPGARPAPE
FT                   AFAQHRANAPHAEVPVPHPPGATHDTRQQAMQREHAAQETRAAAQQQQQQRAEMQRHDA
FT                   AQQREALQQRNAAQQQEHAQAQQRDEAQQQQRVEAQQRDEARQQQRSEAAQQQQRKEMQ
FT                   PHPEAPPREHAAPQPRQAAPEHAHAPHPAESHPPHESREHRPG"
FT   gene            complement(759830..761662)
FT                   /locus_tag="Bcen2424_3891"
FT   CDS_pept        complement(759830..761662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3891"
FT                   /product="Pseudomonalisin"
FT                   /EC_number="3.4.21.100"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: bcn:Bcen_4475 pseudomonalisin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3891"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10628"
FT                   /protein_id="ABK10628.1"
FT                   /translation="MNQVANKNQKHIRVVKLAFAAAAAATFGMATAHAAPAAGWTETHT
FT                   KGFLPLVQQNEAGTAGAPAASTAAAAASAIDMAPGESVDIVLGLNLRNEAQLDQYLRDL
FT                   HTPGSPHYRQFLTPAQFAAQYAPTDQQVASVVAHLRKAGFVNIVVAPNRLLVSASGTAG
FT                   TVQSAFRTTLKRFTRNGRSVYANTDAAQVPNAIGNVVGSVLGLQNVELVHTGAGSKPQG
FT                   NTSNLTIPAGASAVPHNPTEFSSIYGGDGTPTASQTTVGIISEGDLSQTVSDLNTFAAN
FT                   NGLGTISSSIVKTGPAGSSYTDTDGTVEWNLDSQSIVGAAGGSVKQVVFYVAPSMTLTA
FT                   ITAAYNKAVTDNVAKVINVSLGVCESSANSTGSQATDDTIFKQAVAQGQTFSVSAGDHG
FT                   AYECASGTPSRSTYTVSEPATSPYVIAVGGTTLFTNTSTNAYNSEIVWNDPSWQPGTVW
FT                   STGGGYSKYEAAPTWQSSTLTGSTKRALPDVGFDADLRTGAILVVNGQTSDTLWGSGYL
FT                   NNEGGTSLAAPIFTGIWARLQSANNNALGFPASSIYKYFPTNAALLHDVTSGNNGSGTY
FT                   GYKAKAGWDATTGFGSVNISKLNTFIQSTSDFAR"
FT   sig_peptide     complement(761558..761662)
FT                   /locus_tag="Bcen2424_3891"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 35"
FT   gene            complement(762293..762919)
FT                   /locus_tag="Bcen2424_3892"
FT   CDS_pept        complement(762293..762919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3892"
FT                   /product="histidine kinase, HAMP region domain protein"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   KEGG: bcn:Bcen_4474 histidine kinase, HAMP region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3892"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10629"
FT                   /protein_id="ABK10629.1"
FT                   /translation="MTPPVRPGRQIGQTIGLAAIVVVLLAGTVAFVVHALHAPAALPHD
FT                   ASADAMLRSASTYLVLATALFVCLLAAAFDLFRLLRRMLATLDAMADTAGRIVAGDPSA
FT                   RTVSRDGCPADLARFIDHFNAMTHSMKSTNPSDATATVASSSRVTLTHLAELETRLDAI
FT                   KALATDDADASSRDALLQHVDALFRCVEDLQVTERQAPAIRTFPR"
FT   sig_peptide     complement(762812..762919)
FT                   /locus_tag="Bcen2424_3892"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.769 at
FT                   residue 36"
FT   gene            complement(762916..763608)
FT                   /locus_tag="Bcen2424_3893"
FT   CDS_pept        complement(762916..763608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3893"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcn:Bcen_4473 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3893"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10630"
FT                   /protein_id="ABK10630.1"
FT                   /translation="MTNSLILIAEDEPDISDILDAYLKHDGFRTYRVADGQAVLDMQPH
FT                   LKPDLILLDVKMPRKNGWDVLAELRRRDNTPVVVLTAFDRDLDRLQALHAGADDYIVKP
FT                   FNPAEVVARLRAILRRSAAPPTLRMLRVGDLEIDTDSYLARVRTAGTEVPITLTLTEFR
FT                   LLAHMARSPSRVFTRGELLDACMADVSALERTVDSHICRLRKKLEQAGAPGMPEVMRGV
FT                   GYRLRGVQ"
FT   gene            complement(763710..765140)
FT                   /locus_tag="Bcen2424_3894"
FT   CDS_pept        complement(763710..765140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3894"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_4472 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3894"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10631"
FT                   /protein_id="ABK10631.1"
FT                   /translation="MRLLILPLVLALSACSLAPTLVKPSMPVPTAYTAAAAANPDANAA
FT                   DLGWRTMFGDRRLQRLIELALEHNRDLRVAALNVEAAEAQYGIQRAARLPSIGAGASFT
FT                   RQRTSDDTQSNPPLFGATQNQYGVNVGISAFEIDLFGRVKSMSDAAFARYLATDHGRRA
FT                   VQISLVGGVADAYFAERLAHEQRQLSERTLADWQQSLDLARRLKEAHQASGVDIAQAEG
FT                   QVASATADLEARTRAVEQARNALRLLIGTELPKDLPEPLPLQQQPVMTQLPAGLPSELL
FT                   FRRPDIQQAEQNLVAANADIGAARAAFFPRLSLTSSIGFLSPAMGSLFDGGQRAWSFAP
FT                   QVTVPIFQGGRLRAELRLAEVRKSSAVAEYERAIQAAFREVADGIAGRETFGRQIEAQT
FT                   RVVGSAERRADLSNLRYRAGVEGRLELLDSQRQLYAARQALLDLRRSELGNAVALYKAL
FT                   GGGLTDQDVAPSKRVMQN"
FT   sig_peptide     complement(765072..765140)
FT                   /locus_tag="Bcen2424_3894"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.704 at
FT                   residue 23"
FT   gene            complement(765145..768288)
FT                   /locus_tag="Bcen2424_3895"
FT   CDS_pept        complement(765145..768288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3895"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bcn:Bcen_4471 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3895"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10632"
FT                   /protein_id="ABK10632.1"
FT                   /translation="MAEFFIRRPVFAWVIALFIILTGLIAIPQLPVARYPSVAPPSVTI
FT                   TASYPGATPQTMNDGVLSLIERELSGVKNLLYFESSADTSGQAQITVTFKPGTNPEMAQ
FT                   VDVQNKIKSVEPRLPAAVRQNGLIVESASSGFLMIVSLRSDNGRFDEGALADYMARSVS
FT                   EELRRIDGVGRVLQFGSERAMRIWVDPQKLINFGLSMSDLTTAIGQQNVQIAPGSLGAL
FT                   PALPGQRVTVPLTAQGQLTTPEAFAKVVLRANADGSKVVLGDVARVELGSQNYTFVSRE
FT                   NNKPATLAGVQLAPGANAVKTADAIRARMAELSKSMPSGMSYSIPLDTSPFVKISIEKV
FT                   LHTLLEAMVLVFLVMYLFLQNVRYTLIPAIVAPVAMLGTFTVMLLTGFSINVLTMFGMV
FT                   LAIGIIVDDAIVVVENVERLMAEEGLSPKDATSKAMKEITGAIIGVTLVLTAVFLPMAM
FT                   ASGSVGVIYKQFTLSMAVSILFSALLALTLTPALCATMLKPIAAGHHEKRGFFGWFNRR
FT                   FDRLTKWYETRVGRLVGRTGRVMLVFVAISGALVLGFRSLPSSFLPDEDQGYFITSFLL
FT                   PADATAERTHDVVKTLEKHLASRPAIQSSISVIGYGFSGQGSNAAINWSVMKDWKNRGG
FT                   ASTIEEGMLAQQAMAGVTEGTVMSLLPPAIDELGNSSGFSMRLEDRANQGAAALKAAEV
FT                   KLLELAAQSKVVTGVYPDSLPAGTSIRLEIDRAKAQALGVSFTTLSDTLSTAMGSTYVN
FT                   DFPNAGRMQQVIIQADAPARMQIDNVMKLYVRNAAGGMVPLSEVVRPVWTDTPLQMVRF
FT                   KGYPSARIAGNAAPGQSSGAAMAEMERLAAQLPPGFAVEWTGQSLQERQSASQAPMLMV
FT                   LSMIVVFLVLAALYESWSIPLSVMLVVPLGLIGAIGAVLLRGMPNDVFFKVGMITVIGL
FT                   SAKNAILIVEFAKQLREEGKGLIEAAVQASKLRLRPILMTSLAFGLGVVPLMIATGASA
FT                   ETQHAIGTGVFGGMVTATVLAIFFVPVFFVFVMSIQERIGAWRASRKQPASPTHEQEG"
FT   gene            complement(768309..769469)
FT                   /locus_tag="Bcen2424_3896"
FT   CDS_pept        complement(768309..769469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3896"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_4470 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3896"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10633"
FT                   /protein_id="ABK10633.1"
FT                   /translation="MKNQKRCCHGAVCALVAAMLAGCGPSEQQAAAPATPVAAMTVAAT
FT                   RVDVTEDLPGRVAAVRVAEIRPQVSGIVQRRLFEQGTEVRAGQPLFQINPAPFKAEMDT
FT                   AAASLQRAQAALERAKVQTARFKPLVEADAISRQVYDDAVSQRDQAAADVAQARATLAR
FT                   RQLDLKFATVEAPIAGRIDQALVTEGALVSSSDSQPMARIQQIDQVYVDVRQPAASLEA
FT                   LRDALASQPQASDGNGLPVDVLRDDDTRYDVRGRMLFSGVNVDPGTGDVLLRVLVDNPK
FT                   RQLLPGMYVRARIPRAHYANAVMVPQQAIVRAGGKPQVWVLDAKGTARLKAVEVGELTN
FT                   RSYRIKSGLQAGQKIVVEGMERLTDGAPAAATDWKSPDAVATASAH"
FT   sig_peptide     complement(769377..769469)
FT                   /locus_tag="Bcen2424_3896"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.407 at
FT                   residue 31"
FT   gene            complement(769874..770485)
FT                   /locus_tag="Bcen2424_3897"
FT   CDS_pept        complement(769874..770485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3897"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: bcn:Bcen_4469 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3897"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10634"
FT                   /protein_id="ABK10634.1"
FT                   /translation="MRSERFPHTIRAAVAALALAALAGCAHLPDQPTYGKADPAALRRY
FT                   DGDWFDAARVGRVDILRALHDAGYPVDATDSHGYTAVILASYDGQPAALDYLLSVGADA
FT                   CVGDRHGNTALMGALFRNEPDIARRLIDTRCPIDQTNGAGETALGFATLFNRFELIPLL
FT                   VAHGANPNHVDRRGQSLLQLALTHDNTYAADALRNAGAKP"
FT   sig_peptide     complement(770405..770485)
FT                   /locus_tag="Bcen2424_3897"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            complement(770565..772100)
FT                   /locus_tag="Bcen2424_3898"
FT   CDS_pept        complement(770565..772100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3898"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: bcn:Bcen_4468
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3898"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10635"
FT                   /protein_id="ABK10635.1"
FT                   /translation="MSSSSHRVLRHAVAAICVALSASPYAAELTRDTGAPVGDNQNSQT
FT                   AGPAGPVLLQDSALIEKLQRFDRERIPERVVHARGTGAFGEFVPSADISDLTKAKVFTP
FT                   GTRTPVFVRFSTVMGYRGSPEQARDPRGFAVKFYTQQGNWDMVGINWPVFFIRDGIKFP
FT                   DFVHANKPSAVTGVQDPNLAFDFFAHTPEATHMLTRLYTDEGMPDSYRRMDGFAVHAFK
FT                   FVNAQGDVHYVKFHWKSQQGVHGLRPQEIPASIGRDWNLMTNDLYGALKQGDFPKWDLY
FT                   VQVLTPKDLNRFDFDALDDTKVWTGVPERKIGTMTLNRVPDNYFQSTEESAFAPSRLVP
FT                   GIEPSEDRMLQDRLFAYADTQMYRLGANYMDLPINRPVVPVVNNNQDGKMNAGDRKGEV
FT                   NYEPSTLNELAQDPQYKSVRMTLSGTTQQEAIRKKLPFRQAGEYYRSLSQQDKDDLVTA
FT                   LSGDLGQVKNAQNQYAMLSYFYKADADYGTRLAQAVHANVQQVQSLAAKLSDN"
FT   sig_peptide     complement(772020..772100)
FT                   /locus_tag="Bcen2424_3898"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 27"
FT   gene            complement(772336..773823)
FT                   /locus_tag="Bcen2424_3899"
FT   CDS_pept        complement(772336..773823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3899"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_4467 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3899"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10636"
FT                   /protein_id="ABK10636.1"
FT                   /translation="MKPFSLPRRPALTLCAAACLLAGCTVGPDYHGAPAAPDASTFVRA
FT                   PATGVDTASPAPSAWWHALNDRQLDALIVAALVYNPDLHAAQARLRAARAQLSQQRAAQ
FT                   MPKSSATVAAIRMREPDVSALGSLLPSNGSEQSGGTSPSLGGSGPLQLYSAGFDATWEI
FT                   DLFGGTRRAVEAASAQAEAVDADLADTQVSIAAEVANAYVDLRDQQQRLALSKRTAQLQ
FT                   QQMLELTQQRRARGVAADADIERLTTQVENTRASLIPLDAQVTESLDRLAILTGRAPGA
FT                   LDAALSTPDAALPTLPGSVAIGDPATLLKQRPDIRAAERRLASSNAQIGEHVADYFPKV
FT                   TLLGDLGFSATDPGHLFRKQNFTWVGAPYLQWNILDFGRTRGAVRAAEASRDEAEANYQ
FT                   KAVLGALQDANTALQRYGHQREHVVALTKVQTSAVHSRALMDQRYRAGVASMIDLLDTQ
FT                   REAFAAQQNVIAGQAELIKNYVSVQKSLGLGWQTSAG"
FT   sig_peptide     complement(773725..773823)
FT                   /locus_tag="Bcen2424_3899"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.632 at
FT                   residue 33"
FT   gene            complement(773837..775423)
FT                   /locus_tag="Bcen2424_3900"
FT   CDS_pept        complement(773837..775423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3900"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_4466 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3900"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10637"
FT                   /protein_id="ABK10637.1"
FT                   /translation="MADTPATIPLPPHEGRASVTDWIAVAAGALGALMATLDISITNSA
FT                   LPQIQGEIGATGTEGTWISTGYLMSEIVMIPLAAWLTRVFGLRNFLLTNSALFIAFSMM
FT                   CGWSHSLPMMIAGRIGQGFTGGALIPTAQTIIRTRLPLSQLPVGMTLFGLIVLLGPLFG
FT                   PVLGGWLAENVNWSWCFFLNLPVCLLLMALLVFGLPSDRPQWSAFFNADWLGILGLAIG
FT                   LSSLTVVLEEGQRERWFESQMIVTLSIVSFIGMVLIALSQRFAKRPIMRLSLMRNPRYA
FT                   SVIVIVSAVGAGLYGVSYLLPQFLAIVAGYNAEQAGAIMLLSGLPAFLVMPILPRLLGK
FT                   VDFRILVITGLLLFCLSCMLDISLTAQSVGHDFVWSQLIRGLAQMLAMMPLNQASMAAV
FT                   AREDSGDAAGLYNMARNLGGSIGLAIIGTVIDRRTTFHTAALRESVTANSLIGQDRLSA
FT                   YAANWFAHTGDLAYSNLRALGQLAQQIQIQAVVMTYSETFYLLGLALLACVPLALLLRT
FT                   PRGPQPMSSGH"
FT   gene            complement(775416..776540)
FT                   /locus_tag="Bcen2424_3901"
FT   CDS_pept        complement(775416..776540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3901"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_4465 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3901"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10638"
FT                   /protein_id="ABK10638.1"
FT                   /translation="MSTPQDPPQKADRQENKTTPRNGNGGTRRRILLVVAVLAAVGGAV
FT                   WLGRWWTVGRFIESTNDAYLQADSMTAAPKVAGYVTDVYVRDNQPVKAGDPLVRLDVRQ
FT                   YQVALAQAQATVDARRADIARAEADISQQRANLEQADAQAKVSRINAQHASDEYTRYAP
FT                   LAATGAETHERVADLKSTRDQAAATLAANNASIAAARTQIASFTAQLQQARAQLEAAQA
FT                   SAAQAQLDLDNTIVRSTLAGRVGDRTVRVGQYVQPGTRLLTVVPVDSIYLVANFKETQI
FT                   GNMRIGQPVELHVDALPDGPLSGVVDSFAPGTGAQFALLPPENATGNFTKIVQRVPVRI
FT                   RLAANARAQRMLLPGLSVTVDVDTRSARDEQHHG"
FT   gene            776632..777468
FT                   /locus_tag="Bcen2424_3902"
FT   CDS_pept        776632..777468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3902"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_4464
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3902"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10639"
FT                   /protein_id="ABK10639.1"
FT                   /translation="MNEAKKLRRTSAGGYARGDETRQRIIEAAIELFGERGFAGASTRE
FT                   IAAMAGVNAPALQYYFENKEGVYRACVETIAEHGWQVFAPAVGHARAMLDGHASVDALI
FT                   DAFIGLLRALSDRMFTAPKTMNQRMFFAREQGGQEPASASEILMTRMRKPLNDVSAELI
FT                   GRITGRPADDPVTRLRALSLFGQITVFHIAQRSALQLLEWEAFEGERAALVTDTIADQT
FT                   RVLLEQWHAQRDAHASSAESAAKRAQGAAAKRRAAKPGAVPPAAKSTTRVKKPAAR"
FT   gene            complement(777496..779964)
FT                   /locus_tag="Bcen2424_3903"
FT   CDS_pept        complement(777496..779964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3903"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bcn:Bcen_4463 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3903"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10640"
FT                   /protein_id="ABK10640.1"
FT                   /translation="MRHILLGWLLAAVVSAAHAAAPAPAAASAASGAAPALTPQEARQA
FT                   LNVLENPRDRAQVETTLRAIAAVGALSAPAVPASAAPATSGASAAAAPAALTSNGLASM
FT                   LVRQGSRWATQIGNALQESLRSLLDIGSVGSWWHDKLVSADQRADLTRTLGILVAVLLP
FT                   ALIVEWLAKRLLRRALATVAARRADTLRHTASDSAASDEVHAPPPDTSTPPDTAAADTA
FT                   GATPASSQSRGHARRHTTLLQRMPRALVSLALRAVPLLVFVGVASLTMSVLVEADTPIE
FT                   AALEALIDTYVICRLITIVSRLFFQPDARQLRLLHISDAWADFVQRSIARIVIVVGACT
FT                   AAVEIAANFGLSEAGHVALLKAVALVGHVMISVLILQCRRPVAARIRAAGADRPAFTVV
FT                   GNALADAWAPVSVFIVMALWFVWALDVHNGYRVLITLGGRSIAVMIAMRMVSIVVFGAL
FT                   ARLFQRRDDDRTLVHLHAYRYYPLLRQIVSGAIGIVTVVLLLQIWGVPIFRAFETGTIG
FT                   HRLASALVTIAIAAIVALVVWEAANIAIERRLQRWTREGNLVRAARLRTLLPMLRSLLF
FT                   VMIALVVVLTGLSELGVNVGPLLAGASIFGVALGFGSQKLVQDFITGIFLLMENAMQVG
FT                   DWVTLAGVSGTVEYLSIRTVRLRAGDGSLYTIPFSSVTTVNNTNRGLGNAAVKVSIAYG
FT                   EDIDRAIATLKEIGAALRDDPKYHDGILSDFSYWGIDQVDGAALALAGQMQCTDSARWG
FT                   VQREFNRRIAETFRERGIRIANPQRSVVAYADGSRPVGSEENDPRPDTRNAAETAAPSP
FT                   SPDGAERKPG"
FT   sig_peptide     complement(779905..779964)
FT                   /locus_tag="Bcen2424_3903"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 20"
FT   gene            complement(780235..781194)
FT                   /locus_tag="Bcen2424_3904"
FT   CDS_pept        complement(780235..781194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_3904"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: bcn:Bcen_4462
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_3904"
FT                   /db_xref="EnsemblGenomes-Tr:ABK10641"
FT                   /protein_id="ABK10641.1"
FT                   /translation="MPPTVPARPDVAQRVFADGRLSIGLTLPLLRSGHIVADFDEQLEL
FT                   A