(data stored in ACNUC7421 zone)

EMBL: CP000460

ID   CP000460; SV 1; circular; genomic DNA; STD; PRO; 1055417 BP.
XX
AC   CP000460; AAHL01000000-AAHL01000333;
XX
PR   Project:PRJNA13918;
XX
DT   03-NOV-2006 (Rel. 89, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 5)
XX
DE   Burkholderia cenocepacia HI2424 chromosome 3, complete sequence.
XX
KW   .
XX
OS   Burkholderia cenocepacia HI2424
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1055417
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., LiPuma J.J., Gonzalez C.F.,
RA   Konstantinidis K., Tiedje J.M., Richardson P.;
RT   "Complete sequence of Chromosome 3 of Burkholderia cenocepacia HI2424";
RL   Unpublished.
XX
RN   [2]
RP   1-1055417
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., LiPuma J.J., Gonzalez C.F.,
RA   Konstantinidis K., Tiedje J.M., Richardson P.;
RT   ;
RL   Submitted (30-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b977fe1a5de66669be922d16708b3cba.
DR   BioSample; SAMN00113327.
DR   EnsemblGenomes-Gn; Bcen2424_R0082.
DR   EnsemblGenomes-Gn; Bcen2424_R0083.
DR   EnsemblGenomes-Gn; Bcen2424_R0084.
DR   EnsemblGenomes-Gn; Bcen2424_R0085.
DR   EnsemblGenomes-Gn; Bcen2424_R0086.
DR   EnsemblGenomes-Gn; EBG00001021792.
DR   EnsemblGenomes-Gn; EBG00001021793.
DR   EnsemblGenomes-Gn; EBG00001021794.
DR   EnsemblGenomes-Gn; EBG00001021795.
DR   EnsemblGenomes-Gn; EBG00001021796.
DR   EnsemblGenomes-Gn; EBG00001021797.
DR   EnsemblGenomes-Gn; EBG00001021798.
DR   EnsemblGenomes-Tr; Bcen2424_R0082-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0083-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0084-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0085-1.
DR   EnsemblGenomes-Tr; Bcen2424_R0086-1.
DR   EnsemblGenomes-Tr; EBT00001624209.
DR   EnsemblGenomes-Tr; EBT00001624210.
DR   EnsemblGenomes-Tr; EBT00001624211.
DR   EnsemblGenomes-Tr; EBT00001624212.
DR   EnsemblGenomes-Tr; EBT00001624213.
DR   EnsemblGenomes-Tr; EBT00001624214.
DR   EnsemblGenomes-Tr; EBT00001624215.
DR   EuropePMC; PMC2612433; 18931103.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000460.
DR   SILVA-SSU; CP000460.
DR   StrainInfo; 844880; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635681
CC   Source DNA and bacteria available from James M. Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1055417
FT                   /organism="Burkholderia cenocepacia HI2424"
FT                   /chromosome="3"
FT                   /strain="HI2424"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:331272"
FT   gene            complement(49..240)
FT                   /locus_tag="Bcen2424_5867"
FT   CDS_pept        complement(49..240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5867"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: bcn:Bcen_5503
FT                   Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5867"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12600"
FT                   /protein_id="ABK12600.1"
FT                   /translation="MSKFIQQVGRFVRDEDGVTAIEYGLIAALIAIGIIAALSTVGKDL
FT                   KTVFTTIADDLDSAVAAI"
FT   gene            complement(380..571)
FT                   /locus_tag="Bcen2424_5868"
FT   CDS_pept        complement(380..571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5868"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: bcn:Bcen_5504
FT                   Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5868"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12601"
FT                   /protein_id="ABK12601.1"
FT                   /translation="MSRIIEKIAWFVEDQDGVTAIEYGLIAALIAIGIVGALTTVGTDL
FT                   KTVFNTVADDLDSVVAAI"
FT   gene            743..1084
FT                   /locus_tag="Bcen2424_5869"
FT   CDS_pept        743..1084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5869"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5869"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12602"
FT                   /protein_id="ABK12602.1"
FT                   /translation="MYGSTGRMNRASRATGTARLPFDAWNSVEREMNSRQSCNVSLTRL
FT                   AIRDVLWSFIFIPHVPPCRFLIARKLSGLVGRSTTVAAVDRPGAAYSPTRSSPSFPQVI
FT                   REPVPLLFA"
FT   gene            1621..2859
FT                   /locus_tag="Bcen2424_5870"
FT   CDS_pept        1621..2859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5870"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5870"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12603"
FT                   /protein_id="ABK12603.1"
FT                   /translation="MYTANRGTRDRAIRCAQWLTADRIIPYSCIMLMLFAALVIVWGVV
FT                   TNGFTSNATARPGTDFSVFWTASHLVLQGHAASAYDASSFVQAEFAHFGAFLQHRPLPW
FT                   LYPPTMLLFIAPVALVPFLPAYFLFFAGSLLCYALAVSRLSGLRAHLPVPRAAMVVVIA
FT                   YSAVCMSALFGQNSILTAGLAALALHLLGKRPVLAGVLIGLLAIKPQLAVVFPFVLIAT
FT                   RAWRTFAAAAISATLFAAAGVALAGPAALHGLARAMSTVREQHFMLASYWLASPTPFAA
FT                   LRLAGAPVAAALAAQAAVALLAIAAAVSVWRRTHDMRLRGAVLAVATLLTTPYLWHYEL
FT                   TWLGIAIFCLIAHGLDEGWLPGDQGILVIAWLLPIFEMFNRLMKLPQIGPVVLLAVLFV
FT                   VVRRTALASRGKQ"
FT   gene            2856..4235
FT                   /locus_tag="Bcen2424_5871"
FT   CDS_pept        2856..4235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5871"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5871"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12604"
FT                   /protein_id="ABK12604.1"
FT                   /translation="MKAPSFARHAHSAIDVHPELPIAGPRRHPHWLNRDRVRVYAAAVL
FT                   LTELLFIGLYLIRVILSKHGVLEPLSPDFSPIWSAAWLAAHGHGADAWHYATLFAIEKS
FT                   AVPTITLANGTQPWLYPPTMLLLVLPLGWLPYTLALVLWLGITYALFAATIHATVQRDA
FT                   AWLCALAFPGAFLTVIVGQTSLFTATLAAVGLLALNRRPVCAGICFGLLTMKPQLAVLF
FT                   PLALLCAGQWRALAAWAATIAVSALLATLAFGVGPWVAFAHVIADVYAIVGTGRAQLAR
FT                   MPTLFALATMAGWPALVARGLQLLSAAVAAIAVVYAWRGACSYALRAATLACACLLVSP
FT                   YLYDYDLTWYGIVIAWYARYALTRGWRRFDREWLMLLWPMPLAGLAVVPHLSFQFMPLV
FT                   TLASLALLVSRIAQERRDVPSMPDARDTSTETGFAHPSRAHHRPAHGMRRTGRPTLGAG
FT                   R"
FT   gene            4260..5303
FT                   /locus_tag="Bcen2424_5872"
FT   CDS_pept        4260..5303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5872"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bcn:Bcen_5508 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5872"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12605"
FT                   /protein_id="ABK12605.1"
FT                   /translation="MRESIYTPLVSLVVPFYNEGEAVERFFDVVIPLLSAIDAIRFEIV
FT                   CVNDGSRDDTLERLVRIGAAERRVRVIDLTRNFGKEAALTAGLDEAAGDAVIPLDADLQ
FT                   DPPSLIPVMIEHWRDGAEVVAAKRSNRACDSFAKRTAAALYYRVHNLLSDVKLPENVGD
FT                   FRLMDRKVVNALRNLPERHRFMKGLFAWVGYKTVIVEYQRDPRSAGHSKFSGWKLWNFA
FT                   LEGITSFSTVPLRSWTYIGVGIAALAFVYGAFIILRTLLFGNPVLGYASLISVTLFIGG
FT                   IELIGIGVVGEYVGRIYDESKQRPVYLIRRRYQAHGKVIELPVARDARRQPARRRAQPV
FT                   RARIGAR"
FT   gene            5316..5699
FT                   /locus_tag="Bcen2424_5873"
FT   CDS_pept        5316..5699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5873"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bcn:Bcen_5509
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5873"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12606"
FT                   /protein_id="ABK12606.1"
FT                   /translation="MSTLLQAERTRLVRFGVSGLCSTAIHVLVATALFARLDAAPVTAN
FT                   AIAFLCATAFSYLANTLWSFSSTVRTRNAIRFLAVMLAGFVETMLIARAAEALDAPRAM
FT                   GVVAIALLIPPTTFVLHRLWTYR"
FT   gene            5995..6498
FT                   /locus_tag="Bcen2424_5874"
FT   CDS_pept        5995..6498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5874"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5874"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12607"
FT                   /protein_id="ABK12607.1"
FT                   /translation="MSRVTDVLVSFDTETILKKYPNPSKNPAAPTLIDWRYVYMVTNQD
FT                   NVISGQAGGELDLKAQVGDLIRWRETSLSLGFENQVVFYKFIGNVGNDLISTPTPRVAE
FT                   ASIPVPNTSKPEVPTCQKVANYYWSSECLKVGRVTYHFQFQIIDRNCQSQGCFSWDPFI
FT                   SIHN"
FT   gene            6564..7103
FT                   /locus_tag="Bcen2424_5875"
FT   CDS_pept        6564..7103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5875"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5875"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12608"
FT                   /protein_id="ABK12608.1"
FT                   /translation="MSGVRCDALAIVDAVTLLSAYPDASRDADVPTVIDGRHIYVLSPG
FT                   DAGQVSHNDNRLFAGLSPGDQLRLRETALALRAEVTVLFVRFALKDAGIVTPLEAEIRD
FT                   AATPVPDGDDLLHPSCRPMKDHFWHSEVLAPGTTTCTADFAVLDRDGAVSGYFRWETTI
FT                   EIAGSRPDTKRPDVKP"
FT   gene            complement(7176..8117)
FT                   /locus_tag="Bcen2424_5876"
FT   CDS_pept        complement(7176..8117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5876"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_5512 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5876"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12609"
FT                   /protein_id="ABK12609.1"
FT                   /translation="MSRPAFAVTRIARVLAAALIAGSAVAAHAASFDLSPEQPARQRGA
FT                   VNPAVEQALPAGFRFAEANTLTIGIAPNLPPLSTYATDARTVVGFDPDLAQLIADSVGR
FT                   KLKIVPLAWADWPLALQSGKVDAVISNVTVTEQRKEKFDFSTYRKDQLGFYVKTGSKLA
FT                   AIREPKDVAGLRVVTDSGTNQEKILLEWNRQNVARGLAPVEIQYYADAAERWVALQSGR
FT                   VDTIFSVNSMLAYQASLRGDAKLIGTVSGGWPRTADIAITTRKGSGLADPLTLAINALI
FT                   ANGSYRKALDHWQLDAEAIERSQTNPPGLPRT"
FT   sig_peptide     complement(8028..8117)
FT                   /locus_tag="Bcen2424_5876"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 30"
FT   gene            complement(8204..9325)
FT                   /locus_tag="Bcen2424_5877"
FT   CDS_pept        complement(8204..9325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5877"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5877"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12610"
FT                   /protein_id="ABK12610.1"
FT                   /translation="MTYLADARIALTAAESAHIRQTLGALAYDPAGGAGYISAVRKLAY
FT                   NAFPDRIVDAFDRAKAPTADAHGSIEIDNLPIDDDVKGSPRFEETGRSFKAGVLSENVL
FT                   VALSTLAGEPYSIAHEGRELVNNLTPHKATARDYTGLGSEVELDFHIENAAQAHMPEGD
FT                   TSPFALLLLGVRSEAGGGPYTRLADARRALQLLSPDDIAQLYGEHYIIRVPYRWRGAAP
FT                   TPRDNTDLSAVLSGPLDAPRVTVAFYPDMVLAVNTRAQEALANLYRAVREVSFGVQVSP
FT                   GKLVLINNHFTLHSRDRFDPQYDENDRAFRWVQRVFVARSLWNFRAFTPLQARVFDPKA
FT                   LYAGESVQARQPSPVVQPAPQRAAAVELEATPA"
FT   gene            9720..11171
FT                   /locus_tag="Bcen2424_5878"
FT   CDS_pept        9720..11171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5878"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5514 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5878"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12611"
FT                   /protein_id="ABK12611.1"
FT                   /translation="MSDRAPTLDRIDRGDHMPTAAADSRRTSLRAIFPTVAAASLGFAI
FT                   VQLDVTVVNVAIPSLGHAFGSSIHGLQWIVDAYTLSFAALLLTSGTLADRFGSRRLFAY
FT                   GLALFLLASLGCALAPSLVTLVAARVAQGVGAAMILPTSLALITHACANDAAARVRAVA
FT                   WWSATGGAISAAGPTLGGLLIDSLGWRAIFFINLPICALGLWLTLRHVRDSAAARTRLF
FT                   DPAGQFVAVLVLGLLTGGIIRAGAHGLGDPYAAGALIASAVLGVLFVAIERRVAAPMLQ
FT                   LALFRLPRVPGVLAIGAVTNAAFYGLIFSLSVYFQNACGFTATESGLALAPLTIIMLAN
FT                   IASARLAVRYGFRATVIIGLAVSLAGYVWLWQTLAAHTPYLLLAPGLAAMAIGGGIAIP
FT                   ALTSTMLGSVEAGRSGTASAILNTARQVGAAIGVAALGALVAGQGAAIVAGAARAFVIA
FT                   AVLVAICVVLAVRWPRDASATGTRA"
FT   gene            11224..12492
FT                   /locus_tag="Bcen2424_5879"
FT   CDS_pept        11224..12492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5879"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; protein
FT                   of unknown function DUF201; KEGG: bcn:Bcen_5515
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5879"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12612"
FT                   /protein_id="ABK12612.1"
FT                   /translation="MQHRFIDTVLIVDGASTAAYLAPAFRAYGIRCAHVISDPDLPEIY
FT                   RNQFVPSDYIRQVQHRGDIDATLAQLSDLRIGAVLHGLDAALELADTLAERLDVPSRNP
FT                   LATSAARRDKFAMNERIRQAGLRAPAHFHSTSVDEALDWARAHGTLPLVVKPARSAGVA
FT                   GVKICRTLAQVEAAARDVLATRSLYNQPNDDIVIQSYSEGQEYIVDSVSFEGRHRVVSL
FT                   WEVHRDRTHAPRLDKMLVLNHADPRYAPLLDYAANVLDALDVRFGPTHLELFDTADGPT
FT                   IVELNARLHGSLDPRLTSAVSGENHVSAAVEAVLHPERLFGDVTAPTDFRGYCGHVLLL
FT                   SSRNGVLRQDFTWQAIQALPSFVGLKQWIKVGDTLRVTTDLQTALGTVGLYSPTFERLL
FT                   EDCRRIREIEADFFADEGAVAPA"
FT   gene            complement(12501..13376)
FT                   /locus_tag="Bcen2424_5880"
FT   CDS_pept        complement(12501..13376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5880"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5516 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5880"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12613"
FT                   /protein_id="ABK12613.1"
FT                   /translation="MNIPLLETFRAVVQEGSALRAAERLGCTQSNVTARLRQLEESLDA
FT                   PLFDRHGKRLVLNDAGRRLIPYCDRILRLVDEATQVVRETPVARSFRLGSMESTAATRL
FT                   PALAAALKERDPALGLAVQIGSEPDLAEALLRGRIDAALTARAVVRPGLRYEPAFAEDM
FT                   VLVSAATVTRRQLLADNTVRLLAFHDGCPYRAVAEHWLKARGIAIESVSSFGTFGAILG
FT                   CVAAGMGVAILPKRITTEHVARKEVRTHAFDDLDSVTTYLVTPDEAPALPELDALRAVL
FT                   GRQAGALLAR"
FT   gene            13524..14468
FT                   /locus_tag="Bcen2424_5881"
FT   CDS_pept        13524..14468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5881"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5881"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12614"
FT                   /protein_id="ABK12614.1"
FT                   /translation="MRALIAALVRRGPTVLACGVGLGLLVPPLAALARPLMPVTVFVFV
FT                   LGTLLRVEPSAVRAVARRPAVSLLLPAMTMIACPVALGIAARLAGLPYDWVVALVIAYC
FT                   APPSSGTSTIARMLSLDASVALVATLASMVFVPLTAPLLTAWFSHDAAVSISPSSLALR
FT                   LALLIGSAEGVALLVRRFAGARLARHATPIDAVVVVALLIFALGTMAGMQQSIIDAPHR
FT                   ALTAIALAFVVNAGFQLVAYGLTPGDVRTRLNVALIVANRNVGLMWAALGLAATPTMTL
FT                   VFACAQLPIYTLPRVVQHLLPRLEAQRLRRRAR"
FT   sig_peptide     13524..13625
FT                   /locus_tag="Bcen2424_5881"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.945 at
FT                   residue 34"
FT   gene            14506..15717
FT                   /locus_tag="Bcen2424_5882"
FT   CDS_pept        14506..15717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5882"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; protein
FT                   of unknown function DUF201; KEGG: bcn:Bcen_5518
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5882"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12615"
FT                   /protein_id="ABK12615.1"
FT                   /translation="MKRLIVIGARATGSSVALVRAAVARRVAVTVITTPGHRLDGVFPD
FT                   DVETVNLTPDAGQLAGWLRARFPDELDTLRVTTAHDTYARTAAWVADALGLPGPDARHV
FT                   AYAVSKSNQKALLAEHGIPAAQFVAGTLAAPAALAAAAAPLRFPVVVKPSEGSASDGVR
FT                   RCEDIAAVRAQLDTLAAAAQADAPELATERVVIEEFLAGSEYCVEYFDGRYVGALRKLK
FT                   RHGAGFLERGYTSELDLDADTLRALIDVGTRATAAAGLTWGPVHLDCIVHDGVPHVIEL
FT                   NPRIAGSFICDIVRDGYGFNVVEALLDKLDGKAVTIPELFEPHAYARAEFLLDSDPGAW
FT                   RFARGGEIDDGAVRISYGPQVLPDRERRAFLYVRVALPAAHGAADDAGPAAERRELKST
FT                   TESA"
FT   sig_peptide     14506..14571
FT                   /locus_tag="Bcen2424_5882"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.694 at
FT                   residue 22"
FT   gene            complement(15701..16897)
FT                   /locus_tag="Bcen2424_5883"
FT   CDS_pept        complement(15701..16897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5883"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5519 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5883"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12616"
FT                   /protein_id="ABK12616.1"
FT                   /translation="MGNRTIRFAFFLCGFAAFLNLYSTQGILHELAAAFNVSAERAGQG
FT                   ISATTLAVAIIAPFVGALAARFDRRTVISWAAVACVLPVVWSAHAASFSSFLAARFAAG
FT                   MLMPFIFAISIACIGEIFSHDAATEVSALFVAGTTLGGFAGRFVTNVLTSGFGWRHALD
FT                   FIAFLCLATGLAIHACLPSSGAARPEGEGASIPRWKLLTRGPLLASFLVGACVLASQVA
FT                   TFTFVGLRLARAPFGFNTVEIGAIYAVFLVAVVVTPLAGRVAAKRGPRDLALAATGLAM
FT                   VGALLTLSGSVAAILTGLALSSTAVFVEQASANAFISRAAPGARSTAIGVYLSFYYFGG
FT                   SLGSILPVPAWNRWGWVGCVAFVVVAQAIAGALVFFFWRGTPPAGASKPRSPEVRLTR"
FT   sig_peptide     complement(16826..16897)
FT                   /locus_tag="Bcen2424_5883"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.600 at
FT                   residue 24"
FT   gene            16993..17883
FT                   /locus_tag="Bcen2424_5884"
FT   CDS_pept        16993..17883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5884"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5520 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5884"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12617"
FT                   /protein_id="ABK12617.1"
FT                   /translation="MLDLRRLRYFVTVAEELHFGRAALRLRIAQPPLTRHIAALEADLD
FT                   IRLFERSTRAVQLTPAGALFLEHARSVIHAVDEAEATARKMAQGMVGRVVIGYASSIPM
FT                   SDAFSDIIRNASRSMPEVELAFREVSTATQRQQIANGTMDVGFGWSAKAPGERIRSLVV
FT                   SRESLVAAVPARSKYADKATIEFRELVKENFVTFPAGYGSALNAALEDLCAQEGVTPRT
FT                   RPTASQITTLVSLVAAERGVAIVPGFTSTLQRSGVAYVPLARPHVLELVVTWSEPFSSS
FT                   CVEQFIEFARSITRG"
FT   gene            complement(17950..18564)
FT                   /locus_tag="Bcen2424_5885"
FT   CDS_pept        complement(17950..18564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5885"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   bcn:Bcen_5521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5885"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12618"
FT                   /protein_id="ABK12618.1"
FT                   /translation="MPYELTTLSCPLLDQDRVSRRAHHWVSDADAHGRLLGAWRTEIGE
FT                   LSRVVVLRGFETMDALQHERDRALRAERPFGIESASVRLTMESYALFPFLPDIEPAALG
FT                   DFYEIRRYWLKAGGIAPTISAWERAVGPAKAYTSHLVCNLYALDGPPRITHIWGFSSLE
FT                   ERMALRKRHYAEGLWPPAGGPEQIERATSTIGLPETWSPLR"
FT   gene            18661..19581
FT                   /locus_tag="Bcen2424_5886"
FT   CDS_pept        18661..19581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5886"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5522 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5886"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12619"
FT                   /protein_id="ABK12619.1"
FT                   /translation="MDLLKAMAVFVRIVETGSLTAAAQASDLSPTMVGNYLQTLESRLG
FT                   AVLVHRTTRKQKVSAFGHAYYERCVEILGLVDDTEQLALAHLKQPRGRLRVTAPVVFTN
FT                   ECLIPALADYYRRYPEIKLDIVATDSLADLFDEGFEAAIRIGTLANPDVVARPLAPYRL
FT                   VLCASPAYVHEHGAPATPHALGEHHCLTYAYPPRAEWHAAQTQWTLEGPDGPMSLSVDG
FT                   RLKIDNADALRRAALRGLGIAMLPSILIRDDIREKRLIEIMPDFAGPERTMNLLYLQER
FT                   QQSPKLRSFTEFVVDRFGAETACRT"
FT   gene            complement(19765..19989)
FT                   /locus_tag="Bcen2424_5887"
FT   CDS_pept        complement(19765..19989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5887"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5887"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12620"
FT                   /protein_id="ABK12620.1"
FT                   /translation="MHNKRIQQYNGYAVQPSAHRLPDGSFSSNLLLERADSTHDEGRYQ
FT                   FYSLDYFTSEAQALAHSARWARNWVDSRG"
FT   gene            complement(20265..20468)
FT                   /locus_tag="Bcen2424_5888"
FT   CDS_pept        complement(20265..20468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5888"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bcn:Bcen_5524 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5888"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12621"
FT                   /protein_id="ABK12621.1"
FT                   /translation="MDTGIVKWFNDSKGFGFITPDKGGDDLFAHFSEIRADGFKTLAEN
FT                   QKVSFETKQGPKGLQAANIKPL"
FT   gene            complement(20776..21879)
FT                   /locus_tag="Bcen2424_5889"
FT   CDS_pept        complement(20776..21879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5889"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_5525
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5889"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12622"
FT                   /protein_id="ABK12622.1"
FT                   /translation="MIHGVNGLDVHILEAGHESAGRPLALLLHGFPDLAYGWRHLMPIL
FT                   ADAGYHVVAPDQRGYGRTTGWANDYDAPLGPFSLLNMTRDALGLVSALGYRHTSMLVGH
FT                   DLGSPVAAYCALARPDVFPSVVLMSAPFPGPPALPFDTARSETSSAQPNSEGRKLAAAL
FT                   AALDPPRAYYQQYLCTRNANRDMWHPPQGLSAFLRAFFHVKSADWPGNKPHPLKALTAS
FT                   ELAQMPTYYVMDLGKTMPETVAPFQPSAAEILACKWLTDAELGVYTAEYGRTGFQGALQ
FT                   AYRVLSDPDLNAELRLFSGRTIDVPSLFIGGKRDWGTYSAPGALDLMRTKAATSMRGIE
FT                   LIDGAGHWIQQEQPGKLGELLLAFAKA"
FT   gene            22087..22716
FT                   /locus_tag="Bcen2424_5890"
FT   CDS_pept        22087..22716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5890"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_5526
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5890"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12623"
FT                   /protein_id="ABK12623.1"
FT                   /translation="MAIAIDRSSGTWYFSRMTRKTDARARAIATAERLFRIQGYTATGL
FT                   TQILEESGAPKGSFYFHFPRGKAQLAEEAIDNYVTHRIAVLRNISADTTGHALNFVRQI
FT                   FSTFAAEMVATDFQYGCLMQNLANELPALDAELTQRVARGFADSTEVIAAHFRGCGFAA
FT                   ARASSAAAALVAALEGARTVARLERSPAVFDALADVSSQGWGASEG"
FT   gene            complement(23072..23992)
FT                   /locus_tag="Bcen2424_5891"
FT   CDS_pept        complement(23072..23992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5891"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5527 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5891"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12624"
FT                   /protein_id="ABK12624.1"
FT                   /translation="MDNNATMPADLPDLKLLQLFDLLYDVRSVTRVAEQLGQSQPTVSI
FT                   WLGHLREHLHDPLFIRTPGGMAPTPQADALIGPCREILESLRRFTAWEIAFDPATAQRR
FT                   FRICMTDASHVTLLPRLLAHVRAQAPGVRLEAARIDGNTERALESGEADLAIGYVPWLG
FT                   GGIYQQKLYDQDWICLVNRHHPRIRGRLGARQYRSEGHVAITAGTGAQLLEQALRQARI
FT                   ERDVVLELPGFLGLGAIVQTTDLITTLPRHIGETLAQANDLAVHACPIPVEGFAVRQHW
FT                   HARYHHEAGNRWLRGVVIRLFGASH"
FT   gene            24074..25024
FT                   /locus_tag="Bcen2424_5892"
FT   CDS_pept        24074..25024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5892"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bcn:Bcen_5528 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   6-phosphogluconate dehydrogenase, NAD-binding;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE, N-terminal
FT                   domain protein; Ketopantoate reductase ApbA/PanE,
FT                   C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5892"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12625"
FT                   /protein_id="ABK12625.1"
FT                   /translation="MKIAILGAGALGCAIGATLTEGGHETWLIDRSPAHVDAMRRDGLR
FT                   VDDARGTRQVRVHATTQAAEVGAADVVVVLVKSFHTDAAIRGALSLVGPDTVVLSLQNG
FT                   LGHEDILSDAVGRERVLAGKTYVGGVLRGPGHIESGVIGKNTYIGELDGRITPRVQAIA
FT                   AAFDTAGLATTISDNIVGTMWDKLLVNVATGALTGLTGLTYGQLYDEPLLKATSLAAVA
FT                   EAIAAAQAAGVKLSMTDPEQAWTLAAEGLPAAFKTSMLQSLEKGSITEIDFINGSVVRA
FT                   GQRHGVPTPVNATLVACIKGLERAMADRQREEAAA"
FT   sig_peptide     24074..24136
FT                   /locus_tag="Bcen2424_5892"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.444 at
FT                   residue 21"
FT   gene            25021..25413
FT                   /locus_tag="Bcen2424_5893"
FT   CDS_pept        25021..25413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5893"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bcn:Bcen_5529
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5893"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12626"
FT                   /protein_id="ABK12626.1"
FT                   /translation="MSATKAYLEHVAIWVKDIHWHIRFFEDVLGMTLREVDGPLDAPRQ
FT                   YWTLGGMQFIHAPDHNGPEGRLAHLGVMCEDLEAALAAARRFDVTEMPQGRNWIRLPDG
FT                   LAVELIQARPASCVAQALAINPRAEA"
FT   gene            25416..25874
FT                   /locus_tag="Bcen2424_5894"
FT   CDS_pept        25416..25874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5894"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bcn:Bcen_5530 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5894"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12627"
FT                   /protein_id="ABK12627.1"
FT                   /translation="MTIVEKYWDDAREGDTCTSPTYLVTKERILAYADLTGDHTPVHVD
FT                   EEYANASHFGCLVAHGLFGLSIADGLKTQSDYRFLPGMSLGWTWDFLLPIKVGDVLHVT
FT                   FRVGSMRASKSRPDWGIVVLPSELINQDGQVVQRGEHRLMVPRRPEAL"
FT   gene            25874..27094
FT                   /locus_tag="Bcen2424_5895"
FT   CDS_pept        25874..27094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5895"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bcn:Bcen_5531 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5895"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12628"
FT                   /protein_id="ABK12628.1"
FT                   /translation="MQARPLEGIRVVDYSHFLAGPYVGRCLAALGAEVIKVERPGAGDA
FT                   GRQHATVLDDQQSGYFLQLNMGKRGVSVNMKDARGKAFMQRLCDSADVFIENYRPGALD
FT                   KLGLGYEELSARNPGLVYCSISAYGHTGPDAHRAGFGLIAEAKSGIMQMVGTPGERPPL
FT                   LRISLGDMYTGIHAVAAINAALLGRVKSGRGQHVDMALYDTLVSMHEYAVQCYTLKGVL
FT                   PEQTGHDMPTSTLYGVFRAADGDLVIAAQVDDAWKRFAQLIEAHGGPAGFGADSRFHDS
FT                   TGRNAHRAAILSVVEPWVAARSVASVLDLLDGIDVPCAKVQRIDEVLNDPQIQARGMVV
FT                   EQQHPRYGTLRLPNLPFRFSDCDTTIREVAPDLGQHNAEVARSLGFDAAEIDAMQADGV
FT                   LYSKVSQ"
FT   gene            27091..27927
FT                   /locus_tag="Bcen2424_5896"
FT   CDS_pept        27091..27927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5896"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: bcn:Bcen_5532 shikimate 5-dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5896"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12629"
FT                   /protein_id="ABK12629.1"
FT                   /translation="MMTDQYAVIGNPIGHTKSPLIHGLFAQETQQDLRYTAIEGPLEPA
FT                   GAFAATVRAFFDGGGKGINVTAPFKLDAFAMSDERSERAQLAGAANALKFDGGRILADN
FT                   FDGIGLVRDIEANLNLPMAGKRVLVLGAGGAARGALLPFLDAGPAELVIANRDVDKARL
FT                   LAAQVAGRGPLVAGSYADLARMGRFDLVVNATSASLTGDLPPVPPSVFSPTGTAYELAY
FT                   GKRLTPFLRLAKNAGVHGIADGVGMLVEQAAEAFAWWRGVRPATSAVIDRLAVPFD"
FT   gene            28105..29337
FT                   /locus_tag="Bcen2424_5897"
FT   CDS_pept        28105..29337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5897"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5533 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5897"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12630"
FT                   /protein_id="ABK12630.1"
FT                   /translation="MPDTTRPARLNFALMLPLLLAAQPVATDSYLPALPEIAATLGSAS
FT                   VSLTVFALIFGVGQLPMGGLSDRIGRRPVLLTGLALYALSALAAALASSAAMLVAARAM
FT                   QGFAMAAILVCARATVRDRYSAGDGPYVMARGFMGMGMMAFLAPILGAYVTQHAGWRWV
FT                   LAGMSLYAFGLLVMCWYGFEESAARIAPGRNSTGDVREIFGNVPFRVWTLLAASTYTGM
FT                   FCFLLLSPTIYIRQLGISPQRYGWIPASGTLVYVLSTVGCRHLLRRQSMLRTVRQGATL
FT                   SLSGAVIQALGCALLPGSIWPLLVGHGVYCLGHGIHQPCGQAGAVSGLPHLAGRAVSWS
FT                   GFIMMFFAFSVGQTAAVFTDPRYQSGAWPMVVPMLGVGVTLVTIAFVWLPRIGGANLGA
FT                   AAVPARAVDGR"
FT   sig_peptide     28105..28188
FT                   /locus_tag="Bcen2424_5897"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.561 at
FT                   residue 28"
FT   gene            complement(29451..30278)
FT                   /locus_tag="Bcen2424_5898"
FT   CDS_pept        complement(29451..30278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5898"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bcn:Bcen_5534 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5898"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12631"
FT                   /protein_id="ABK12631.1"
FT                   /translation="MTSYAEIYLKDFHRRRAGVTRRAYGNRPARSAQAAYPSSYHALAN
FT                   RVPNDAMSRTVLDLACGDGPLLQILNDRGHAATKLIGIDMSDGELSVARGILPHEIRLL
FT                   NERAQAMSLDSGSVDYVLSHMALMLMDDIEQVVREIRRVLCDGGSFSAIVGRSFLTGKV
FT                   GEVFLDIFKPIAKDRLTELRLGDARTRSEAGWQELLKPDFVDVSFEDIEIDWTPTPEQL
FT                   WLDMLDTYDADRMSEAARAQFKSELLSAFAPLQGEDGTLQTGWGLRLVQATAA"
FT   gene            complement(30565..31467)
FT                   /locus_tag="Bcen2424_5899"
FT   CDS_pept        complement(30565..31467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5899"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   bcn:Bcen_5535 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5899"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12632"
FT                   /protein_id="ABK12632.1"
FT                   /translation="MKQQIGLIGVGLMGHGIARNVLKHGYPLTVVEHPGNQPLDELLRD
FT                   GVRTVRTARELAAQADVIILCVTGSPEVEAVLTGDDGVLAGLRDNAIVVDCSTAVPEST
FT                   VRMARLVEAAGGRFVDAPMTRGAKEAHEGRLNLLVGAPPGLFAEIRPVLACFAENITCV
FT                   GDVGAGHSMKLLHNYVSLGTIALLSEAVACAKRSGVDVAVLADVLANGGGGGAALNRLR
FT                   PFLETGDTSALPFHMANALKDLSYYSAMAEGVDAAHGIAAAVTETYRDAVAGAGAHCPV
FT                   LKLSDVLMVGGVGDEGTSR"
FT   gene            complement(31525..32853)
FT                   /locus_tag="Bcen2424_5900"
FT   CDS_pept        complement(31525..32853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5900"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5536 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5900"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12633"
FT                   /protein_id="ABK12633.1"
FT                   /translation="MEIDAACNPGDLAAPASAHDLAQEDRIFRRLAVQILPILMFAYVT
FT                   SYIDRVNVSFAKLQMSEHLGFSDAVFGFGAGIFFLGYVIFEVPSNMLLVRVGPRRWITR
FT                   IVVSWGVVSGLTAFVSTPMQFYVMRFLLGVAEAGFIPAIVLYMARSFPGRRRARILSMF
FT                   YAALALAGLIGSPLTGFILQYFDGAMQIPGWKWIFILESLPAFVAALYVWKGLDDDVTR
FT                   SERFSQAERAVLARVLAEDRATTESVNHRGLFSNWLVWAFCVIYFLDVFAIYGYTFWAP
FT                   TMIKQMGIGSDFVIGLLAALPNAVAVVVMVLFGRSADRCGRQRLHVAALLLMGATGLGL
FT                   SVVWHDQLWLGMFALCIANAGLISFPPLFWSMPTAALGTASVSMGIAVISSFGNLGGFF
FT                   GPYAVGYLKQASGSLAAPLFVMVGCLLLGIVLTMLLPARLVDR"
FT   gene            complement(32870..33181)
FT                   /locus_tag="Bcen2424_5901"
FT   CDS_pept        complement(32870..33181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5901"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5901"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12634"
FT                   /protein_id="ABK12634.1"
FT                   /translation="MVLTLTRSDRPRMVRRTPQRRRRAAKARAVRAIGGRNPFSVGLCI
FT                   APYDGGPRVRSRYSKCHLKDFAYRVGGAAGRFEPSPVAHIYIDSDCTRDDASMHAGHP"
FT   gene            33249..34169
FT                   /locus_tag="Bcen2424_5902"
FT   CDS_pept        33249..34169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5902"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5537 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5902"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12635"
FT                   /protein_id="ABK12635.1"
FT                   /translation="MFDLTSLALFVRAAELGSLSRAAQQSHMSLSTASRRIALLEHHFR
FT                   VVLLNRTVAGVELTPAGEALLRHATDLLLRTDAIYSELSDYTKGAVGRVRVFANISAIS
FT                   QDLPDQLRTFSQRYRDIKLQISELRSSDILQALREGRADVGIVTSRTAPEGIHLAPYCM
FT                   DRASVVVPDDYPLTGDSIDFSALLDHDLVALDDRSELTRALVREAALLGKSVRFRVQVQ
FT                   SFEAMCRLIAAGQGIGILPERAVALFREPMRLRFIRLNDPWANRVMSVGIRAGAVPLPT
FT                   RKLFEFLASFAPPSLVSGEAGQSND"
FT   gene            34472..35575
FT                   /locus_tag="Bcen2424_5903"
FT   CDS_pept        34472..35575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5903"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="KEGG: bcn:Bcen_5538 tartrate dehydrogenase; TIGRFAM:
FT                   tartrate dehydrogenase; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5903"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12636"
FT                   /protein_id="ABK12636.1"
FT                   /translation="MKNPHRIAVIAGDGIGKEVMPEGLRVLRAAAARFDIPLAFDEFGD
FT                   WCTDHYVRHGTMMPADWARQIGAHDAIFFGAVGAPDIVPDHVAVWESLIKIRREFDQYV
FT                   NLRPVRLMPGVPAPLAGRQPGDIDFIVVRENTEGEYSSVGGRMFTGTDREIAVQQSVFS
FT                   RVGVDRVLRFAFELARSRPRKQLTAATKSNGISITMPFWDERLAEMARSFPDIETRKYH
FT                   IDILCAHFVQNPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPERRFPSLFEP
FT                   VHGSAPDIAGRGIANPIGQIWSAALLLQHLGRGESRYEAAAAEIVAAIESVLIAGPRTR
FT                   DMGGTASTEELGAAIAHTIANPASIEE"
FT   gene            35579..37027
FT                   /locus_tag="Bcen2424_5904"
FT   CDS_pept        35579..37027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5904"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_5539
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5904"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12637"
FT                   /protein_id="ABK12637.1"
FT                   /translation="MQFDHYIGNARVVPNTGERIDVVDPSTGEPFATIARGDATDVQRA
FT                   VSAAQRAMGDTLDGPWAKLSPVERSNLLFAYAAAVSQHADELAQLEARDTGKALNTART
FT                   DAAVLARYLQYYAGCVDKLHGDTLPYTAGFTVLTVREPIGVTGHIIPWNYPMQIYGRSV
FT                   GASLAAGNACVVKPAEDASLSILRLAEIAAEVGFPAGTVNVVTGLGGEAGAALSAHPGI
FT                   RHISFTGSTGTGALVGRAAAERHCPAVLELGGKSPQLLFDDADLDQALPVIVNAIVQNA
FT                   GQTCSAGSRLLVQRTVYERVLDRLAQQFERLRSGPPSMNLEMGPLVNAKQHARVRAIVE
FT                   RAQADGIRVAARGTIAAGASGAGYYQEAVLFRDVPPDSELAQEEVFGPVLAAMPFDDED
FT                   AAVALANGTQYGLVAGVWTRDGARALRLARKLQAGQVFINNYGAGGGVELPFGGVKASG
FT                   YGREKGFEALLGFTALKTIAIRHD"
FT   gene            complement(37307..38245)
FT                   /locus_tag="Bcen2424_5905"
FT   CDS_pept        complement(37307..38245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5905"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: bcn:Bcen_5540 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5905"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12638"
FT                   /protein_id="ABK12638.1"
FT                   /translation="MKSTPGSILDTIGNTSLVPLRHVVPKNGARLFVKLESQNPTGSMK
FT                   DRIALAMIEAPERDGRLKPGGAVVEYTGGSTGVSLALVCAVKRHPLHLVSSDAFSKEKL
FT                   DHMRLLGAELTLVPSDNGKQTGKLTKDMIREAHRIAGETGAYITAQMENTDQLDAYTKM
FT                   ADEIWEQTGGRLDGFVQSVGTAASLRGISRRLREHDARIRIAGVEPAESAVLSGGSTGA
FT                   HKIDGIGAGYVVPLWRDGIADELERVSTEDARAMAFRLAAEEGLFCGTSTGANVTGALR
FT                   LAERLGPDATIVTIMCDTGMKYLKSFAQTMG"
FT   gene            complement(38292..38699)
FT                   /locus_tag="Bcen2424_5906"
FT   CDS_pept        complement(38292..38699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5906"
FT                   /product="membrane-associated proteins in eicosanoid and
FT                   glutathione metabolism (MAPEG)"
FT                   /note="PFAM: membrane-associated proteins in eicosanoid and
FT                   glutathione metabolism (MAPEG); KEGG: bcn:Bcen_5541
FT                   membrane-associated proteins in eicosanoid and glutathione
FT                   metabolism (MAPEG)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5906"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12639"
FT                   /protein_id="ABK12639.1"
FT                   /translation="MTFSPELHLLTLTAIATLLMWIPYMLARIMTRGLMAALSNPDPSH
FT                   PPDPPWAERARRAHANAIENLAVFAPLVLMCAMTGASSPATVFSARLYLGARLVHYVVY
FT                   AAGIPVVRTIAFLTGFAATLTFAVALLGHAT"
FT   gene            complement(38922..39788)
FT                   /locus_tag="Bcen2424_5907"
FT   CDS_pept        complement(38922..39788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5907"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: bcn:Bcen_5542
FT                   NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5907"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12640"
FT                   /protein_id="ABK12640.1"
FT                   /translation="MYAITGITGKVGGALARELLASGRPVRAVVRDATRAAAWAARGCE
FT                   IATAFMEAPALLADAFAGATGVFILLPPVFDPAPGFPEARKVIEAVSAALLKARPDRVV
FT                   CLSTIGAQADEPNLLTQLALMEQALREMPMPVTFLRPGWFMENAAWDVASARDEGVVAS
FT                   YLQPLDKPVPMVATADVGRVAAQLLQQTWHGVRVVELEGPCRVSPNDLALAFARVLGRD
FT                   VRAEAVDRRTWEALFRAQGMKHPLPRMRMLDGFNEGWIDFESDPEEILHGHVALDTVLG
FT                   ELVSRTV"
FT   gene            39999..40919
FT                   /locus_tag="Bcen2424_5908"
FT   CDS_pept        39999..40919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5908"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5543 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5908"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12641"
FT                   /protein_id="ABK12641.1"
FT                   /translation="MRSSSEKLSGSISVFAAVVDAGTFSAAADVIGMTPPGVSRAIARL
FT                   EKRLNIRLFNRTTRSVSLTEEGRRFYEQVMPHLAGLEEAAAAAAGGASAVRGKLRINLD
FT                   PVVYRAILGPRLDAFMDAHPELEIELIARDSLGDLVMDGFDLAVRFGEPRASSLIARKL
FT                   LDTGVVTVAAPSYIARRGRPAKPEDLEDRHHRCLEFRNPETGKPFAWEFHRKRKRIVVD
FT                   TRGRLTVNDPGALLNACLAGSGIAQMLLLGAEPLIADGRLINLFPEWADERYPLYAYYP
FT                   SRHHVPAKTRAFLDFIRICSEKPRH"
FT   sig_peptide     39999..40085
FT                   /locus_tag="Bcen2424_5908"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.569 at
FT                   residue 29"
FT   gene            40981..42033
FT                   /locus_tag="Bcen2424_5909"
FT   CDS_pept        40981..42033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5909"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB; KEGG: bcn:Bcen_5544 transposase,
FT                   IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5909"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12642"
FT                   /protein_id="ABK12642.1"
FT                   /translation="MILVYRYRVKSLNGLLNKQSRAVNYVWNFCNDTQKHALKWSKKWP
FT                   TGFNLNVLATGSSKELGIHSGTVNATCEQYAKSRSQRRRPYLRYRGRKSLGWVPLKGRD
FT                   LKREGDAFRFAGNTFRVFNSRPLPEGKIKDGTNFAQDARGNWFLNIVIEMPDVQARPIR
FT                   SGVGIDLGLKDFATLSTGEKLPNDQFGRRAAEKLAKAQRARKHKRHIAKLHAKVANARA
FT                   DFQHKLALDLVRRFDYIAVGNVSAVKLARTRMAKSVYDASWSSFRNKLRYKAVAHGATF
FT                   EEVDESGSTQSCSSCGSKDSSTRPKGIAGLRVREWACSDCGAEHDRDINAALNILRCGR
FT                   ASPGVGIRRL"
FT   gene            complement(42103..43065)
FT                   /locus_tag="Bcen2424_5910"
FT   CDS_pept        complement(42103..43065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5910"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; SMART:
FT                   helix-turn-helix- domain containing protein, AraC type;
FT                   KEGG: bcn:Bcen_5545 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5910"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12643"
FT                   /protein_id="ABK12643.1"
FT                   /translation="MRLTILALEGLFDTGLTVLLDTFAMANELAAAQGFAAPPFDVTVA
FT                   GVRKRVRTAHGLSMLVEPASSVRRPDWVAVPAPGIREPERLIETLQRRDVCDAMAHLRA
FT                   WHADGVGVAAACIGTFLLAEAGLLDHREATTTWSLSPFFRQRYPAVDLNDSRMVVAADR
FT                   VVTAGSAMGHLDLALWLLRQASPELATLVARFMLIDKRSSQAEYIIPDYLAHADPLIAR
FT                   FERWAREHLSLGFSLQTAAAALAVGPRTLQRRTEAVLGKSPLAFFQDLRIERAQNLVSM
FT                   GYDLETIASEVGYADSATLRALLRRRLGRGVRELRADNR"
FT   gene            43218..44141
FT                   /locus_tag="Bcen2424_5911"
FT   CDS_pept        43218..44141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5911"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: bcn:Bcen_5546 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5911"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12644"
FT                   /protein_id="ABK12644.1"
FT                   /translation="MRLRSSNLIGWETLNMSRTILITGASSGFGRDTAETLSRAGHRVF
FT                   ASMRDVAGRNRPHADALRASGVQVVELDVTDDASVERGVASVLEHAGRLDVLINNAGIG
FT                   SAGVSEAFTTKQVQALFDVNVFGIQRMSRAVLPTFRKQGEGLIVNVGSILGRVTFPFFG
FT                   LYGASKFAIEALTDSYRYELSTLGIDVVLVQPSNYPTNIFGSAQRPADAARVPGYGEAG
FT                   AIPDKMVETLMTLFASDHAPDPHDVAEAIAQLVEQAPGTRPARWVVGQSFGADALNAQA
FT                   AAIQAQTLESLGLAHLAGPQGQSAAA"
FT   gene            complement(44309..45049)
FT                   /locus_tag="Bcen2424_5912"
FT   CDS_pept        complement(44309..45049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5912"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bcn:Bcen_5547 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5912"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12645"
FT                   /protein_id="ABK12645.1"
FT                   /translation="MSHDIEPTTTQQDTIYATLRQWVTVGRFLPGERLKIRNVAAEMGV
FT                   GQMPVRAALQRLAAEGALVNVPNAGTIVPRLTVPEFDDLLQMRMLLEGEAAERGCLRLE
FT                   PAELATLRKLCQRMAKALKHPADQPARARKSAGDKPTLKQPAVSLKADQATDYLAANED
FT                   FHVLLYKAAGSPLLFELIDTLWLKAGPISNRLFDTSEASAVLNDAHEDLMDALDRRDAA
FT                   AARRAVERDIFVAGQFLRSTLKRD"
FT   gene            complement(45046..46428)
FT                   /locus_tag="Bcen2424_5913"
FT   CDS_pept        complement(45046..46428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5913"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bcn:Bcen_5548 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5913"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12646"
FT                   /protein_id="ABK12646.1"
FT                   /translation="MNHTLPHTGIEHERVQALLAHERAEYAQRNPKSQVMSARAAPQLM
FT                   FGVPLHWMNDWSTPFALHVAQAQGAQLTDVDGHTLADFCLGDTGAMFGHSPAVVTEALA
FT                   TQARQGLTTMLPNEDASVVGELLARHFGLPKWQFAMTASDANRFLLRWVRAATGRRTLL
FT                   VFNGCYHGTVDDVFVDLVDGQPTQRASLLGQVHDLTITTRVVEFNDLAALEAALAPGDV
FT                   ACVLAEPVMTNIGMVLPEPGYWAQAQDLIRRHGSLLVLDETHTLSSGPGGYACAHGLQP
FT                   DAVVVGKALGGGMPCAAYGFSAALAERAEAAKRTAPPGHSGIGTTLTANLLAMAAMRAT
FT                   LTHLMTPEVFAPMHALAEQLAAGLRTIIARHGLPWCVTQVGARVEFQFCPQPPRNGSQA
FT                   EAVMDAELEHALHLALLNRGVLITPFHNMMLVCPDTTRMHVQRLLAAFDTVLASLTAAA
FT                   DS"
FT   gene            complement(46439..47773)
FT                   /locus_tag="Bcen2424_5914"
FT   CDS_pept        complement(46439..47773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5914"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   bcn:Bcen_5549 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5914"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12647"
FT                   /protein_id="ABK12647.1"
FT                   /translation="MNDALSDFLTRHRIREVECVIPDMTGIARGKILPRDLFTASGEMR
FT                   IPKSVLLNTVNGQQPDNSPFVGDTDPDMVCKPDAATVRIVPWAAEPVAVVIHDCLEWDG
FT                   QPVQLSPRAVLRRVLALYEARGWQPVVAPEMEFYLVARNQNPHEPLQPPLGRTGKPEVG
FT                   RQSYSIDAVNDFDPFFMELSAFCDQHQLGVETLIHEAGPGQMEINFSHGEPLDLADRVF
FT                   LFKRTVRETALRHGVFATFMAKPMEGEPGSAMHIHQSINDGEGRNIFSNTDGTASEHFH
FT                   HFIGGLQTYIPQVMPMLAPYVNSYRRLAPYMSAPINVRWGQDNRTCGIRVPKSGPGARR
FT                   VENRVPGVDANPYLAMAATLACGYIGMRDRLHPSEPTEGSAWNVAHELPRHLENAIEAM
FT                   RACDAMKEVLGETFVDAFCAVKELEFSTYNRVISSWEREHLLLLV"
FT   gene            complement(47855..48202)
FT                   /locus_tag="Bcen2424_5915"
FT   CDS_pept        complement(47855..48202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5915"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5915"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12648"
FT                   /protein_id="ABK12648.1"
FT                   /translation="MCVVAVPPTVLGGEAAGGSTGGCRPEAAGSSISETDGQTTAPLGN
FT                   PTVGPFPDLGLGNQWPIKSNGRLCIQTGHLLFDAENGWRGSVSTTVPKGCSWTCDRRCS
FT                   RCRELSCSSLG"
FT   gene            complement(48274..49038)
FT                   /locus_tag="Bcen2424_5916"
FT   CDS_pept        complement(48274..49038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5916"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_5551
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5916"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12649"
FT                   /protein_id="ABK12649.1"
FT                   /translation="MARKLDNKIALVTGATSGIGLATAQRFAAEGAHVYLTGRRQAELD
FT                   AAVAGIREAGGTATGVRSDSTKLDELDALYAQIKEEQGRLDVLFVNAGGGSMLPLGSIT
FT                   EAHYDDTFDRNVKGVLFTVQKALPLLADGASVILTGSTAGSAGTAAFSVYSASKAAVRA
FT                   FARSWILDLKDRRIRVNTISPGATRTPGLLDLAGDDAGQRQGLADYLAAQIPMGRLGEP
FT                   GEIAGAALFLASDDASFVNGIELFVDGGQQQI"
FT   sig_peptide     complement(48952..49038)
FT                   /locus_tag="Bcen2424_5916"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.941 at
FT                   residue 29"
FT   gene            49180..50097
FT                   /locus_tag="Bcen2424_5917"
FT   CDS_pept        49180..50097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5917"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5552 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5917"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12650"
FT                   /protein_id="ABK12650.1"
FT                   /translation="MAHLPDFEGLAMFAKVAEHGSFAAAARSTGVSVATVSRGVARLED
FT                   RLGARLFNRTSRQLSLTEFGRTISEKAGEIYRQAEEAESSAREMSVQPRGLVRLAVPMS
FT                   FGLRWVAPLLPGFFRAYPEVSIDLHLSDASVDLIADGFDAALRIAALPDSSLVARRLCA
FT                   VTQFVVAAPEYLRREGRPTHPLELADRPCLPYAYRARSAVWRFTNDAGDEESVMPTGPL
FT                   RVTNADALLPTLLDGLAIAELPEFIAGEYLADGRLEAILPDWSLTTGGLYFVTPSARAR
FT                   PAKVTALSDYFAEHLGNPVWRWPK"
FT   gene            complement(50232..50576)
FT                   /locus_tag="Bcen2424_5918"
FT   CDS_pept        complement(50232..50576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5918"
FT                   /product="regulatory protein, LysR"
FT                   /note="KEGG: bcn:Bcen_5553 regulatory protein, LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5918"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12651"
FT                   /protein_id="ABK12651.1"
FT                   /translation="MGRHIQLVVTDNQPDAEKTQQGVASERQWWVDDLGAKHDLLRGSL
FT                   CWGRMPRHMVDADLAKGTLVELQRRAWHMRPLTFMVSQRRGYAFSGCETRLVELLGQCP
FT                   SHRVRRGKST"
FT   gene            complement(50634..51371)
FT                   /locus_tag="Bcen2424_5919"
FT   CDS_pept        complement(50634..51371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5919"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_5554 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5919"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12652"
FT                   /protein_id="ABK12652.1"
FT                   /translation="MKVTIAYIEEPPFGWTEADGTARGADLELAATILRQIGVTRVEYC
FT                   PTTFSELLPGVASGHWDMNVPLFVTPQRAHTVAFSVPVWGIEDGFLVRPGNPKALRRYA
FT                   SIAERPDARLGIIAGQVQHDSAMAAGVSRRQIVVFEQQADAIAAVLSGVIDAYASTALG
FT                   NRIVAGRIGSAMIEAVAHEPDGDGSQRTPPLGAFSFNRENRDLLTAFNRQLRAYVGSPD
FT                   HRARMARFGLTDREIDPAVSPTG"
FT   gene            complement(51588..52499)
FT                   /locus_tag="Bcen2424_5920"
FT   CDS_pept        complement(51588..52499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5920"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5555 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5920"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12653"
FT                   /protein_id="ABK12653.1"
FT                   /translation="MQNPQAVPDYLIQSDAVRERFARLKARDVILDVRHVGKRFTTPQG
FT                   ECVALDDISFRTHRREFVCVIGPSGCGKSTLIRILAGLDAQTSGDVLLDGKPVDGPGAD
FT                   RGMVFQGYTLFPWLTVKKNVMFGLRMNGSSSGVAEREALQWLDLVGLTRFADVYPHQLS
FT                   GGMKQRVAIARALANRPRILLMDEPFGALDAQTRARMQTHLLDIWRNIDVTILFITHDL
FT                   DEAIFLADRILVLKANPGGVQELIEVPVPRPRDYSQVNTPEFVATKARLEALIHPKEAA
FT                   TAEDDGIKPHMIRMTDVADNVE"
FT   gene            complement(52545..53519)
FT                   /locus_tag="Bcen2424_5921"
FT   CDS_pept        complement(52545..53519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5921"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_5556
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5921"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12654"
FT                   /protein_id="ABK12654.1"
FT                   /translation="MTTTRNTTGWLAVRRELTTRGKWTLALASFLLPFAVWCLISYVPF
FT                   VWHPQMRITNPGSVDYFQTGMQIDRDVFDDELAHARATHAAVPEGERANPVYLPAPHQV
FT                   LRAFYTAFTTPPASRDGVWLHESLWHSIRIIFWGFVISSAIGVPLGIVCGTFSALARLQ
FT                   EPFLEFFRYLPAPAFGALMVAILGIYDAPKIAIIVIGTLFQQVLIIANTTRKLEYGLFE
FT                   AAMTLGTKKLKLLTHVVIPGVLPDLYRDQRILLGWAWTYLIVAELVGTSSGITWYISQQ
FT                   ARYQHFDNVYAAILMIGIIGLGTDIVLGLLGRRLFPWDRTLKA"
FT   gene            complement(53583..55454)
FT                   /locus_tag="Bcen2424_5922"
FT   CDS_pept        complement(53583..55454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5922"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bxe:Bxe_B1385 putative UreA
FT                   amidolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5922"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12655"
FT                   /protein_id="ABK12655.1"
FT                   /translation="MSTTDRPVLPGLRSIAALRARYAAGDLTPHALVDAIAAHFDAGDP
FT                   HHAWIRPLTRDEMMSYADALAGRDIASLPLYGVPFAIKDNIDLAGIPTTAGCPAYAYTP
FT                   ARSAPVIERLIAAGAIPVGKTNLDQFATGLSGQRSPYGACRNALDSRYASGGSSSGSAV
FT                   AVALGVATFSLGTDTAGSGRVPAAFHGLVGLKPTRGVLSTLGVVPACRSLDCVSVFARS
FT                   ADDARTVFAAAHGVMDGDPYGRAWQPLLGADGLRVQPARPLAQLRFGTPRADQLEFFGD
FT                   ASYRAAWGAALERLRATGAQVVEIDFEPFLAAARLLYDGPWVAERLAAIGAFAAREPDA
FT                   LHPVIREIVGGASRFSAADAFAAFDRLAALRVDAARAWDGLDAIVMPTSATTATVDALE
FT                   ADPIAINSRFGYYTNFVNLLDLSAIAVPAGTCSTGPHAGLPFGITFVGRAHDDARLLDL
FT                   AQAWGDGAAAVDDVRPPAAAMSARAAAAGVVRVAVVGAHLRGEPLNGQLTQRGARFVTA
FT                   TTTAPAYRLYALSAEASGGVAKPGLVRVPNDGAPIAVEVWEMPVDAYGSFVAGIAAPLG
FT                   IGTLTLADGARVQGFLCESVALDDAQDITRFGGWRAYRAQAASGALQ"
FT   gene            complement(55451..59068)
FT                   /locus_tag="Bcen2424_5923"
FT   CDS_pept        complement(55451..59068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5923"
FT                   /product="Biotin carboxylation region"
FT                   /note="TIGRFAM: urea amidolyase related protein; Biotin
FT                   carboxylation region; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; Allophanate hydrolase subunit 2;
FT                   Allophanate hydrolase subunit 1; Carbamoyl-phosphate
FT                   synthase L chain, ATP-binding; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; biotin carboxylase
FT                   domain protein; KEGG: bcn:Bcen_5558 allophanate hydrolase
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5923"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12656"
FT                   /protein_id="ABK12656.1"
FT                   /translation="MRFAKVLVANRGEIACRVIRTLKRLGIASVAIYSDADRDARHVAL
FT                   ADEAVRVGPAPAADSYLNVAAILAAARETGAQAVHPGYGFLSEHAGFADACEAAGLRFI
FT                   GPRGDHMRAFGLKHTARELAAAHGVALLPGTGLLDDVATALAEADAIGYPVMLKSTAGG
FT                   GGIGMSLCRDAAQLGAAFESVVRLGAANFAHAGVYLEKFVEHARHIEVQIFGDGRGGAI
FT                   ALGERDCSVQRRNQKVIEETPAPDLSAAERDALHASAVRLARAVGYASAGTVEFVFDAS
FT                   TRQFYFLEVNTRLQVEHCVTEAVTGVDLVEWMILQAEGDLPPLDTLAVVPRGASIQVRL
FT                   YAEDPNKQFQPSAGLLTHVAFPDDVRVDGWIEAGTEISAHYDPLLAKLIVRGDTRRDAL
FT                   AALRAALDQTELYGIETNLDYLRAVVGSDTFARGAPTTAFLSRFAFAPHTIDVLDGGVQ
FT                   TTVQQAPGRVGYWSVGVPPSGPMDDRAFDLANALLGNARDAAGLEFTMVGATLRFNTAT
FT                   LFVLGGAPLAATLDGEAVPFWQVVRARPGAVLKLGGVTGAGVRACLAVKGGLQVPDYLG
FT                   SKATFTLGQFGGHAGRALRKGDVLHLHADAGRGDAGAMLAAAEIPALTHAWTLGVLDGP
FT                   HGAPDFFTPDDIAMLYGTQWTVHYNSSRTGVRLIGPKPQWARADGGEAGLHPSNIHDNA
FT                   YAIGAVDFTGDMPVILGPDGPSLGGFVCPVTVVRDELWKLGQLRPGDTVQFVRAGVSAG
FT                   VSTAAVVDATRDVAAAASGASASFDDCVLHRDPSAGGGIGVVYRRSGDRNVLVEYGPLV
FT                   LDLNLRFRVHALMGWLDAHRLPGMLDLTPGIRSLQVQFDARTLPLDALLAHLQAAEREL
FT                   ADVADLRVPNRIVHLPLSWDDPSTRVAIERYMQSVRPDAPWCPSNIEFIRRINGLASID
FT                   DVKRIVFDARYLVMGLGDVYLGAPVATPLDPRHRLVTTKYNPARTWTPENAVGIGGAYL
FT                   CVYGMEGPGGYQFVGRTVQMWNRHRTTREFEAGKPWLLRFFDEIRFYEVSEAELTALRA
FT                   DFIAGRATLKIEESVFDLRAYNRFLHDEAESIAAFKATQQAAFDAERERWRAAGHAEYV
FT                   GDAEPGDAQADRVAGALDDTQRAIAADVSGSVWKVLVDAGERVTEGQVVAIVESMKMEV
FT                   AVTATEDGTIETIDCAPGAAVVAGQRLMVMKAGAAEEVA"
FT   gene            complement(59157..59813)
FT                   /locus_tag="Bcen2424_5924"
FT   CDS_pept        complement(59157..59813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5924"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5924"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12657"
FT                   /protein_id="ABK12657.1"
FT                   /translation="MPIIESRLDPRDAIHDVTLSAGDPWLHDLKRGQTFRILDLEGNQA
FT                   VDTLFYRTDDPEERYSAQDTIRSQRNLYLSAGSVLMSSRGNPMATIVADTCGRHDTLGG
FT                   ACAAESNTVRYALDKRYMHNCRDSFLNAISHCTCGAGARLTKRDLVGNVNFFMNVPVTP
FT                   LGGLTFEDGISAPGKYVEMRAEMDVTVLISNCPQLNNPCNGYNPTPVRLMIWEAE"
FT   gene            complement(59825..60580)
FT                   /locus_tag="Bcen2424_5925"
FT   CDS_pept        complement(59825..60580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5925"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5925"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12658"
FT                   /protein_id="ABK12658.1"
FT                   /translation="MSPSPQAILAPPPHVAWETLIPAGTHWSGILRRGLALRIVDVDGG
FT                   ANLSAVFHRQEDLLERYNMADTLKAQHTAHLTRGHALYTDMGRVIASITADTLGWHDPL
FT                   GGVGDARLFAHKYGTSSYQADRNAMIRNGRDSLVLELAKYGLSARDLAANVNFFSKLDA
FT                   RDDGALEFVAGHSPAGSAFDLRFEMNTLAAFSTAPHPLDPRPDYAPKAVKLIAYRAYPA
FT                   DGAAPDDDPCRRACAENMRGFANTDRLFA"
FT   gene            60780..61046
FT                   /locus_tag="Bcen2424_5926"
FT   CDS_pept        60780..61046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5926"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5926"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12659"
FT                   /protein_id="ABK12659.1"
FT                   /translation="MLRTSRASNKRVACQPPLDDRTTRPGGAMPRDIRMTDAFACPRGG
FT                   RAAHHAHASAHRCSARRVLAHRPMRDGMGIAEPMHRHLISDPS"
FT   gene            61466..62488
FT                   /locus_tag="Bcen2424_5927"
FT   CDS_pept        61466..62488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5927"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /note="KEGG: bcn:Bcen_5562 ABC transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5927"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12660"
FT                   /protein_id="ABK12660.1"
FT                   /translation="MTRPAPALRHLPSFRFIRHALGAAVAAATLWAAPAVHAAAPLKIG
FT                   YSDWPGWVAFQVALDKGWFKEAGVDVDFEWFDYSASLDAFSAGKLDAVAATNGDALVTG
FT                   ASGAKNVMILLTDYSAGNDMIVAKPPLRTVEALKGKKIGVELGLVDHLLLETALQKHGL
FT                   KDGDVTLVNAKTNELPQVLGSSADIAAVAAWQPNAGEALKRAPGARAIFTSADAPGLIY
FT                   DAITVAPASLAARRADWAKVIKVWYRCVAYINDPKTQADAVKIMSARVGLAPAQYLPLL
FT                   KGTHLLDEAAAKRAFRKGDGLDSIYGSTRNANAFNVRNAVYKQSQDVDAYIDPRLVDAH
FT                   "
FT   sig_peptide     61466..61582
FT                   /locus_tag="Bcen2424_5927"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 39"
FT   gene            complement(62636..63355)
FT                   /locus_tag="Bcen2424_5928"
FT   CDS_pept        complement(62636..63355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5928"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bcn:Bcen_5563
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5928"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12661"
FT                   /protein_id="ABK12661.1"
FT                   /translation="MFSAAVDSLNRIRPEPDLVVISGDLTDEGTEDEYRKLRELLVELR
FT                   RPFVVLPGNHDDRGNLRAAFPDHAWLPDEGALSFALDVGELRLVALDTSVPGLHHGDLD
FT                   AETLAWLDTELAEHRNRTVVIVMHHPPFMTGIPYLDIYGLRNAEAFAAVLARHDNVDRI
FT                   LAGHVHRSMQTRLGRVPVLTCPSTTTQIALRVEADAQPASFLEPPAYMLHRWAGRGQPA
FT                   VSHLCYVGHFEGPFPFA"
FT   gene            complement(63639..64088)
FT                   /locus_tag="Bcen2424_5929"
FT   CDS_pept        complement(63639..64088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5929"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_5564 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5929"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12662"
FT                   /protein_id="ABK12662.1"
FT                   /translation="MRWFGTDPMTDIGEADKLIQVFADWRRSGSGVRWAVERLSDGHLL
FT                   GTCGLFRWNRNWRSCAVGYELATFARGKGYMNEALSAAIDYGFDTMQINRIEAQVHPQN
FT                   ASSIQVLETLGFVREGYQRQAGYWRGAYHDLLQFSLLRSDCLRRG"
FT   gene            complement(64481..65005)
FT                   /locus_tag="Bcen2424_5930"
FT   CDS_pept        complement(64481..65005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5930"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_5565 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5930"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12663"
FT                   /protein_id="ABK12663.1"
FT                   /translation="MLQCASPSSLPPPMSPSVDELLALDVLTLREHTERAGDAFDVDEH
FT                   RAKLCKSLEINELCYVRRDGKLVAYAMLRPEAGACWFVGAFGTHPLHRTYTVVNELFAK
FT                   IATLASERRIGELRSHVYKTNRLSIAFHRKLGFVVTRENEKGFEFSTTLDELATKPAVR
FT                   RATARATSRSD"
FT   gene            complement(65108..65539)
FT                   /locus_tag="Bcen2424_5931"
FT   CDS_pept        complement(65108..65539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5931"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bcn:Bcen_5566 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5931"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12664"
FT                   /protein_id="ABK12664.1"
FT                   /translation="MSRLRKKVGSDLILSPSVAAVIHDHEGKLLLQEKSSGEAWSLPAG
FT                   GVELGESPQEAIFREVMEETGYVIRIHGILGVFGGRLFRYTYPSGDRVEYVVTLFQCKI
FT                   IDGSGIPSDPETTSTRYFGRHDMPELALPYPKDDLFLPF"
FT   gene            65833..66114
FT                   /locus_tag="Bcen2424_5932"
FT   CDS_pept        65833..66114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5932"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5932"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12665"
FT                   /protein_id="ABK12665.1"
FT                   /translation="MEDQSGASSSSDPTSFPAERPSYSTSESRPAQTDDARARRQPNAL
FT                   SQHRHARQSDAERCHRVRHHRDETWGSARPTQPSRRRTVLADREQDKW"
FT   gene            complement(66426..66992)
FT                   /locus_tag="Bcen2424_5933"
FT   CDS_pept        complement(66426..66992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5933"
FT                   /product="protein of unknown function DUF925"
FT                   /note="PFAM: protein of unknown function DUF925; KEGG:
FT                   bcn:Bcen_5568 protein of unknown function DUF925"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5933"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12666"
FT                   /protein_id="ABK12666.1"
FT                   /translation="MNLNERLVEIARQSSWCMSALSAARAMGLKSWCIGAGAIRNLVWD
FT                   SLHGYVTPTRPADVDLAYFDPSDLSSIRDAEIQHSLTAQCPEIPWEVTNQAAVHLWFES
FT                   AFGHPVPPFSSLTQAVASWPEYATTVGLTLLGDGTIDVCAPYGLDDLFSMVVRRNPARV
FT                   SIDTYLRRIQQKRYKDRWPRVTIIV"
FT   gene            complement(67251..68213)
FT                   /locus_tag="Bcen2424_5934"
FT   CDS_pept        complement(67251..68213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5934"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5569 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5934"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12667"
FT                   /protein_id="ABK12667.1"
FT                   /translation="MATKLSFEVLEVLDAIDRTGTFAEAAELLHRVPSTLTYLVQKLES
FT                   DMDVELFDRSGRRTRLTEAGRAVVEDGRRLLDAARHLEAKAKGIRDSWESELRLCVDAI
FT                   LPIQSLWPYVHAFYDLEMNTQLSLSTEVLGGVWDALVTRRADLAIGAFGEPPHAANIAA
FT                   RPIGTLRHVFVVAPDHPLARIPEPLESETIAGYRGVVISDTSRELQRQSVATRDGQPLV
FT                   IVPTLAAKLQALCEGIAVGMLPDFVAKEPIHEGRLVARRIVGVREFTNGYLAWREDKVG
FT                   NALNWWIAQLDSTDLLERLLTPRQESKGQPGTATCAVRY"
FT   gene            69028..69261
FT                   /locus_tag="Bcen2424_5935"
FT   CDS_pept        69028..69261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5935"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5935"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12668"
FT                   /protein_id="ABK12668.1"
FT                   /translation="MNPEQARAEETQAMERMVAATLRVQSTFASMQKQFPPQGSGEPSP
FT                   FALQTFDAALQELEDAQAAFDALLNDLIDGNR"
FT   gene            complement(69400..70521)
FT                   /locus_tag="Bcen2424_5936"
FT   CDS_pept        complement(69400..70521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5936"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: reu:Reut_B4368 ATP-binding region,
FT                   ATPase-like:histidine kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5936"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12669"
FT                   /protein_id="ABK12669.1"
FT                   /translation="MRLADFIVRNMETILVQWEAFAATLLPAARHMNSQGLRDHAREIL
FT                   TAVAKDIATPQTREAQHEKSLGRAPEPANASETAAQTHAVLRARRGFNINQLAAEYRAL
FT                   RASVLRLWIDACQPGAPDMDDMIRFNEAIDQALAESVSFFTEQVEQARNLLLGMLSHDM
FT                   RTPLQTIQLTASYLAALNAGEEVSEAAARLIRSGGRMQGLLDDLCDFNRTQLGLGINVV
FT                   PRNIDLAHVLDNVVDELRAGHPDREITVDMRGDLRGEWDDQRMQQLLSNLVSNAIKYGA
FT                   RDTPVRVVATTTGDEVFVEVGNSGPAIDPRTLDRIFDPLERGEARQGRKGDDAGLGLGL
FT                   FIAREIAKAHRGRIDARSDQTETVFAVRLPRGV"
FT   gene            70767..72032
FT                   /locus_tag="Bcen2424_5937"
FT   CDS_pept        70767..72032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5937"
FT                   /product="poly(3-hydroxybutyrate) depolymerase-like
FT                   protein"
FT                   /note="KEGG: bcn:Bcen_5573 poly(3-hydroxybutyrate)
FT                   depolymerase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5937"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12670"
FT                   /protein_id="ABK12670.1"
FT                   /translation="MRVTPVPPGAAFRLPRHRQHEPCFAPVRLPSDGGVGRLFPSRPAA
FT                   GTKLHMPRKKSSLWLRHLELFSIATGARPKKRAGKPRPAAPKAAKKVVQRTIKPAVAAP
FT                   AAKRTGAAPAARAPSVEPPGTWLRSFHSAGPSAGRLVNHLAYALYLPAAPAKTAGMPAV
FT                   VMLHGCKQTAESFAAGTRICRLAERAGFAVLFPEQAKTTHAHRCWHWHGDATESEAAAV
FT                   ASLVDAIVRRHGFDRDRIYVAGLSAGAGLAAALALRYPDRFAAVGLHSGPAIAPPSSTM
FT                   AAMSLMRRGLRDDPVAALDACADVASYPGMPALVIHGALDTVVTDRNATQLGIAFARLN
FT                   RLVDEHGAIRIGEQRSYAQDDADYIDYLKGGRLVVRVCIVRRLPHAWSGGDPSEPFHSA
FT                   KGPDATAMFWHFFRRQRRKRLA"
FT   gene            complement(72080..73915)
FT                   /locus_tag="Bcen2424_5938"
FT   CDS_pept        complement(72080..73915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5938"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; MHYT domain protein; KEGG: bcn:Bcen_5574
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5938"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12671"
FT                   /protein_id="ABK12671.1"
FT                   /translation="MAAGRALAPAAAMHSTRCGRPIMHGIYNLPLVVLSLAIATLASYT
FT                   TLDLAAFISLLDDPKLKRAWLGGGAAAMGTGIWSMHFVGMLAFSLPVPLGYAWQETGAS
FT                   LAIAVLVSYFALNVVTRARLGWRRLCMGGVLMGGGIAGMHYTGMAAMHMQPGIRYDAAL
FT                   FAASIGIAVIASTAALWIAQALRMQQARHATAQRIGAAVIMGLAITGMHYTAMAAAHFA
FT                   PDARCGAANGVDAPWLATTVALFTMATLVVTLLVCRFDARTTFLRGMTDTLERLVRVRT
FT                   GELERALYSYEQTTRMLQRTRENMAAEIDERKAAHALLEQEKDEQRRLLHALEETHEQL
FT                   LQSEKLASIGQLAAGVAHEINNPIGFVSANLNTLKTWVRSLLDVVAAHEAALPQLDPAT
FT                   RDALTAVHRAVDLDYVRDEIAMLIDESIDGALRVRRIVQDLRDFSRPASDEWSVVDLHA
FT                   GLESTLNVVHNELKYKADIVRDYGDVPHVECLPSQLNQVFMNLLVNAAQAIPERGVITI
FT                   RTSSDGDQVSIAISDTGAGMTPDVVRRIFDPFFTTKPVGQGTGLGLSVSHGIVERHRGT
FT                   IDVTSEPGRGTTFRIRLPVRRAGDRASAAALEQRA"
FT   gene            complement(73933..75351)
FT                   /locus_tag="Bcen2424_5939"
FT   CDS_pept        complement(73933..75351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5939"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase, HD sub domain; KEGG: bcn:Bcen_5575
FT                   response regulator receiver modulated metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5939"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12672"
FT                   /protein_id="ABK12672.1"
FT                   /translation="MTTSATNGVNAVAPETSDTAAASASVEVPRVPSILLVDDEPNVVS
FT                   ALRRVFRPAGYDIVTADSGETALEILASTDIDLIVSDMRMPHMSGAEFLARARALYPDT
FT                   MRILLTGYAELASVVQAVNEGGVYRYLNKPWDDHDLLLTIEQALEQRRLRREAARLAAL
FT                   TEAQNEALRRFNTDLETQVRARTEELGQTVMFLEAAQSDLKSSFTAMVQVCASMIELRC
FT                   GAASGHAMRVGEIARRLALASGMSELHAQDVYFAGLLHGIGKLSLPDELLHKPLARMTT
FT                   DEHRVFQEHPLRAQMVLTPVAQLHKVASIVLHQYERFNGRGTPDGLVGDAIPIGSRIVA
FT                   IARDFEGLRHGEIGAPHSIEQAIDVLRSQASVRYDPQLVAGFIELMRDPASLGIAASVA
FT                   EIRSAQLREGMELADDLRTHRGVLLMTKGSVMSAHQIELVRRFETREGTPFDILVLAGP
FT                   AAQAHAPNAGVPPA"
FT   gene            complement(75473..75928)
FT                   /locus_tag="Bcen2424_5940"
FT   CDS_pept        complement(75473..75928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5940"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_5576 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5940"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12673"
FT                   /protein_id="ABK12673.1"
FT                   /translation="MTTTLTFLPVTQADADALVAIRIAAMRDSLERIGRFDPQRARDRF
FT                   LASFDPALCRFIEAGHSRAGFYTLRPMADHWLLDHLYIVPAHQGKGIGAAVLREIFAAA
FT                   DERRMPVRVGALRGSDSNRFYERHGFVRTDEAEWDIYYRREPGTAAT"
FT   gene            complement(76186..76590)
FT                   /locus_tag="Bcen2424_5941"
FT   CDS_pept        complement(76186..76590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5941"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5941"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12674"
FT                   /protein_id="ABK12674.1"
FT                   /translation="MMIGSESAAFFMLRLGTPHPSWAFTDDSNMLGIGDCDGVMSAMFE
FT                   LDRNQVARIRRLGQSVERIRCTCERAGRELHFYLHGRQVSQGVWVGVASADPDYLPTDE
FT                   MIATWEVPKPDDAFRSTGAGADLIASLSLA"
FT   sig_peptide     complement(76519..76590)
FT                   /locus_tag="Bcen2424_5941"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.898 at
FT                   residue 24"
FT   gene            complement(76761..77966)
FT                   /locus_tag="Bcen2424_5942"
FT   CDS_pept        complement(76761..77966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5942"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bcn:Bcen_5578 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5942"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12675"
FT                   /protein_id="ABK12675.1"
FT                   /translation="MQMLGGLVLGAACGVFAPGFAAKLGFLSAMFGHAIKMVVMPLIFL
FT                   SVTVGVFRAGRLRERLGKVALSSIGFFVLMTGLAASLGLLLNFAFRPGLGASMVQSGSM
FT                   PAALASSIDWTKFLVDLIPANIVAALAAGNSLPVLVFGVIFGAALAAAPERAEPAIAVF
FT                   EALLSGLFKMVQWVIAWSPLAIFAAIAQLLSAKGFTGAHSLVELLGVAYLGMAILAVVL
FT                   TIVIRVAGQSPLAVLRKVKEPLILGFTTRSSEITYPLHLKKLVELGVPYGVASTILPLA
FT                   YIFNRDGAVLYTALAVGYLADAYHLVWSWPLVITILILTIITIDGAANVPSGAIVAITI
FT                   VLTSIGLPADAVLLLLGVDAFFDMGRTALNVYGSTAAAAVAVRLSGSDSIAAETVPRQA
FT                   SV"
FT   sig_peptide     complement(77901..77966)
FT                   /locus_tag="Bcen2424_5942"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.961 at
FT                   residue 22"
FT   gene            complement(77983..78645)
FT                   /locus_tag="Bcen2424_5943"
FT   CDS_pept        complement(77983..78645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5943"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bcn:Bcen_5579 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5943"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12676"
FT                   /protein_id="ABK12676.1"
FT                   /translation="MTSKVSTDAELAYEEIRARIFDGRFAPGQKVSHRGLSDELGFGQM
FT                   PVRSALHLLESEGLVVVIEKSGTYVASPTTSDLREIFEMRLALESTAAFLAARSGVTAG
FT                   LRDAAAKMQELLDRDVADIMLEQRIGWVFHQELFAAARNVRISSAYGLLRAQTLALNEL
FT                   PRGDAETVRRGTIEHLHIFHAIEANDGELARQHMWNHIVDGTPARIKLLKARHEHEK"
FT   gene            78796..79260
FT                   /locus_tag="Bcen2424_5944"
FT   CDS_pept        78796..79260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5944"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_5580 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5944"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12677"
FT                   /protein_id="ABK12677.1"
FT                   /translation="MTSQGVRFTICAVRAEETYPLRAAILMAGDEEGSALHGDHAPTTL
FT                   HFAVRDNDTIVAVASVCKEGQSGVPNAEAWRLRGMAVHPSVRGLGFGRLLVNLSIRHVR
FT                   EQRGTLLWCTARESAYQFYEMLGFNRDPIPISLHGRDDMKFYLMQRPIEC"
FT   gene            79306..79617
FT                   /locus_tag="Bcen2424_5945"
FT   CDS_pept        79306..79617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5945"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5945"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12678"
FT                   /protein_id="ABK12678.1"
FT                   /translation="MSRSWLPARKTRSTGARLSRFARAKIEIACGAFSPQKNHPKLSAA
FT                   VSHAESAYDLYGHALINRAFHFDYRNPKANGTVTTGTAGLLLAMAVPCSRLSSPHDPT"
FT   gene            80029..81195
FT                   /locus_tag="Bcen2424_5946"
FT   CDS_pept        80029..81195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5946"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_5582
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5946"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12679"
FT                   /protein_id="ABK12679.1"
FT                   /translation="MKNKKINISVIAVAAFAASSAAMAQSSVTLYGMLDAGIGYTSNIN
FT                   GHSRFGLDGGAAGSNKWGLRGQEDLGGGLQAVFKIENGFNIATGGIGGQGPIGTTRSLF
FT                   NRQAYVGLASSQYGALRMGRQLDAVTEMVQVLTGDAISASTFSTPGDVDNNDNTTNQNN
FT                   AVKYISPIIHGFQAEAAYSFGGVAGSTGSGQSWSAAATYAQGGLTVAGGYFRAANQGEN
FT                   GWTNATAQPSFGGALGYPSSGYNGGNAFKSAGIAQVAAQYEVGPYTAGLRYSNAQYKGN
FT                   DGQPSIHFNVLGALLQYRVTPALSLATGYTYVYGSAATPTQAAEGRTMASINQVSLGAT
FT                   YSLSKSTALYAMGAYVHAKGAQASAADFGNTSSGGNQVQVNIGMFHGF"
FT   sig_peptide     80029..80103
FT                   /locus_tag="Bcen2424_5946"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            complement(81228..82193)
FT                   /locus_tag="Bcen2424_5947"
FT   CDS_pept        complement(81228..82193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5947"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5583 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5947"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12680"
FT                   /protein_id="ABK12680.1"
FT                   /translation="MERKSHVMSESRDVAKHRGELPPLNALRAFDAVARHGSFAGAAAE
FT                   LHVTHWAVGKQIRLLEDWFGLPLFDRRPRGVALTDEGAALLNDVSHAFERLGTAVVRLR
FT                   HNTFTHRISGVVRVNVPMSFAFCWLLPRLADFHSRYPDIDVRVSTTSRKLRYVADAFDI
FT                   GVRSGPEQGAGVVSRPLMPDLRVPACNPALLRQHPIQSVADLRHHTLLHSATTRSAWSH
FT                   WLKEAGASDLRAARHVEFDHVNLQLGAAIEGLGVALASLPLIGRDLAEGRLVCPIASPV
FT                   WRADDYMLVTNADRADDAAVSAFEEWMEGMASRQGGTTPE"
FT   gene            82311..83531
FT                   /locus_tag="Bcen2424_5948"
FT   CDS_pept        82311..83531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5948"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5584 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5948"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12681"
FT                   /protein_id="ABK12681.1"
FT                   /translation="MRLPVFSPPVTRETAPPRRRALWLSCVAHAMHDGYTDMIYALLPV
FT                   WQSEFGLDFAALAILRGVYAGTMATLQLSAGRLAQRLGSRATLALGTLLAALGYALAGM
FT                   SGGLLGLGVALAISGGGSSTQHPIASGAVSRFYGRDARGPLSIYNFSGDLGKSALPAAI
FT                   SLLVTLMPWRHALWIVAGLGCVVAAVIALWFPAVPRGGANTTAKEHASAQRGGTGKSGF
FT                   SALFSIGVLDTAVRMGLLTFLPFLLKAKGVSPQLLGTALALVFIGGAAGKFMCGWLGAR
FT                   LGMVRTVLLTEGGTAACIIAVMYLPLAPSMVLLPILGMMLNGTSSVLYGTVPELSAPER
FT                   TERAFAIFYTGTIASGALSPVLYGFLGDRIGVHGATYATALTALAIFPLALALRPHLAD
FT                   DPTGGTP"
FT   gene            83528..84424
FT                   /locus_tag="Bcen2424_5949"
FT   CDS_pept        83528..84424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5949"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="PFAM: Ketopantoate reductase ApbA/PanE, N-terminal
FT                   domain protein; Ketopantoate reductase ApbA/PanE,
FT                   C-terminal domain protein; KEGG: bcn:Bcen_5585
FT                   2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5949"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12682"
FT                   /protein_id="ABK12682.1"
FT                   /translation="MTKSGYPSVALVGPGAIGTTVAAALHEAGRTPVICGRSAHAELKL
FT                   RFDGGEIVVPGPVLTDPQAVKETVDLVFVAVKSTQTASAAPWVAALCDANTVICVLQNG
FT                   VEQKAAFAPYAAGAAIVPSVVWFPAQRESGASVWLRAKPRLTLPDTPASNVVVSALRGT
FT                   RCAPEVAEDFISLAWRKLLQNAVAGLMVLTGRRAGMFSRSDITELSLAYLKECLAVARA
FT                   EGAKLGDEVPQEIVDAFHGFPPDLGTSILADRQGNHPLEWDCRNGVVQRYGRTHGIPTP
FT                   ISDLVVPLLAAASDGPG"
FT   sig_peptide     83528..83596
FT                   /locus_tag="Bcen2424_5949"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.542 at
FT                   residue 23"
FT   gene            complement(84559..85158)
FT                   /locus_tag="Bcen2424_5950"
FT   CDS_pept        complement(84559..85158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5950"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: bcn:Bcen_5586
FT                   ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5950"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12683"
FT                   /protein_id="ABK12683.1"
FT                   /translation="MHIAIVTFQGFNELDSLIALGVLNRIRKPGWRVTLACPEPSVTSM
FT                   NGITVHAQSTLADACTADAVIIGSGIQTRDVVNDAALMAQLRFDPARQLIGAQCSGTLI
FT                   LAKLGLLGTIPACTDLTTKPWVIEAGVDVLNQPFFARGNVATAGGCLASPYLAAWLIAR
FT                   LEGEDAARGALHYVAPVGEKDEYVSRALTNIKPYLR"
FT   gene            85568..86725
FT                   /locus_tag="Bcen2424_5951"
FT   CDS_pept        85568..86725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5951"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5951"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12684"
FT                   /protein_id="ABK12684.1"
FT                   /translation="MNNIIKSALCAAFVPFVLAGCGGGDDGGGTQTGTLHVAMTDAPSC
FT                   GFDHVYVTVSQVRVNANANAADNDAGWSTVSLATPQKIDLLSLTNGVLADLGQTALPAG
FT                   QYQQVRLVLAQNQGNNLANSVVPTGGVEQALATPSATQSGYKIIQPFTVQPNTLVDLVL
FT                   DFNACKSIVQRGNGSYALKPVVTAIPTVVSGAISGYVASAEAGATVYAEQGGKVVRGTV
FT                   ADSSGKFVLSPLIQSSTQGNYDVVIVQNNFASGIVRSVPVVVNTTTAVSASTAPITLPA
FT                   STTSTVSGTVTASVNAFVRALQTVDANAYEITSINANMDTGAYSLSVPAAAPIVGTYSG
FT                   SLPVALAAAPAAAGQYTIEADAASGATQSANVNATTSQSNVNFSF"
FT   sig_peptide     85568..85642
FT                   /locus_tag="Bcen2424_5951"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.458 at
FT                   residue 25"
FT   gene            86785..86946
FT                   /locus_tag="Bcen2424_5952"
FT   CDS_pept        86785..86946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5952"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bcn:Bcen_5588 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5952"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12685"
FT                   /protein_id="ABK12685.1"
FT                   /translation="MKKGVIALLAAASMVGALSGCVAYVPGPPVVVAPQGGPGNGFCPP
FT                   GQAKKGNC"
FT   sig_peptide     86785..86856
FT                   /locus_tag="Bcen2424_5952"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.696 at
FT                   residue 24"
FT   gene            complement(87028..87501)
FT                   /locus_tag="Bcen2424_5953"
FT   CDS_pept        complement(87028..87501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5953"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5953"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12686"
FT                   /protein_id="ABK12686.1"
FT                   /translation="MEAAMQWITRQRPKIDRVACPWLIARFIDETPEFLYVPPGDVLRI
FT                   ANETGAIPYDIPGVELTHVGEQCSFDAFLDKYGLADDRALQHMARIIRGADTSRLDLTP
FT                   QSSGLYAISLGLSDMFSDDHDMLEHGLVMYDALYAWCRHCQAEGHAWPPKMAE"
FT   gene            complement(87504..88676)
FT                   /locus_tag="Bcen2424_5954"
FT   CDS_pept        complement(87504..88676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5954"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   bcn:Bcen_5590 chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5954"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12687"
FT                   /protein_id="ABK12687.1"
FT                   /translation="MNTHRDRPAYTLWQLTRYFAWLGATGFGGPVALAGYMHRDLVDTR
FT                   GWIADADYKEGLALAQLAPGPLAAQLAIYLGYVHYRIVGATLVGIAFVLPSFLMVVLLG
FT                   YAYTQFGGLTWMQSVFYGVGAAVIGIIAISARKLTAKSIGHDKLLWAIYLALVAVTVIT
FT                   ESEVAWLFLAAGLVVWFTRAPPKWLRQRRVNAVMALPVSATGAWLGIVDWPQLAQLAAF
FT                   FAKAGAFVFGSGLAIVPFLYGGVVTEHHWLNEKQFVDAVAVAMITPGPVVITVGFIGYL
FT                   VAGLPGACVAAAGTFLPCYLFTVLPAPYFKKYGRLPAILAFVDGVTAAAVGAITGSVIV
FT                   LARRSIVDVPTALMALAAIVLLVRFKKLSEPVVVGGAAVIGLIVYPLLHH"
FT   gene            complement(88696..89658)
FT                   /locus_tag="Bcen2424_5955"
FT   CDS_pept        complement(88696..89658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5955"
FT                   /product="putative chromate resistance signal peptide
FT                   protein"
FT                   /note="KEGG: bcn:Bcen_5591 putative chromate resistance
FT                   signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5955"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12688"
FT                   /protein_id="ABK12688.1"
FT                   /translation="MNPVPTSWLLLIVSLPTSGATARMRIWRTVKALGCGALRDGAYLL
FT                   PAHAEQAAQLRELADEARNGDGQAWLLDVRADDPADEDAYKRLFDRAGDYAAWLAELSE
FT                   ARQTLPDLTAADLNRLQRRHARTYEAIRSIDFFPGETSLRAQAQWRDFTAAIEALRSPG
FT                   EPHAAQRGIPRRDPAQYQGRLWATRRHLWVDRVASAWLIRRFIDPHARFVWLDNLADCP
FT                   ADALGFDFDGAPFTHVGDRVSFEVLIASFGLDDNAGLVRLGAMVHALDVGGATVPEAGG
FT                   FEAILAGARKRLADDDALLMEIGAVLDSLYVHFRGNRNP"
FT   sig_peptide     complement(89599..89658)
FT                   /locus_tag="Bcen2424_5955"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.472 at
FT                   residue 20"
FT   gene            90021..90350
FT                   /locus_tag="Bcen2424_5956"
FT   CDS_pept        90021..90350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5956"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5956"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12689"
FT                   /protein_id="ABK12689.1"
FT                   /translation="MQLDGKRRPAHETAPMTIDPGSIPYYLVLRAGWPPYVLNSDRQVL
FT                   RRQASPLLLAFARTRGAIAHVDDSAWNGFSDSEGLTVVERRETGFFSLVAGNETERQLQ
FT                   LLTTL"
FT   gene            90609..90941
FT                   /locus_tag="Bcen2424_5957"
FT   CDS_pept        90609..90941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5957"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5957"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12690"
FT                   /protein_id="ABK12690.1"
FT                   /translation="MCSPMRLVVAERQEFVMSMHVYRGFEIYPLIYPHVAAPQGCPHNY
FT                   DAGFDAAVKICLRGTTDTLTQSQTFRLRDTAPFDNAGDARRASVRYAENIIDDNRGKQG
FT                   FFSSAG"
FT   gene            90945..91199
FT                   /locus_tag="Bcen2424_5958"
FT   CDS_pept        90945..91199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5958"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5958"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12691"
FT                   /protein_id="ABK12691.1"
FT                   /translation="MLAGATQFFGILEDEMIIDELLGLIRRNEVTRIDTVVPARIADSA
FT                   MCHQPELHMFMAVRALSIGAGYSEFESDEIASAVMTRLG"
FT   gene            91233..91445
FT                   /locus_tag="Bcen2424_5959"
FT   CDS_pept        91233..91445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5959"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21; KEGG: bcn:Bcen_5595
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5959"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12692"
FT                   /protein_id="ABK12692.1"
FT                   /translation="MTTITLKLNEPIDVALRRFRRDIEKTGLIRELRARTGYEKPTTER
FT                   KRKKASAVARQRLQAKRLLPPRKMY"
FT   gene            91535..92638
FT                   /locus_tag="Bcen2424_5960"
FT   CDS_pept        91535..92638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5960"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bcn:Bcen_5596 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5960"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12693"
FT                   /protein_id="ABK12693.1"
FT                   /translation="MRGMDEMQEPLFTTVKLEDFVPADHPLRPLRLLVNQALKRLNGLF
FT                   GTIYADSGRASIAPEKLLRALLLQVLYSVRSERMLMEQMRYNLLFRWFVGLAIEDAVWD
FT                   HSVFSKNRDRLLEHEVVEAFFTEVMSLADKQGLLSREHFSVDGTLIQAWASHKSFRPKD
FT                   GSDDPPAGGGRNVDTDWKGKRRSNDTHESSTDPDARLFRKGRQSGAILCYQGHILMENR
FT                   SGLVVGAVVSHADGFGERASALRLLDRVPGRHAKTLGADKGYDMRDFVRDCRARKVTPH
FT                   VARNDAHQGGSAIDGRTSRHAGYGISQVIRKRIEEHFGWGKTVGRIRQTAYRGIKRVDQ
FT                   HFKLTMLASNLTRMARILAAVPQGAAR"
FT   gene            complement(93015..94292)
FT                   /locus_tag="Bcen2424_5961"
FT   CDS_pept        complement(93015..94292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5961"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: bcn:Bcen_5597 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5961"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12694"
FT                   /protein_id="ABK12694.1"
FT                   /translation="MKNPLDTMFGRLVITTVGLLVLVHLTSLLLIERTRASLAAFHISR
FT                   VVEAAASMGGQDSGGERSVADILGISFVDLKQLPAADAQRFRGDTNGPIERQLRHVLPP
FT                   GTHVAMDDDGTLRVLRAGSTHGIVLPRAEVPVSRFTGVLALTLVFAIGVAVVLAWQLNR
FT                   PIRDLAAAAREHRTGHHLNIVRKRGPRELRELIGDFNDMTGELAVAERERAVMLASIAH
FT                   DLRTPITRMQVRADLLTDRGDREGFLRDTESMSRVITQFLDFAREIPEGSPQISVDTHC
FT                   RRDYTDALSPSGDAHRDALVTLDLHAGPDFMLPAVDIDRMLSNLVENALTYGEPPVEIA
FT                   TRARGEHYELVVRDHGPGVSEPDLDRVLRPFVRLDPARGGTSHSGLGLAIVHRLVRHHG
FT                   GTLHMSNAADGGLVIVMRFPKRSAAQ"
FT   gene            complement(94276..95025)
FT                   /locus_tag="Bcen2424_5962"
FT   CDS_pept        complement(94276..95025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5962"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcn:Bcen_5598 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5962"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12695"
FT                   /protein_id="ABK12695.1"
FT                   /translation="MHPPSLPDSAPQVLLVDDDAELRDLLRRFFQQRGIEFSVLHDATN
FT                   LARRLERERPAIIVLDLMMPGVDGLTALKQLRASGDTIPVIMLTARAEGIDRVLGLELG
FT                   ADDYLGKPFMPQELLARIQAVLRRQGPPRTTAVREKPTPCRFGRFELDFSTRTLLREGT
FT                   PVKLTGGEYALLEVLASHPMETLSRTRLIELLHGPDAEVTERGIDVPVWRLRRLIEDDP
FT                   SNPRRLQTVRGIGYMFIPDNPADEEST"
FT   gene            95351..96607
FT                   /locus_tag="Bcen2424_5963"
FT   CDS_pept        95351..96607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5963"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_5599 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5963"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12696"
FT                   /protein_id="ABK12696.1"
FT                   /translation="MKTPILPNHAHHPMTCRPRQLFAALSILAIVGTAGCNRQTGAPPG
FT                   GFAAQTAQVGVLSLAPQRIVETTELSGRLSSQKVSDVRPQVSGIILKRLFMEGGDVKAG
FT                   QVLYQIDPATYQAAYDQARGTLENARATLASAKTKADRFTELVKINAVSKQDYDDAVAA
FT                   VRENAASVTADEAALESARVNLEYTHVRAPISGRIGASTVTEGALVTSNQTTALATIQA
FT                   FDQMYLDVTRPSTEWLRLRKAFASGRLKKTGSDSAAVTLVMEDGTEYAHPGALQFSGVT
FT                   VDATTGSVTLRSTFPNPERELLPGMFVRARLEEGENDNAILVPQMAVTRASDGKASVYV
FT                   VDAAGNARQVQVTADNAFRDQWIVTSGLHTGDRVIVSGLQSVHAGAPVKVAADTPQTQA
FT                   NAASAAPATDTASTVSAQR"
FT   gene            96620..99817
FT                   /locus_tag="Bcen2424_5964"
FT   CDS_pept        96620..99817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5964"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bcn:Bcen_5600 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5964"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12697"
FT                   /protein_id="ABK12697.1"
FT                   /translation="MAEFFIKRPILAWVMAIVIMLVGAAAVTSLPVAQYPTIAPPSVQV
FT                   TATYPGASADTVAATVTQVIEQKLSGIDNVLYMSSTSSSAGQATITLTFNPGTNPDIAQ
FT                   VQVQNKVTQATPTLPQTVQEQGVQVAKASTSFLMIVALSSPGGTWNSVDLGNIIATRIE
FT                   DPLAQLNGVGDVTLFGAQHAMRIWLNPVKLHSFGLTPSDVTTAITNQNVELSTGQVGGS
FT                   PATDSQAINATIRSSSLLTTADQFAGILLRVNSDGSRVLLKDVARVEVGGDSYDTSSRL
FT                   NGKPASALAIKLATGANALDAANAVRAKLAEIQLQLPKDVAISYPYDTTPFVRISIEEV
FT                   VKTLFEAVVLVFLVMYLFLQNVRATLIPTIVVPVALLGTFGVMSMIGFSINVLSMFAMV
FT                   LAIGLLVDDAIVVVENVERIMSEEKLGPKEATHKAMGQITGALVGVTTVLTAVFIPMAF
FT                   FAGSTGAIYRQFSITIVSAMLLSVMLALTLTPALCATLLKRADVEHHEKRGFFGWFNRW
FT                   FAKSNAGYSSSLARVVARPARYMLLYGAIAGVVALLYVTLPSSFLPDEDQGYFIVSISA
FT                   PAGTPASRTLKTVEAVEQYVLKDEPGVKQVIAINGFSFNGQGQNNAIAFVTLKDWSLRG
FT                   SRDSASAIIARASQHFAGNRDARIFVLNPPAIQELGTQSGLDFEIEDRGGAGHDKLLAV
FT                   RNQFLGMASKEPTLAMVRPSGLEDTPQLQVDIDREKANALGLSISDVNDTLQTAFGSSY
FT                   VNNYIDTGRVQKVYVQSDAPYRMMPADLGDWYVKAGSSSSGSSSSSSSSTTTSTTGYDA
FT                   TMVPFSSFAKSHWTFGPPQIERYNRQLAAGMSAATRPGVSTGEAMTAVEQLARKLPPGF
FT                   AVEWTGQSYQEKQAGSQATVLYAISLVVVFLCLAGLYESWSIPLAVLLVVPLGVLGALL
FT                   AAHGRGLSNDIYFKVGLLATIGLSTKNAILIVEFAKDLQAQGHSLVDAVLEAAHMRLRP
FT                   ILMTSLAFVFGVLPLVISTGAGAGARHAIGTGVTGGMIAATVLAIFFVPVFFVVVRRLF
FT                   NEHGHTTDSADINEGNA"
FT   sig_peptide     96620..96700
FT                   /locus_tag="Bcen2424_5964"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.371 at
FT                   residue 27"
FT   gene            99814..101241
FT                   /locus_tag="Bcen2424_5965"
FT   CDS_pept        99814..101241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5965"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_5601 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5965"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12698"
FT                   /protein_id="ABK12698.1"
FT                   /translation="MKRTLIALVCTGVLAGCTLDPTYQRPAAPVDDTWSTVPALAQPKA
FT                   AQSTAAAPLGADLGWRDFFKDPRLQKLIELALANNRDMRVAALNVAQYEAQYRIARANV
FT                   GPAINASGSVTRERVAGSTSAYSSSSASVGLTSWEIDFFGRLRSLKRQALEQYLATDAA
FT                   RTSTQISLIATVATDYLQLRSDETSLQIAQNTVDADQHTYDLTVSMMKMGSASLQDVRQ
FT                   AENSLASARSSLASYTRAVAQDRNNLVAEIGAPLPDDLPQGASLMESENTFADIGEGVP
FT                   SDLLARRPDIVEAEHTLKAANANIGAARAAFFPKIELTASAGTTSGSLSNLFKAGTGAW
FT                   TFAPSISVPIFDFGYNRATLDVAKVEKDIDIANYEKAIQTAFKEVSNALAGRTTYVTQV
FT                   AADRDYVNSAQQYYDLAQARYRSGTDSFLTLLDAQRTLYAAQQQLVTDMLAKQSNLVTL
FT                   YKVLGGGWRETSAVAQR"
FT   sig_peptide     99814..99864
FT                   /locus_tag="Bcen2424_5965"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.655) with cleavage site probability 0.286 at
FT                   residue 17"
FT   gene            101297..102346
FT                   /locus_tag="Bcen2424_5966"
FT   CDS_pept        101297..102346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5966"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_5602 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5966"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12699"
FT                   /protein_id="ABK12699.1"
FT                   /translation="MLRSPATGCWKQPCARRIARGSHERAAYGGVAGPVADHRCTAPST
FT                   RAQRLPRSIARRPVATVRPARSHRHAGRHAPSNVRVISSASTRRRASRHPTNPTPPASP
FT                   PMPIAPAVVSAFTPTGKLRASINLGNPILANRDPATGEPFGVSIDLARAFAERLSADLE
FT                   LVVFDAAGKSVQALTDERADFGFFAVDPLRGETVAFTAPYVLIEGFYLVPDASPIRTNA
FT                   DVDQPHNRVAVGKGSAYDLFLTRELKAAQIVRAPTSQAVVPTFVEQQLEVAAGVKQQLE
FT                   TDAAKTPGLRLLDERFMVIRQAMGVPKSRGDAAAAALAAFVEDMKASGFVADSLRRHGI
FT                   TGASVAPAG"
FT   gene            complement(102400..103659)
FT                   /locus_tag="Bcen2424_5967"
FT   CDS_pept        complement(102400..103659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5967"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; KEGG: bcn:Bcen_5603
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5967"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12700"
FT                   /protein_id="ABK12700.1"
FT                   /translation="MSSPRGALFPDALMQQIKSRFHHVDRDVDGRERLFFDNAGGSFRL
FT                   KAAVDAYARVDALPDCPERIHARALDLQAIQSRGEDDVRTILNAQGGTVYASLTASGAM
FT                   FDMVRAIMENVPGTNAVTTVLEHPSSYDAMTVYAERTGKTLRIAPSNPVTGGVDVDAIV
FT                   ALVDADTALLSVMAASNISGAKFDIETIVARAREKKPDLFIVVDAVQHAPHGVIDLQRT
FT                   PVDGINFAPYKFFGCRGSGMSWLSERAAALPHHRLAAKENGVWELGSPAPAQFAVVSSI
FT                   VDYVAWIGRYFTDSDDRRTLFVEGMHRIELHERALLAALLDGLRAIDGVEVYWDHADLT
FT                   QRDLIVGIGFAHLEPTQAVREYEKHGVIVYERVASSLYSGRMLTSFGLPGAVRISPLHC
FT                   HAPDDIARFLAITEALAAQR"
FT   gene            complement(103713..105041)
FT                   /locus_tag="Bcen2424_5968"
FT   CDS_pept        complement(103713..105041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5968"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bcn:Bcen_5604 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5968"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12701"
FT                   /protein_id="ABK12701.1"
FT                   /translation="MDTVIDSPPVVGAARKPRVGLAWQIVIGLVIGIATGLVLNRFPQL
FT                   RDTAVSGLLQPAGDIFIKLVRMIVVPIVFTSMVIGIAGVGDGKSLGRLGIKTLLYFEVI
FT                   TTIAIVLGLVIGNVLQPGVGTDMSQLGHTDISRYQQTTQQVQQAHHGLMALVLGIIPDN
FT                   IVASMAKGDLLPVIFFSLLFGLGLQSVPEEHRKPVLAMLKGVADAMFKVTNMVMRYAPV
FT                   GVCALIAVTVSSFGFGSLLPLLKLVAVTYFAILLFAIAVLGVTARLFGFRILTLLRVIK
FT                   DELIIAFSTCSSATVLPQLMKKMEDYGVPKSITTFVVPTGYTFNLDGASIYLGIGTLFV
FT                   AQLYGVHLGWQQQVLLTLTMVVTSKGAAGVPGFMFVIMLATLASAGLPLEGLAFIAGVD
FT                   RIMDMGRTALNVVGNALAPLVIAKWEGRYDAEKGRAYVESLRG"
FT   gene            105218..106135
FT                   /locus_tag="Bcen2424_5969"
FT   CDS_pept        105218..106135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5969"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5605 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5969"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12702"
FT                   /protein_id="ABK12702.1"
FT                   /translation="MLTFKQMEALYWIVQLGSFDAAATRLNTTQSAVSKRIQELERAFD
FT                   LTVFDRAHRSARLTDKGAELFDHAKALLEQRDRVVERMSSKEALVRHVRIGVTELTALT
FT                   WLPRLIAAIQAAYPRVHVEAEVDLTATLRDRLAADTIDLIVVPQIHATDAFTATVVGEV
FT                   DNAWMCAAGFMPTSRAALALTDIARFPLILQGNLSGTGHLYTRFLQEHGVATQRVLSSN
FT                   SLLAQIGLTLSGLGISYLPKACVAHLVACDALEIVRTQPALPPVRYVALHRAERAQSLT
FT                   AEIVRLAEQACDFSTSLLDPRAHD"
FT   gene            106446..107753
FT                   /locus_tag="Bcen2424_5970"
FT   CDS_pept        106446..107753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5970"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bcn:Bcen_5606 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5970"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12703"
FT                   /protein_id="ABK12703.1"
FT                   /translation="MRKKNAAAVWILVAMAAGIAIGYMVFTSFPDKKAAAEVAGYISLV
FT                   SDVFLRLIKMVIGPLVFSTLVVGIAHMGDAASVGRVFAKSIAWFITASLVSLLLGLLMA
FT                   NLLRPGDNLGLPLPDIGASANLATSKFTLKDFVGHMVPRSFAEAMANNEILQIVVFSMF
FT                   FGVALAALGERGKILIAAIDQLSHVMLKITGYVMKLAPLAVMAAMAATVAVNGLSVLLK
FT                   FAVFMGDFYVSLFLLWALLVCAGLVFLGPRVFKLLVLIKEAFMLSFATASSEAAYPKIL
FT                   DALDRFGVKRKISSFVMPMGYSFNLDGSMMYCTFASLFIAQAYNMHLSLGTQITMLLVL
FT                   MLTSKGMAGVPRASLVVIAATLHQFGLPEAGLLLILGVDTFLDMGRSATNAVGNSIASA
FT                   VVAKWEGQLLPEAEAEANAARIEAEQEATIAHPTEV"
FT   sig_peptide     106446..106514
FT                   /locus_tag="Bcen2424_5970"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.532 at
FT                   residue 23"
FT   gene            107767..108708
FT                   /locus_tag="Bcen2424_5971"
FT   CDS_pept        107767..108708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5971"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_5607 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5971"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12704"
FT                   /protein_id="ABK12704.1"
FT                   /translation="MKMQRFWRALALAGLLATGAAARADDAPSTPPRVEPFAPAQLTGT
FT                   LAKVRGSGTIALGYRDASIPFSYLNARNQPIGYSIELCKALVASIEDAINQSLTIRWVP
FT                   VTSDNRIDAVVSGKVDLECGSTTSNLERQKRVAFSPIFFVAGTKVMVKRGAPIRSFRDL
FT                   AGKKVAVTAGTTNEKALRDLNDKFRLGVQLQVVPDHAQGFALVANGSADAFATDDVLLY
FT                   GLIAENASKGGQYDVVGDFLSYDPYGIMFRKDDPQLAQIVKSTFQELAADGEIARQYKR
FT                   WFLRPLPSGLSLNLPMSPQLETIIEAIGVNAN"
FT   sig_peptide     107767..107841
FT                   /locus_tag="Bcen2424_5971"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(108798..114692)
FT                   /locus_tag="Bcen2424_5972"
FT   CDS_pept        complement(108798..114692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5972"
FT                   /product="UvrA family protein"
FT                   /note="KEGG: bcn:Bcen_5608 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5972"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12705"
FT                   /protein_id="ABK12705.1"
FT                   /translation="MSSSNLIRIRGARQHNLKNLDLDLRTGEMTVVTGPSGSGKSSLVF
FT                   DTLYAEGQRRYVETFSAYARQFLDRMDRPQVERVDGVPPAIAIDQTNPVRSSRSTVGTM
FT                   TELNDHLKLLYARAAELFDRKTARQVRHDTPETIYAELVARTQADDPRVVVTFPVELPE
FT                   AVSDEEIAQWLSASGYTRVQAQREVASPTGPRKMLDVVADRFRVQQADKARVVEAIEAS
FT                   LKRGGGRVNVYVLAADAENATAEPLIWRFSTGLHDPDSDLRYAEPQAALFSFNSAYGAC
FT                   ETCRGFGRVIGVDLGLVIPDARKTLRGGAIKPMQTPAWKECQDDLMRYAAKAGIRRDVA
FT                   WSELTDAERDWVVNGSPDWNGKWQSQWYGVKRFFGYLESKAYKMHIRVLLSKYRSYTPC
FT                   DVCGGARLKTESLQWRLGSKENADAVLAPADRFMPRGVDWSRAQLETLPGLTVHDLMLL
FT                   PIERIRRFFDDIVLPSALLDDALKLLLAEVRTRLKYLCDVGLGYLTLDRQSRTLSGGEV
FT                   QRINLTTALGTSLTKTLFVLDEPSIGLHPRDLTRIVEAMQRLRDAGNTLVVVEHDPSVM
FT                   LAADRLIDMGPGPGERGGTIVYDGTPGDIRSARTLTGEYLGGRKQVAHASNWARRVVDA
FT                   NTPRIVLEGATEHNLRDVTVEIPLQRLVCVTGVSGSGKSTLLQDVLYPAMARHHGKATE
FT                   SPGAFRSLTGADQVGDVVFVDQSPIGKTTRSNPASYVGAFDEIRKLFAKAPLALQRGYG
FT                   AGTFSFNSGDGRCPTCGGSGFEHIEMQFLSDVYLRCPDCDGSRYRAEILEVRIERDGRA
FT                   LNIADVLDLTVSEAAAFFATDAEVLRVLQPIVDVGLEYVKLGQPVPTLSGGEAQRLKLA
FT                   GFLAESAAAANGRRVATEEARIARAKLFMFDEPTTGLHFDDIAKLMQAFGKLLAAGHSL
FT                   IVIEHNLDVIRAADWLIDLGPEGGDGGGLVLCAGTPDDVKACAESHTGVALLQYDREME
FT                   GAAAAADEGVPLQAALNAARARRAIEGEDVVRIVNAREHNLKSLDVDIPHGKFNVITGV
FT                   SGSGKSTLAFDILFHEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAIEQRLSR
FT                   GGRKSTVATTSEVWHFLRLLYVKLGLQHCIHDGTPVTSQSVESIAAQLLRDHRGEHVGL
FT                   LAPLVVNRKGVYTDLAKWAKARGSTHLRVDGEFVTVDPWPKLDRFREHTIELPVADIVV
FT                   SPDNEAELRRRLDETLELGKGVMHLLAPLDGLHHAMQNDHSTAQVGAVKVLSVKRACPV
FT                   CGTSYPELDPRMFSYNSKHGWCTTCVGTGVTLTREQRAAYDDTVLAGDDRGREQTLPSD
FT                   EQEPEGVGNEPCPDCHGTRLNPSARAVTFDAHPIVEVAQWTVSDTRRWIDALELTGRDA
FT                   QIARDIVSEIGSRLAFLEEVGLGYLSLDRAAPSLSGGEAQRIRLAAQLGSNLQGVCYVL
FT                   DEPTIGLHPRDNQILLDALRKLGDKGNTLVVVEHDEDTIRRADQIIDVGPGAGKRGGTL
FT                   VAQGAVADLAAQADSVTGRLLAQPMTHPLQPRRSVSLPGKKGGEAVPEAWLTVHGARLH
FT                   NLRDVTVGIPLARLVAVTGVSGSGKSTLARDVLMTNLLDAVGRSVLSSPATRRARKAAQ
FT                   QDAPAANRRSSVLARSAPRPSLNVTHAWQGCESLSGWEQIDRVLEVDQTPIGKTPRSCP
FT                   ATYIGVWDTIRKLFADTLEARARGYTASRFSFNTGDGRCPACEGQGVRTIGMSFLPDVK
FT                   VPCDVCHGQRFNPETLAVTWRGRNIGDVLTMEIDEAVEFFAPISNIAHPLQLMKDVGLG
FT                   YLTLGQPSPTLSGGEAQRIKLVTELTKVRDDITRRGQKAPHTLYVLDEPTVGLHMADVA
FT                   KLIRVLHRLVDAGHSVVVIEHDLDVIAEADWIIDLGPEGGVGGGTIVAAAPPEGLVQVK
FT                   ASHTGQALKPVLARAASEDAEVEQQGAARVG"
FT   gene            complement(115005..116207)
FT                   /locus_tag="Bcen2424_5973"
FT   CDS_pept        complement(115005..116207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5973"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5973"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12706"
FT                   /protein_id="ABK12706.1"
FT                   /translation="MRSNPAGQTMVEYFPTNYVWNLSVNIALASGGNSGEIDAVCRSLV
FT                   AASTRSDDGATEAFFLSWCDLGDRLRALAEADLAAGRRLSAGAKFGRAAVYYLTGERMT
FT                   HPSFEPRKAAYAKALRCFARFAELHEKNCERVEIPYRGASLAGVFVAARGDASAAAPCV
FT                   VFANGLDSFKETIYGSGVQQALAARNISSLAIDQPGTGEALRVSGLTALIESEVWAGAV
FT                   ADYLAQRTDVDSRMLGMCAWSLGGYYAPRAVAIDKRFRLCVAWGANFNWGELQRRRLAR
FT                   EGDNPVPHYWDHVRWVWGKATLEEFMVFSERITLAPVIDEVTVPFLIVHGDADRQIPRE
FT                   YAIQQYQGAVNSPKRELKFFTAAEGGVEHCSADNVTNVRDYIADWIAETYRELGAIHVE
FT                   T"
FT   gene            complement(116285..116968)
FT                   /locus_tag="Bcen2424_5974"
FT   CDS_pept        complement(116285..116968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5974"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   bur:Bcep18194_C7459 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5974"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12707"
FT                   /protein_id="ABK12707.1"
FT                   /translation="MQARKTTKKATVTRGEGRVQDAAQTSKRERVLDVAERLFAEGGFD
FT                   GVSMRDIASAADVGLPLIVYHFETKMGLYRALFERRKTVLDARLAMLREPVAAGEDPLE
FT                   HIVRAFVLPVMQIQGTDAGLAYAKLVAREASDPREAERGIVAEYFDPFAAEFVGAIKKE
FT                   LPGHGASYAHWAYLFAVGALVMSAFDSRIERISNGKVKAGALKSKTTHLVTFITAGIRA
FT                   GATPV"
FT   gene            117193..117999
FT                   /locus_tag="Bcen2424_5975"
FT   CDS_pept        117193..117999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5975"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: bcn:Bcen_5611
FT                   putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5975"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12708"
FT                   /protein_id="ABK12708.1"
FT                   /translation="MTRRFVDLSIYLENDVISDPPGYGPTIQYLAHEETAKSVTAFFPG
FT                   LQEHDLPDSEGWAIEHVRLSTHNGTHLDAPYHFHSTMNESTGERERAITIDEVPLDWCF
FT                   QPGVKLDFTDRADGYVVTAADVEAELSRIDHVLKPLEIVVVNTRAGLRYGQPDYVSSGC
FT                   GMGLDATLYLLERGVRLTGTDAWSWDAPFVHTARKYAETHDASLIWEGHKAGRHIGYCH
FT                   LEKLHNLEVLPPHGFFVSCFPHKIRGASAGWTRAVAIFDDALNATA"
FT   gene            118035..119357
FT                   /locus_tag="Bcen2424_5976"
FT   CDS_pept        118035..119357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5976"
FT                   /product="fumarylacetoacetate hydrolase"
FT                   /EC_number="3.7.1.2"
FT                   /note="KEGG: bcn:Bcen_5612 fumarylacetoacetase; TIGRFAM:
FT                   fumarylacetoacetase; PFAM: fumarylacetoacetate (FAA)
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5976"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12709"
FT                   /protein_id="ABK12709.1"
FT                   /translation="MELNHTHDVTRRSWVDTANEAGTDFPLQNLPLGIFRRAGRDEPWR
FT                   GGVAIGNQIVDLAALQQAGVLDGLAADAVRAATATTLNALLDMGPGAWQALRHALFALL
FT                   EAGSPHEKNVRHTLVPQTDTEHAVPVRIGDYTDFYTSLDHALNCSRPLGMAISPNFDWL
FT                   PIAYHGRVSSIDVSGQQVYRPVGQYRPDPSSAPVRGACRQLDYELEVGAVIGTGNSRGT
FT                   AIPLADAQQHLFGLCLLNDWSARDIQAWEMQPLGPFLAKNFATTLSPWLVTVEALLPYR
FT                   TTWSRVAARPQPLDYLDAETNRAAGAFDIQLEASILSARQLAQRQQPRTLTHTSFRHQY
FT                   WTLGQMIAHHTMGGCNLQSGDLLGSGTVSGPSPGEAGALIELTSGGTRPVDIGNGEARA
FT                   FLEDGDTVIFRGWCERDGFARIGFGANYGTVLPAPVADSAR"
FT   gene            complement(119497..120588)
FT                   /locus_tag="Bcen2424_5977"
FT   CDS_pept        complement(119497..120588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5977"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_5613
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5977"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12710"
FT                   /protein_id="ABK12710.1"
FT                   /translation="MNRKRRGCPLKRMQAAAAMLAVGASAHAQSTVTLYGVVDAGVMYT
FT                   SRSFDAGTGTNGAHRVSMTDGGISGSHFGITGVEDLGAGTKAIFTLESGFTMNDGALGN
FT                   SNGNLFGRQAFVGLSGRFGTVKAGMQYSPFGLAIVDTDARHASFFGSQAGIYMGNFFAT
FT                   GIFVANAVSYTSPTVAGLQASALLALGGDPGKFQAGRQYAARLRYEWRNLVANAALFSG
FT                   NPGGSTSTSTPFPSTVEFAGRTIGAAYTWGAATLKGSYTSYKIAHSFNEKVYSVGGEYL
FT                   ITPTLSTDAGVWYMRDSNDSASHALLTSAGLYYSLSKRTTVYGAAAFVNNHGLMHTGFT
FT                   VNGALYAPTGGSTSLVVGARHLF"
FT   sig_peptide     complement(120502..120588)
FT                   /locus_tag="Bcen2424_5977"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 29"
FT   gene            complement(120858..121616)
FT                   /locus_tag="Bcen2424_5978"
FT   CDS_pept        complement(120858..121616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5978"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5978"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12711"
FT                   /protein_id="ABK12711.1"
FT                   /translation="MRKHVVSFDSDQEVELKSVTFFKAGAEVTSEDILRMEVKRARHMM
FT                   ALLMDKLGADGMVKVFAKEIAEHEANERDWSRRANGRFRSSVAEAHVAAGDGAAFIKWF
FT                   WDGYSGPNSAAMLRAHPEHLGALSLPGERVGILEVPGHTRFPALLKFRHLDDWSGVPIE
FT                   LAPDMPHRMMGRIESIDGETVGYLLHQFRDTSPGFDARLEIFWPSTAPDDLIRGHADHL
FT                   MVEWYNWFELYALTRTQPDDLMSLAFSVNA"
FT   gene            121746..122348
FT                   /locus_tag="Bcen2424_5979"
FT   CDS_pept        121746..122348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5979"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_5615
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5979"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12712"
FT                   /protein_id="ABK12712.1"
FT                   /translation="MSNSAEAESPSPRRRPGGRSARVRDAVVAATIAQLQESGFEGLSI
FT                   GVVAALSGVNESSIYRRWKSKEGLVMEAVFELFAENIVIPNRGSLHADLVALMSATVRY
FT                   LRTGVGRSAIQFVLATYSDAGVTSELHRLWTNRFSAVQQIFERATQRGEWHRGADPMPL
FT                   LHCLIGAVYLRTFMLRERVTVNQLRELTLWLLRGQNA"
FT   gene            complement(122641..122871)
FT                   /locus_tag="Bcen2424_5980"
FT   CDS_pept        complement(122641..122871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5980"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5980"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12713"
FT                   /protein_id="ABK12713.1"
FT                   /translation="MHNTRMRAPDLECLVAVAMPFGKYKGRLIADLPGPYLNWLAREGF
FT                   PRGELGRQLALMHEIDHNGLRHLLEPLRKPA"
FT   gene            complement(123030..123407)
FT                   /locus_tag="Bcen2424_5981"
FT   CDS_pept        complement(123030..123407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5981"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5981"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12714"
FT                   /protein_id="ABK12714.1"
FT                   /translation="MRQCMLAADNGRGQGSLRRAHAVSVAAAAPPNSDWRPAHGSPSVP
FT                   GRGWRSVSDHADGHDLVPGVGIRARGLLRFVIRTKGGGILDGRRHADIAVLGGAKELLA
FT                   GLHDIDGHHDSLQGLQGEISV"
FT   gene            complement(123460..124122)
FT                   /locus_tag="Bcen2424_5982"
FT   CDS_pept        complement(123460..124122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5982"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bcn:Bcen_5618
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5982"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12715"
FT                   /protein_id="ABK12715.1"
FT                   /translation="MKNIHLVLLASVVSLAACSSASGPTYNAYELQSRNGIRTFQVDCH
FT                   GILSTAKTCMKVATRMCGNEPVRLVDTTTPYRDGADPHSIVFQCGAAPAPTAAAVAPAP
FT                   APVEKVSLTGDAYFATDSAVLTPAATAALDTLLNRQADRHFARVEVDGYTDATGSDAHN
FT                   QALSKRRADAVAGYLREHGLKADSFAAAGHGEANPAASNDTAEGRARNRRVEISLQK"
FT   sig_peptide     complement(124057..124122)
FT                   /locus_tag="Bcen2424_5982"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.627 at
FT                   residue 22"
FT   gene            complement(124247..128662)
FT                   /locus_tag="Bcen2424_5983"
FT   CDS_pept        complement(124247..128662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5983"
FT                   /product="YadA C-terminal domain protein"
FT                   /note="PFAM: YadA C-terminal domain protein; Haemagluttinin
FT                   domain protein; Hep_Hag repeat-containing protein; KEGG:
FT                   bcn:Bcen_5619 YadA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5983"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12716"
FT                   /protein_id="ABK12716.1"
FT                   /translation="MNKSFKSIWNEALGAWVAASELDRARGKRVASSTRAPECAAHGEA
FT                   ATHADIPSAPSVLKLAVLTATACLGLFHASAHAQYAQDGGTASGGTTAISIGLGSTAAQ
FT                   QNSTAVGNLSTAQGLSATALGPGAHAMGDGSTSVGINSQATGVNSSALGVQAIGSGDYS
FT                   VAIGNLSSATQSGAVAMGSGAAATGVSAVGLGNNALASGQYAAAMGLGASAAGAQSVSL
FT                   GYASHATNTGSVALGNQSTSSGAAGVAVGSGALTTGNSGVAMGVNSGAKGTASIAIGWG
FT                   GTAGVPGSGTQSLGTSSIAMGSNTNAGADQALAFGLNANASGVSSIAMGVQSTATQQFA
FT                   TALGNLSLATGVSSSALGPGATASATNATAVGINSVAAATSTVAIGDSNSVAAAAGAGS
FT                   VAGGYGSKVLGGIGAVALGYGQTVSGNGAVAIGDPSTAIGTGAVTMGSNNTANGDGAVA
FT                   IGNTNNAQGTGSLALGNTSTAAAAGAVAFGASAVANNANDVALGSGSTTAAPNPTASAV
FT                   IGGVTYNFNGINPASVVSVGNVGAERQITNVAAGRISSSSTDAINGSQLAATNTALDSL
FT                   STSTASSITSLSTGVSSLSTGLSSTNSAVTSLSTSTSTGISSLSTGLSSTNSAVTSLST
FT                   STSTGISSLSTGLSSTDSTVTSLSTSTSTGLSSANSSIASLSTSTSTGIGSLSTGLSST
FT                   DSTVTSLSTSTSTGLSSVNSSITSLSTSTSTGIGSLSTGLSSTNSAVTSLSTSTSTVVG
FT                   SLSTGLSSTNSSVTSLSTSTSTGISSLSTGLSSTNSSVTSLSTSTSTVVGSLSTGLSST
FT                   NSNLTSLSTSTSTVVGSLSTGLSSTNSSITSLSTSTSTVVGSLSTGLSSTNSNLTSLST
FT                   ATSTGISSLSTGLSSIANNNTNLGNSTAGAIGGGATYDPTTGTISSPSYVTYNSDGSTT
FT                   INNNVGSAIDNINANGIKYFHANSTAPDSQALGLDSVAIGPNAISRVDGSIALGSGSVA
FT                   DRAVVPSSGILRNGSASIPFDTTDQTLLGAVSVGDATNKTYRQITNVADGTGQQDAVTV
FT                   RQLTGALQSFAVTGQKYFHANSTAADSLAVGAESVAVGPTTVVNGDNGVGIGNGAIVDQ
FT                   TAPGGIAIGQAASSAQSDAIALGSGATATGAQSVAQGANAVAVSVGSVALGSGARSTAT
FT                   DALALGAGASATFANSVALGAGSLTTVGALTNYVAYGLSSPQSSAGEINIGNRQITGLA
FT                   AGKNGTDAVNVSQLDSVASQLTTLIDQRTANLGGQYTTNPNGANVPPGASGSNSSAGGS
FT                   GAVASGSNSTAVGNNALASGNGSSAIGVGATAAGNNSTAIGTGSNDGGRSNVVAVGSAD
FT                   SARQVVNVAAGTQGTDAVNVNQLNAVSNQFTQSLNTVNNQLTQMQQQIQQTDSMAREGI
FT                   AATAAMASIPHMDRDSNFAMGVGTATFQGQKAMAVGVQARVTENLKATLNGGFAGSQRV
FT                   VGAGMLYQWK"
FT   gene            128803..129168
FT                   /locus_tag="Bcen2424_5984"
FT   CDS_pept        128803..129168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5984"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5984"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12717"
FT                   /protein_id="ABK12717.1"
FT                   /translation="MPGMLDPHRECKTDRRACPFGTMREGEKPVIDSWKSTSAARRTTR
FT                   RESARAHAIAPAEGRRRISLEKRRSDAGRTDAGPHRGRPVMFHSGGERRHVVPGSEACA
FT                   AGSVTLTAGAGSIDPRP"
FT   gene            129475..129786
FT                   /pseudo
FT                   /locus_tag="Bcen2424_5985"
FT   gene            130117..130950
FT                   /locus_tag="Bcen2424_5986"
FT   CDS_pept        130117..130950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5986"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; response regulator receiver; KEGG: bcn:Bcen_5621
FT                   two component transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5986"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12718"
FT                   /protein_id="ABK12718.1"
FT                   /translation="MSSRLPSSASPRTTPDLAGAHILIVDDRPNDLRLLTEILRTARCR
FT                   ISVAFDGLQAYHRAQAIAPDLILMDVRMPRMDGFAASRLLASTPSTQSIPVIILTAAGD
FT                   LEDRIAGLETGAIDYIVKPFEPAEVIARIRNHLKRTRRSQPFAHLPDLPDNPDAALVRA
FT                   ASEVLLRDLRHPPALEDLAKQVGTHEKRLSRVFRDHLGQTVFEYLRDTRLRAAMHFLSE
FT                   TSMGIGDIAEEIGFSTPGNFATAFRERFGITPSDWRRQRHAVDAPAAPGGHHGDA"
FT   gene            130943..133285
FT                   /locus_tag="Bcen2424_5987"
FT   CDS_pept        130943..133285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5987"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; Diverse 7TM receptor, extracellular region 2;
FT                   KEGG: bcn:Bcen_5622 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5987"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12719"
FT                   /protein_id="ABK12719.1"
FT                   /translation="MRRHDAAWTAGCRVLLLLLAALAVTCAAARAATAPNPAQLEAVSV
FT                   LEDAGTTLSADEVAARFADPSRHAATPARTAFNVTFSRSAWWVRATLINRDSETCPLVL
FT                   AIRDARVDRADFYVGRNDQWTLERSFPTDRGDALDAPSRYPTLDVTLRAGEPLPVLIRI
FT                   TSRKEMRLAPVAFTRDGWIAQELHASMWNFGFFGGLLALVWCALLIGFFSRSGVFHVLA
FT                   ALTLNTALFEAAYRGYLAMALSPAAREWSTRGETIFAYLSVACFIVFILMVAHREKARM
FT                   PMRAVYVAFLALECVGIAGAAFGDLATFAWFCLWLNTVLAIVNISLALMLVIRRTPTGR
FT                   VMLIAVAFATFNMLIRMLDGRDALPPVLSWIRSDVFPNPVIAIIGLATHLLVLAAWIHH
FT                   VGRQRTEARKRLEHWQLTEQDRLRDEVARRTVALNDALQQSKTHMQQKIETLGYVSHDL
FT                   RAPLSTINGYAKLLLEGATRGQARLIRSIDRSIRYQLALIDELLAFTKAELQPLGVAPD
FT                   RTDLPGLLDDIGHYAVALCAQQDNRFVYRPVTALPRTVLIDGIRLQQVLLNLLSNASKF
FT                   TRNGTVTMSIHASREGDAWRLLFEVADTGIGIDITTTTDIFRAYQQVQAVNGGTGLGLF
FT                   IAQRIVTAMGGELAVASQPGVGTTFSFAVVAPALGHALAPASGLVRQFHPADEAEPAHA
FT                   APAMRSPPADALAELIALAGEGRLTDIEEWLGQYVDEPGHAPFVQEMREHLDALDLHAI
FT                   EKLAGALKRTRVADTPFDTEADATGPA"
FT   sig_peptide     130943..131038
FT                   /locus_tag="Bcen2424_5987"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 32"
FT   gene            complement(133326..133613)
FT                   /locus_tag="Bcen2424_5988"
FT   CDS_pept        complement(133326..133613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5988"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5988"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12720"
FT                   /protein_id="ABK12720.1"
FT                   /translation="MKRDDMTAGVADALAVEHGRRPLLDLGDARDCRIVADALRVLLRE
FT                   RSEALAFAMRVADEHGRPRPDAGEFGLTDIIRLARVVERADRQRERTAME"
FT   gene            complement(133647..134735)
FT                   /locus_tag="Bcen2424_5989"
FT   CDS_pept        complement(133647..134735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5989"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_5624 inner-membrane translocator; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5989"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12721"
FT                   /protein_id="ABK12721.1"
FT                   /translation="MNRFLGRLADPRTLPIVVTIVLFAALFGFGSVMYTGFFSMQVLTG
FT                   LLVDNAFLLIVAIGMTFVIVSGGIDLSVGSVVALTTIFCAVGAERLHWPVWVIVPLVLA
FT                   FGALYGAAMGALIHYFKLQPFIVTLAGMFLARGACFLITTQSITINAPAFHAIAGISVP
FT                   LGGGMLSAGALIALATLAVAIYVAHFTRFGRNVYAVGGNERSALLMGLPVARTKIGVYA
FT                   LSGFCSALGGVVFTLYVLSGYGLQAQGMELDAIAATVIGGTLLTGGVGYVIGSVFGVGI
FT                   LGTIQVLITFDGTLSSWWTRIVIGALLCVFCVLQRVIERHATRRRTGGTGLGAQRPTQA
FT                   AAPARPAPPKEDIGLVSTMRRS"
FT   sig_peptide     complement(134601..134735)
FT                   /locus_tag="Bcen2424_5989"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.610) with cleavage site probability 0.535 at
FT                   residue 45"
FT   gene            complement(134732..135775)
FT                   /locus_tag="Bcen2424_5990"
FT   CDS_pept        complement(134732..135775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5990"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_5625 inner-membrane translocator; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5990"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12722"
FT                   /protein_id="ABK12722.1"
FT                   /translation="MMRLRTLFRHSLAWPVLTLALLFALDVAYRPGFLSIALLDGHLFG
FT                   APIDILNRAAPLVIVSLGMTLVIATRGIDISVGAIVAIAGAAAATVLEADPSQVGTALA
FT                   AALGVGLLAGAWNGLLVAFVGMQPIIATLILMVAGRGVAQLLTGGQIIPIGAPGYLALG
FT                   GGYLATVPCAVWIALATIGATALLVNRTALGLFIRAIGVNPVATRLVGLRSGAVVFGVY
FT                   LCSGVMSALAGILASSNVRSADGNNAGLLLELDAILAVTLGGTSLLGGRFSLAGSVLGA
FT                   LIIQTLTYTTYSIGVPPEATLVVKAVVVIVVTLIQSDAARALLVRHASRLLPSARSRAT
FT                   TTGATPR"
FT   sig_peptide     complement(135689..135775)
FT                   /locus_tag="Bcen2424_5990"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.445 at
FT                   residue 29"
FT   gene            complement(135772..137286)
FT                   /locus_tag="Bcen2424_5991"
FT   CDS_pept        complement(135772..137286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5991"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5626 ABC transporter related; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5991"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12723"
FT                   /protein_id="ABK12723.1"
FT                   /translation="MQSPPVVEMIGIDKSFPGVSALQRVDFRLFPGEIHALMGQNGAGK
FT                   STLINVLTGVHAHDAGEIRVGGAPVNFAAPREAEAAGIQTLYQEVNLCANLSVAENIFA
FT                   GRQPMRRGAIDWKTIHARSRDALAELDLALDVTRSLDSYPIAVQQMVAIARAVSVDARV
FT                   LILDEPTSSLDDGEVARLFDVLRRLKASGIAILFVTHFLEQTYAVSDRITVMRNGEREG
FT                   EYLARDLPVDVLVAKMTGRERMSETLQAGAAAVERDTATTAPFLSMQQVGRRGMMSALD
FT                   LDVRPGEIVGLAGLLGSGRTETAQLAFAAARPDTGAIEIDGARKRLASPHDAVRSGIAY
FT                   CPEDRKKEGIVAALSIRENIVLALQARRGWWRLIGRARQREIADTYIARLGIKARDAEQ
FT                   PIGLLSGGNQQKVLLARWLATDPKLLILDEPTRGIDVAAKFDIMERVLALCAQGLAILF
FT                   ISSEIGEVVRVSHRIAVLRDRRKVAELSGADASEEQVYRLIAGGQS"
FT   gene            complement(137347..138309)
FT                   /locus_tag="Bcen2424_5992"
FT   CDS_pept        complement(137347..138309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5992"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bcn:Bcen_5627 periplasmic
FT                   binding protein/LacI transcriptional regulator; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5992"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12724"
FT                   /protein_id="ABK12724.1"
FT                   /translation="MTFIRKLAAGAIVAAATVLAGGAHAQQKPITLGFSQVGAESAWRT
FT                   ANTVSVKGAAKDAGINLKFSDAQQKQENQIRAIRSFIAQKVDVIAFSPVVESGWEPVLT
FT                   EAKAAHIPVILTDRGVDVKDPSLYVTMIGSDFLEEGRRAGHWLEERYKNDAGPINIVEL
FT                   QGTVGSAPANDRRAGLLEVIKNNPKFKVIASQSGDFTLAGGKQVMEAFAKTYGKQINVV
FT                   YAHNDDMALGAIQAMEEAGIKPGKDVSVVSFDATKGGFQAMVAGKINVDVECSPLLGPQ
FT                   LMSAVKDVVAGKQLPKRIVTNETVFPMNVAAQVLPTRKY"
FT   sig_peptide     complement(138232..138309)
FT                   /locus_tag="Bcen2424_5992"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(138591..139442)
FT                   /locus_tag="Bcen2424_5993"
FT   CDS_pept        complement(138591..139442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5993"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; KEGG:
FT                   bcn:Bcen_5628 pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5993"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12725"
FT                   /protein_id="ABK12725.1"
FT                   /translation="MLNTLDSVPSTTVAGRHVVFRTRGHAHGPVVRMVSPSDVGEMIKP
FT                   FVFLDLIDTRAPLGKPAFGWHPHSGIATLTLMIDGHGTYVESTGHEGPMRAGDIEWMSA
FT                   GRGVWHTGSVVPPVKAFQLWVALPPGRELAPAFSQHLSIDDIPTDGPARVLLGRHGDAV
FT                   SPVDAPPGINYVVVQLAAGERWTCRPPQGYRVGWTAVMDGRLRTPDPVGRGELVVFDAS
FT                   DAPIEFEAVTDARFVVGTAIPHPHDLHLGAYSVHTSAAALVEGEREIVRVGRELRAKGV
FT                   MR"
FT   gene            complement(139477..140082)
FT                   /locus_tag="Bcen2424_5994"
FT   CDS_pept        complement(139477..140082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5994"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   bcn:Bcen_5629 (acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5994"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12726"
FT                   /protein_id="ABK12726.1"
FT                   /translation="MKLLHIDSSILGQGSVSRELSAEIVARFRARDPGLTVTHLDLAAT
FT                   PIGHLTAGHLAAAQGAPADDALKADVEIGQRALEEFLAADIVVIGAPMYNFGIASQLKA
FT                   WVDRISVAGTTFRYDENGPVGLCGGKKLVIASSRGGVYSAGSPFASFDHQETYLRDAFG
FT                   FLGITDITFIRAEGVAMGPDKRTGAIASAKEAAAALAA"
FT   gene            140201..141124
FT                   /locus_tag="Bcen2424_5995"
FT   CDS_pept        140201..141124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5995"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5630 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5995"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12727"
FT                   /protein_id="ABK12727.1"
FT                   /translation="MLDLNDLALFVQVVRAGSFSEAARRLRMPANTLSRRIDQFEGHIG
FT                   TRLLHRSTRKLAPSTEGLALFERYAPALDRIFEIERQHADGQEPAGTVRVAAMAGLFEV
FT                   IKLEWLAEFYARYPRISIDFLLDDTPSDLIAERIDLALRIGIETGGSFRVRRIAPGTMI
FT                   LAASPAYLERRGTPRTPRELADHDCLTVSSRQGRSMWRLQGPRGTQEISIDSRFSVNDM
FT                   RVVMQACLAGLGIALVPQVLAAAAIDEGKLARVLPAYQRSGAGLGLQLVYTSRPPLPPA
FT                   VTAVAEFLLEKLGQGMSKCPEPAAGR"
FT   gene            141356..142384
FT                   /locus_tag="Bcen2424_5996"
FT   CDS_pept        141356..142384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5996"
FT                   /product="DNA topoisomerase, type I, putative"
FT                   /note="KEGG: bcn:Bcen_5631 DNA topoisomerase, type I,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5996"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12728"
FT                   /protein_id="ABK12728.1"
FT                   /translation="MKQPASSAAAALRHVDDRQPGYTRRRLRNGFAYYAQDGTRIRDAA
FT                   EIARIDALAIPPAYTDVWICADPLGHLQATGRDARGRKQYRYHPQWRETRDANKYARMA
FT                   AFARALPRIRARVTRDLALPGMPRDKVVATIVRLLDTTLARIGNAEYARENGSYGLTTL
FT                   RKRHLKIQPGQVRLRFAGKSGIEHDVTVDDARVARIVRRCAELPGHELFQYVDDDGVRH
FT                   PVGSSDVNDYLREAGGADFTAKDYRTWAGSVHALGLLRRIEHRGVTHARKQIVETVRAV
FT                   AELLRNTPAVCRRCYIHPAVLDAFEAGTLAALAVRRTPRGLRADEAAFVALLVSARRHT
FT                   AR"
FT   gene            142664..144133
FT                   /locus_tag="Bcen2424_5997"
FT   CDS_pept        142664..144133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5997"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_5632 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5997"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12729"
FT                   /protein_id="ABK12729.1"
FT                   /translation="MSPSQARPAKTRSSRQSIKLDDITIVDPAVLKRAVGAMAFGNAME
FT                   WFDFGVYSYIAVTLGKVFFPSSSPSAQLLATFGTFAAAFLVRPLGGMVFGPLGDRIGRQ
FT                   RVLAATMIMMAVGTFAIGLIPSYASIGIMAPILLLVARLVQGFSTGGEYGGAATFIAEF
FT                   ATDRRRGFMGSFLEFGTLIGYTLGAATVALLTATLSQETLLSWGWRVPFFIAGPLGLVG
FT                   LYVRLKLEETPAFKKEAEAREADERARPKQRFATLLVEQWKPLLQCVGLVLIFNVTDYM
FT                   ALSYLPSYLSATLHVRESHGLFMVLLVMVLMMPMTLYAGHLSDKVGRKPVMMAGCVGLL
FT                   ALSVPALMLIRTGGTLPIFGGMLIYGVLLSTFTGVMPSALPALFPTRIRYGALAIGFNV
FT                   SVSLFGGTTPLVTAWLVDRTGDLMMPAYYLMGASFIGIVSVLALRETARQPLPGSGPCV
FT                   ASRAEALNLVRGGADEARVRDRKFTPVSERA"
FT   gene            complement(144180..145004)
FT                   /locus_tag="Bcen2424_5998"
FT   CDS_pept        complement(144180..145004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5998"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_5633
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5998"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12730"
FT                   /protein_id="ABK12730.1"
FT                   /translation="MPVHGIHGSTLHYLDRGAGFPVLLGHSYLWDATMWAPQIDALSRR
FT                   YRVIVPDLWGHGESGALPDGTHTLDDLATQASALLDALEIDQCAIVGLSVGGMWGARLA
FT                   LREPRRVRSLVIMDASLEAEPDATRARYFGMLDAIEAAGRIAPPLLDAIVPLFFRPDAD
FT                   LDDPVPTAFREALANLPADRLRQSIAPLGRLIFGRPDTLATLAELDAARTLLMCGAGDM
FT                   ARPPSETVKMASVIGCAHALVPDAGHISNLENPAFVTRTLLDWFDAQQLPSN"
FT   gene            complement(145158..146150)
FT                   /locus_tag="Bcen2424_5999"
FT   CDS_pept        complement(145158..146150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_5999"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5634 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_5999"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12731"
FT                   /protein_id="ABK12731.1"
FT                   /translation="MANVRLAKRLRSLPSLDFLRGFECAARHLSFTRAGQELNVTQSAV
FT                   SRQVKALEEQLRIELFHRHIRSLTLTDKGRELYDAISFALSDLESVVGKLSSSVGQRSI
FT                   SLSTTVSFAALWLIPRLGSFRASYPDIDVRVSATSEIEDLKRKRLHLAVRYAGPYTSTD
FT                   DTDVLFRERVVAVCSPSLMTAAGDAASMQPADLDKHVLLHLDDPRGEWPWHGWSHLLKA
FT                   LGVPRLRPAGALHFSQYDQLVQAAVDGHGIAIGRRPLVDGLLRQGRLVELFPHCTVASG
FT                   SYVLVQNPDACNEFDIAVLTNWLLEQACQPLASEQDTAGSNVLPMYRVG"
FT   gene            complement(146770..147621)
FT                   /locus_tag="Bcen2424_6000"
FT   CDS_pept        complement(146770..147621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6000"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6000"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12732"
FT                   /protein_id="ABK12732.1"
FT                   /translation="MLYPELFRSLEAVRWDMEKDIPWNRFDPALLTDEQAETIRMNAIT
FT                   EWSALPATEMFLRDNRHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFRPERVPTEAELHA
FT                   VRFEFDPAPPLETLMLHFCGEIRLNHWYRCAADWHTEPVIKQIYETISRDEARHGGAYL
FT                   RYMKKALNDCGDVARAAFAKIGVLMASARRTEKPLHPTNLHVNQALFPRDTVQSRLPDP
FT                   AWLERWLDEQIRFDGEWEKKVVERILHNLSILFERTFATAQELNRYRREVTARANGAAD
FT                   HA"
FT   gene            complement(147660..148607)
FT                   /locus_tag="Bcen2424_6001"
FT   CDS_pept        complement(147660..148607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6001"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: bcn:Bcen_5636
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12733"
FT                   /protein_id="ABK12733.1"
FT                   /translation="MKSRPSGVVFSLKLVVYAALIAHGMMFALSALVILKIVGILLIGA
FT                   MYAHGVELQHQALHYQGFRSKRLNMVFGVLLGMPMLVSFHAYQDSHLRHHRLLGTPENK
FT                   EFFDYGDQYGASPVVNVGLWAWRLSMAAHYIQFAKNVAKLVVPGARFGDNALVSRAIRR
FT                   DYLLMAAAIALLAALSFALHTWCVVWVWVVPLVFVAAPVHALVEMPEHYRCDLTSTDPF
FT                   RNTRTIESNAFMTWFTNGNNYHVEHHMMPSLPIERLHDLHGAIAPRIRYYHRTYRQFYY
FT                   ALLRGRLSPRSVDDDRDDREPDAEAAAPASTQSA"
FT   sig_peptide     complement(148515..148607)
FT                   /locus_tag="Bcen2424_6001"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.351 at
FT                   residue 31"
FT   gene            148989..150791
FT                   /locus_tag="Bcen2424_6002"
FT   CDS_pept        148989..150791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6002"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_5637 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12734"
FT                   /protein_id="ABK12734.1"
FT                   /translation="MARAAVFLKGRILVTKYASTIHRLIESLEDVAGAMHRMTFVDDAG
FT                   HEAGITYRHFAEEVFRQAGALRELGVRENDLVMLALPASVEHAAAMMACVMTGALPCTV
FT                   PVPMRRAAAGRQVADVACELYRPRLVVAADAQAAAWRDDAFPAAATRVVDLATLSSAAD
FT                   AGARALISSKSGRDPHHVQLTSGSTSHPKAAVLSHENVIANVLGIGGSVRFDIAAGDGT
FT                   ASWLPLYHDMGLLTLLSNLHYRAPLLMMQPNSFIRNPLGWLKRIASARATTTSVPTFAL
FT                   RYCVRRFNAAAMDGVDLSACRNIFIGGERVDDATLRDFAATFAPYGLAASALQPCYGMA
FT                   ESTLAVSMHRAWHEGAVDGAPYVIADTLDRRALIERRDAQPAAANDGQDTETETVLAMG
FT                   TPIDGMAFRILDDGGHALANRAVGEVAIRGTSVMLGYLNPDDGTIAAPLTADGWFRTGD
FT                   IGYVADGQLHILGRKKEVIIIRGSNYFPHEIEEALASHSALRKSTCIAFGLPDPETGTE
FT                   RLVVAIEARPVDATPQTRTECQQLLASRIGFAAQDLCFVEPGSLPRTTSGKLQRLKCRD
FT                   LYANGALPVIPASAAVEAVQGAFA"
FT   gene            150788..151498
FT                   /locus_tag="Bcen2424_6003"
FT   CDS_pept        150788..151498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6003"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5638 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12735"
FT                   /protein_id="ABK12735.1"
FT                   /translation="MTAASLAPVLELRDVTRTYEGAGRVVAVRGATISIGRRDVVALVG
FT                   PSGSGKSTLLNLAGFLDVPTSGERWLEGRRIDDAPDTLERIRRERIGFVFQQFNLIPVM
FT                   SALENVELGCFAWGTPRTRRERARAMLDAVGLAARERHRPGELSGGEQQRVALARALAK
FT                   EPAIVIADEPTASLDSTNARAVAELILDTNRTLGTAFLIASHDDRLCAHLPRRIEMRDG
FT                   VPGVNRELVDVCVA"
FT   gene            151470..152687
FT                   /locus_tag="Bcen2424_6004"
FT   CDS_pept        151470..152687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6004"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bur:Bcep18194_C7413 ABC efflux pump, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12736"
FT                   /protein_id="ABK12736.1"
FT                   /translation="MNWSTFAWRNLWRNRRRTVLTMAMIGVAAFASSLALGYVIATFDA
FT                   VREGSIDSGVGHVQVLHHGYLDLIGERPLQYGLTADEQTAATQAIAKLPGVATTARGID
FT                   FDGLVSNGDLSYGFVGEGIEPNREPPGFFDYHTVLSGRYLSPTNAGTEVVVGAELARKL
FT                   GVHVGSVVQLMASTAHGGINATDAQIVGVMSTGNKDVDERIVNVTFTAAQALLRTDRAS
FT                   RIAVFLEDTAGTPAAAATLRAALPTLDVRTWDQLVSLYHQVVALYKNQFSVFGAILCVT
FT                   ILLSMSNWILMSIVERRREISTLRALGVPAATVRGVLIQETALLGLLGAATGIALALLT
FT                   MVALNHAQIHLPAPPGRVKPILLEFTVSPVAVAAVEAAFVVLGVVAALLATLGLAKRNI
FT                   LEGLAP"
FT   sig_peptide     151470..151583
FT                   /locus_tag="Bcen2424_6004"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.663 at
FT                   residue 38"
FT   gene            152684..153436
FT                   /locus_tag="Bcen2424_6005"
FT   CDS_pept        152684..153436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12737"
FT                   /protein_id="ABK12737.1"
FT                   /translation="MNRIRLTFAAFAALVACAPLAAQAADAPTAQTMLARADAYRSTAA
FT                   DTQTNIRITNEVGGQSGDATRYLVYTRGNGDTLALTRSGENDGQKYLATTRGHWFYVPN
FT                   TRSAVRINGMQRLQGEVVISDITRTHWADSYRATAAPGTTPIAGKPATELDLTATDPDN
FT                   VYPTIKLWVTPDTDVPVRAQFFLASGLLFRSADFSAPVDANGRKVIRKITYRNEVEKQR
FT                   ASVVDILDGQPRKIPSGWFNPDTLADGQ"
FT   sig_peptide     152684..152758
FT                   /locus_tag="Bcen2424_6005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            153426..154754
FT                   /locus_tag="Bcen2424_6006"
FT   CDS_pept        153426..154754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12738"
FT                   /protein_id="ABK12738.1"
FT                   /translation="MANEYDADADAHRDRLHSSPERARRGWPGVALAIPLALGCTLAHG
FT                   ESLMDQLGTLNGIGYARTVDSMDGRALLGRLIGDSPRNQQEAGLLARIDGENLFVNARV
FT                   VASNHSLGAQASRFNEAGVRYAFDNGITLTAGKRIDTLDTSQAFFPLGFFQKRAATADI
FT                   YDRYGDVEGTPLVEAKWAGEQTTLQFIAGENRTLRNDVDNRDVQGATQLVRGAYNWSGG
FT                   SAALLAGRHAGRGGTGATLSFDVARSNTVYASAWVERGTTRPLPAFIANGTPLDTAAAY
FT                   DAVDRRNDRQYMWRNALGMQSALPGNLSLIVEWSHDEARYDANQWRRMVGAVQANNALL
FT                   PVAPGAALAGLGGTANFVSVDGSLRDYLFARLGKKVGRVEYSLRGVYSPQDKGLLAIAQ
FT                   VVADVNQRVSVDVALTHAFSDSQSEYRMVGLGTRIDAAVRVRF"
FT   gene            154768..155853
FT                   /locus_tag="Bcen2424_6007"
FT   CDS_pept        154768..155853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12739"
FT                   /protein_id="ABK12739.1"
FT                   /translation="MSTLSAPAPIAPPLLLRVADQAAYPVLRHLDAIGTPPHAAARLVE
FT                   AAAVRLLDSEMVIALRSTAPDVLPDASASTPLRHDEAPLTEALLEQIGREGFHHLFKPF
FT                   MRAFIRIMFGLFFSDDQNRRACECIDAGHNFAFLMSDGGGPTLAAWRTVVRSDDNGLAL
FT                   TVDKVWGIEAHRDCMAVVAARLPGVMFPAAYLVWPDEYRKLKRSTCGAPFLAGNLQLAN
FT                   VGGQVRVAAEDRLRIGGPTVFNKYLTVVRPYFVRALMAHVGWLERTGRVELDADARAVH
FT                   RFIADAARSQTDDAHYSFGKVQRVLAIKLLSNEFLSALVRDGKVPLFDDQRDLLAFSKM
FT                   EGSSYRCYHELRKSLRCEAGS"
FT   gene            155912..156166
FT                   /locus_tag="Bcen2424_6008"
FT   CDS_pept        155912..156166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6008"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   bcn:Bcen_5643 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12740"
FT                   /protein_id="ABK12740.1"
FT                   /translation="MTTQNVPADALDILSREVAKILNVETVDTDAGIGELGIDSLNIVE
FT                   LIVFCEQLYGSIDPEALNITQYTTLQQLDAQLRSQQHAA"
FT   gene            156174..157049
FT                   /locus_tag="Bcen2424_6009"
FT   CDS_pept        156174..157049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12741"
FT                   /protein_id="ABK12741.1"
FT                   /translation="MLAPLAPMAAAAVQPAPATALTVQALAYRRVAPSRDGAAVPLDDT
FT                   ARAIGTLACAERERLCGAIGADDYVVSSTILSMLLMNDSPQHRVFAQSLAGANDYTPDW
FT                   MTCSYECAGWGYVLRRALATAAETGPRTLLLQIVDVDVHGYTYWHGNPAWGRSGFGVCT
FT                   LLVDVGREPAQSVIADAAPPASAVVRLGRDIRTFCAARPGLHAALPFFPATSRRALLAS
FT                   VGKTPLLPDGHGVFGHAFGSDPWLSVLLAHRDGDTPRRAAVCSLALNGYYAIADVAFAP
FT                   DATFSLDGEA"
FT   sig_peptide     156174..156236
FT                   /locus_tag="Bcen2424_6009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.979 at
FT                   residue 21"
FT   gene            157051..157680
FT                   /locus_tag="Bcen2424_6010"
FT   CDS_pept        157051..157680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12742"
FT                   /protein_id="ABK12742.1"
FT                   /translation="MVRPVHFTYRIERDARQPVAVAASAYRMPLDTPADYARAALAEAA
FT                   GDAYDAGNTSDVAGGERRVLLDHVQYFAFLAEVTARIRDAVHPDARLFIEVCAPYFGAL
FT                   PAELLAPHVLLGVHLYDEALRDASRGAPVVWIGDRILRDAEFAGDNRVCCAIWPARLAD
FT                   AFDAQLRGAWPSFAIRVEPHPGASRAAAPFTDSAHYSGAAARPGRP"
FT   gene            157682..158665
FT                   /locus_tag="Bcen2424_6011"
FT   CDS_pept        157682..158665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12743"
FT                   /protein_id="ABK12743.1"
FT                   /translation="MNDTLTVMQDTADIRWSMPVDALMSNDYALREEALNRLYEKAKAA
FT                   QWDVATDVDWSHNLDPANPLGMPDPTLLIYGTELWGKLADADKREVRHHAQGWLLSQIL
FT                   HGEQAALICASKLASAEDGLSARLCAAAQMMDEARHVEAYAKLVNEKLDVSYPMSRSLK
FT                   GLLHDTITSSALDMTNLGMQVLVEGIALSIFQSVVAYSTDPFIKDLFLRIQRDEARHFA
FT                   VGRITLCRVYAEMSSHELREREEFICEGAAVLYEHLCADDIWEPMGLSKRECSAMVRES
FT                   PVSSSIRRSIFRRLVPTIREMGLLTPTVQATFEKLDVLDYAAMPLN"
FT   gene            158669..159652
FT                   /locus_tag="Bcen2424_6012"
FT   CDS_pept        158669..159652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12744"
FT                   /protein_id="ABK12744.1"
FT                   /translation="MTTISSQASRDFWIGIDAVAYELPGPPVDIEAWAAERDYPAQRAA
FT                   AIAQSGSRYFHMALDTSETDLAIAAVGRLLDTARVHPSDVGAIVHVHTQQFSVPPAPRS
FT                   LPHEVAAQFGIEPLWLGSVAQLNCVSVAAGIETVRALMRRHPQLDAALVVSSDRVYGED
FT                   YRMRQMTGVQCDGAAAMLIARNSTKNRLGGIAIETHAKWHRGSDTVAANEADLIMMEWP
FT                   YTRRAIDAAVALEPHALDAYDLVLPHNADLPGWNALCRAMRVPAERLYSDNIHARGHAC
FT                   CSDFPINLADVGLDALAHGRRVLGVMQSNCGAYAAATLHPVGRHDA"
FT   gene            159642..160817
FT                   /locus_tag="Bcen2424_6013"
FT   CDS_pept        159642..160817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6013"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   bcn:Bcen_5648 Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12745"
FT                   /protein_id="ABK12745.1"
FT                   /translation="MTPERPLPAAADHAWIADLRTPCYVYEPEVAIARYRSLKARLGTR
FT                   LIVSLKANPNQDMLARCAHAYEDGVELASRGELDAVIGRIKTPRYLNNPSMDEMFMRAG
FT                   LASRCHFVLDNPDAVARFVPLAREAAAGGSTPGAVLLRVNAGALAGEQARALWHDHFGM
FT                   TPNEAHDAVRTLAAAGLPVAGLHVFSGPHSFIRQDPTQPDTLVLPELLAALARDLAPAN
FT                   GAPLGSLSLGGGFADDHPGDAAFDRYAAALAPLAGPYSLAHESGRAIFADAGVFATRVV
FT                   AVKTWQDRTIAVCDGGLSHAFLLAQTESVMRRLAAPSLVRRTPAPPPRGVPTLYVGSTC
FT                   SRADVIGRDDAGAPPQVGDIAVFERCGAYHRTYSMAHFLSHEAAHVYVRPA"
FT   gene            160834..162429
FT                   /locus_tag="Bcen2424_6014"
FT   CDS_pept        160834..162429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6014"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_5649 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12746"
FT                   /protein_id="ABK12746.1"
FT                   /translation="MNALISIADLLEHGAERWPHHPAYADGGGTLTYDQLARAVRRAAA
FT                   VLAARGVQPGERVAIYAPKRVETVVAMLAANALGAIFVPVNPQLKEAQIEHIVADSGAA
FT                   LFVTGAQRLKRLPALAALVGARTLLIEELADAIESPGTDTPASASAAAAAPAGRPVDDD
FT                   PAALLYTSGSTGKPKGVVVSHRNLVSGAFSVAAYQRLAADDVVLGVLPLSFDAGLSQLT
FT                   TALASGACYTPLDFLQPAEVPRHCDAFGVTSITGVPPLWMQIASAGWSDTARTRLRRFA
FT                   NTGGHLATPLLHRLQALFTQASPYLMYGLTEAFRSTYLAPADAALRPTSIGKAVPNAEI
FT                   LVLRADGSECAADEPGELVHRGAFVTLGYWNRPELTAQRFRPLPRRHGEIPRPDVAVWS
FT                   GDIVRRDADGYLYFVARGDDMIKTSGYRVSPTEVEDVLFALPHIREAAVFSVPHPALGE
FT                   AIAACVVSTLDADACRADIARACRDALPTYMNPLVVEPLPTLPRNPNGKIDRPALKAQY
FT                   RDAFARPNLEETAA"
FT   gene            162426..163520
FT                   /locus_tag="Bcen2424_6015"
FT   CDS_pept        162426..163520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12747"
FT                   /protein_id="ABK12747.1"
FT                   /translation="MSLSTLDETCVGAPRVAAPGTLALSGGVVVLPPAVVFSAIQAQER
FT                   HPGYRHLLLPQARFARPRGMGALTPDEGTRLAPGGRPALRVAPPGRSLADLAADAALDL
FT                   RDQLGSGALARTTHVIVASCALNEGIGDSVVGRMQYELGLQRVTPFALGQNGTLGWYSA
FT                   LMLLDGLLLDEGDQALVILSDKWLYPFFRQFGDLVGYGDAAAALLVSRAGPAPEPAAWG
FT                   GVRSVALEFGPSITDPWADAPTALRDTLAPVAARAIRRALEQANLRANQIDWCVPPGFD
FT                   PGFAARVADAASIPVAARIQHDGSGHLSSAESAAALIRLAGALDEGERRTVLVWDAALH
FT                   GAAAAAVVDLAGGLDAALDIEGDA"
FT   gene            163517..165370
FT                   /locus_tag="Bcen2424_6016"
FT   CDS_pept        163517..165370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6016"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bcn:Bcen_5651 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12748"
FT                   /protein_id="ABK12748.1"
FT                   /translation="MMSAYKVSLRELRFFLWELFEADKRFLAEHGLYGTHDRASIDALL
FT                   ERARDFALDLGRSYQQADVEGCTLLDDGQVRIPSHFHALWARFRDEWSNTLFGTAHGLP
FT                   PIVTQMIYEMFMGANPSFMTYGGFTRPAVKLLQMHGTPHQKALIAPLEAYRWDACFCAT
FT                   EPQAGTDLTAVALRATPLERDIYAIDGEKVYISAGMHELTENTLYFVLGRIDTASPDSF
FT                   SLSCLVVPRFWPDEETGELQPNHVDCIGLPRKMGLKGCANTHLVFGSNGTTKGWLLGGR
FT                   RNVGLLQLMPLMNQARMSTGMFGVGVASSAYLHAVEYAGRRLQGRPIERASNTHAARVA
FT                   IVEHADVQRMLVDMKSRVDGCRGLLGKLAATATRAAMLEATPDADPAEIERHRKLQLLL
FT                   TPICKAFISDQAWRICETAIQVHGGLGYTDASPVEQNARDVKILSIWEGTNYIQAQDLV
FT                   RDKLGFGRHSRLIQYYRDELDAFLAQQHHAGTHAELRPLFDALRVGADRIAAALDDIAR
FT                   DVQDGHTHRSSQFYTRFLEMFGVVTSAWVLLESATIAARRLDAPDTADAPAELAFYRGK
FT                   LKSARYYFANVLPVVDQHAAVIAAMAHAAISVSSDELAAVE"
FT   gene            165372..166622
FT                   /locus_tag="Bcen2424_6017"
FT   CDS_pept        165372..166622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6017"
FT                   /product="citrate synthase-like protein"
FT                   /note="KEGG: bcn:Bcen_5652 citrate synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12749"
FT                   /protein_id="ABK12749.1"
FT                   /translation="MDTTLDSSTSATTTATGAAPRNLLGRPTTRHRGTDIDGATLAPEA
FT                   LRVRDLDLNALIGATTFEGALAHLWFDVAPGSTDHRAHEAAIAARLAAFADALAPGSVA
FT                   QSVAADLGAAGVAPVFAAASGLLRGLDDVTDRARGPAPDDADLDTMLLCAAAAPFLLHA
FT                   AIEGRPFAAGPQARGGTALDAAQTQAQRMLVLTGATRGDAPAQAAMDMLLVAWHAGFGY
FT                   ITPTVLAPRVAIGTGVTLTQAIASGFLASGPSHVGAALEAMQWLAALARSIPGGTDAPA
FT                   AALDAAGRAAIDAALDAKRTLYGFGHPLFVADPRPPHIRSRLTEEDFDGAYVSLFDACC
FT                   AQADARRALRPNIDFLTAATLLELGVAAPSWGVGIGLGARIAAMAAHAVERRRRPAFGV
FT                   NSATARRLLAAVPVGWL"
FT   gene            166651..167313
FT                   /locus_tag="Bcen2424_6018"
FT   CDS_pept        166651..167313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6018"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: bcn:Bcen_5653
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12750"
FT                   /protein_id="ABK12750.1"
FT                   /translation="MLLKNLRPANDYDRFATETLEPWDLLFISRIRQLARGMTAGTIAD
FT                   IGTATGVVPVRLATDPAMRGWRYVGIDLDPAMLDEGRPRIHELGLDDTIEMRVGDALAL
FT                   PFDDGTLTMAVGRATLHHLPDKALSLTEMYRVLEPGGIALVHDMRRDAPQHLLDRFTEM
FT                   RAAADYPPTHVEEKITLDEAHALVAEAGLAEVASIYSPSMGLGALGFEILLKKPALA"
FT   gene            167317..168390
FT                   /locus_tag="Bcen2424_6019"
FT   CDS_pept        167317..168390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6019"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: bcn:Bcen_5654 taurine catabolism dioxygenase
FT                   TauD/TfdA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12751"
FT                   /protein_id="ABK12751.1"
FT                   /translation="MTDLAFLAAHAAVRLGADDVHCAPVAPGATLPLCVTPRSAELATS
FT                   PEMFVAWYRSRLDTIDMLLDACGALLWRGFAVPDTAAFGRLGALYPAHANGYTAGAAPR
FT                   KQIDGQVYESTRMPPPFRIGLHQEMAYMPAFPRLVAFYCRQPADAGGETPICDMRRVTA
FT                   RVPAALRERFAERGVMYLRNFAAPGDRADGLAANPNLPFAAYHRPWDDAFGTTERDEVE
FT                   RLCAERGVGCRWLDDGSVTVSHVGSALRTHPRTGETVWFNQASAQHPNPRSMGELSYRY
FT                   LQRMYGARAAFPYEIRYGDGAPMPFDDLVAIYDALDDEECAFPWQAGDVLVVDNMLVAH
FT                   GRNPYRGARDTQVMLFD"
FT   gene            168402..169415
FT                   /locus_tag="Bcen2424_6020"
FT   CDS_pept        168402..169415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6020"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5655 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12752"
FT                   /protein_id="ABK12752.1"
FT                   /translation="MSVSFLASVRAMFAPRAAFDRPRRAGTPPLPDAHAPGAALGARAI
FT                   DVAAGDFRFSARHVRFRLGAITAIVGPNGSGKTTLLETLLGFRRGGSDVRVLDVPAERF
FT                   MCDSRSLQRIGAQLQKVEYPDHLRVSEIVALHRAMYAHTDAAITDALGIAELLDKPCRA
FT                   LSKGQRQRVDLYVALAHRPELAVLDEPFTGLDRRYAGVVIDLLRHRASGTSVAMICHSE
FT                   EELSVVDDLVWVRDGGVRYQGDQDTLRAELVGDARAVLHCRDAADARALRKRLAALPGV
FT                   TGVRVSAAHVVEAFGDATLHPNVHRIVGEQGIQHLALAPSTPGDLLRLCTEGPTHD"
FT   gene            169408..170487
FT                   /locus_tag="Bcen2424_6021"
FT   CDS_pept        169408..170487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6021"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bcn:Bcen_5656
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12753"
FT                   /protein_id="ABK12753.1"
FT                   /translation="MTKVFLILVRNELLGYLRSRSSLFWTLVFPVFLLSVMLFAFGGSG
FT                   SLGTADIAFDVPGGATPYNQACKAEIVASLSHSDTVKATFGGRGTPAERVTVVLGADER
FT                   TPATIRYDFNGSLAVKAASRVVEIALARCAAQRLGLPAAQARFENAAPTRRPFDYGAFF
FT                   ATGILVMAFMAIGLNSTTTAIAALRERNTFKLYVCFPVSRGVFLAALIVARMAMMALSA
FT                   LVLLTVARVAFGIALPIATPDGLRALPIVLLGAAMVLSIGVLLASRTRSLAAAELACNV
FT                   TYYPLLFFSDLTIPMHDAPAWLKAGLAFLPTNQFAVALRGALVDGAPYAQLAPQLLGMT
FT                   ACTALFLFAAARLFRWHDA"
FT   sig_peptide     169408..169557
FT                   /locus_tag="Bcen2424_6021"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.409 at
FT                   residue 50"
FT   gene            170524..171066
FT                   /locus_tag="Bcen2424_6022"
FT   CDS_pept        170524..171066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12754"
FT                   /protein_id="ABK12754.1"
FT                   /translation="MKSNHPITDYLLHASNFLPAIVFLFYGRLGPEQPDLRWTHAFLIG
FT                   GVLALVHGAWLMRRAERNSIALGVDLFLVIGAVLALVSPTGSRLWGEELGPAAMLVCVL
FT                   VVGIVHTAWSDGGFVDGTFVDHARTRPLSLVLLAVTVVALAVSIAMRHSPLWGGVVPLI
FT                   ALVVVRGRLRKQLARAS"
FT   gene            171069..172487
FT                   /locus_tag="Bcen2424_6023"
FT   CDS_pept        171069..172487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6023"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bcn:Bcen_5658 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12755"
FT                   /protein_id="ABK12755.1"
FT                   /translation="MNALPAPAAYAAQRHALAAALGDGWLEGAACEPYATDVVQHGGVP
FT                   LGVARPASTADVRALARVAVAHRIMLVAQGARTGLVGAAVPDRSGTQCVVSFERMRTVR
FT                   AFNPANRSITVEAGVRLSDINRLAGEAGLCVPIDLGSDPAAGGLVGANAGGSRLIKYGD
FT                   VRRHVLGVEVVLADEAGTVIDALAPLRKRNAGFDVAQCFIGANGANGLVTAVSFALAPL
FT                   ERSSCAAFVAFASYDAALAGLLAFERAFGELLSAFEFMSAAAVGCVAAAFPTLRVPFEA
FT                   DAAACYALVEIATGMPGLDALLEERTVATLDTLANERVVLDAACAPAERFWRIRDALPA
FT                   AVAQDGLPLSFDVSFPRGALAGFVADAEQWLAAAHPALRCHAFGHFGDGGCHLVVSIPH
FT                   AEAARYGPLQQVALRGALYDRVVQAGGCFSAEHGVGPVNIAYYRKHVPAAQRQVASAVQ
FT                   HAVDPLGLIGRVRY"
FT   gene            172487..172771
FT                   /locus_tag="Bcen2424_6024"
FT   CDS_pept        172487..172771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12756"
FT                   /protein_id="ABK12756.1"
FT                   /translation="MHSFDTPRRIRMMSPRPPSPAVTAEPDDDSSPAGIPALPDSGAMV
FT                   NVRGVAHVIELPPRDHARPALWRELALWRNDRSADDASDGDAEPDTPRG"
FT   gene            complement(172797..173888)
FT                   /locus_tag="Bcen2424_6025"
FT   CDS_pept        complement(172797..173888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6025"
FT                   /product="3-carboxymuconate cyclase-like protein"
FT                   /note="KEGG: bcn:Bcen_5660 3-carboxymuconate cyclase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12757"
FT                   /protein_id="ABK12757.1"
FT                   /translation="MKTTLLRRAVAAVALTMAASLAHAATYAYVSNSDSRDISVFSVDT
FT                   ANGALTAIETVPVDGTVMPMALSPDHRRLYAALRSTPYRVVSFAINPLDGRLIELGRAP
FT                   LADSMAYVSTDASGRYLFSASYGGNLLAVNRIGADGVAGDVRQTVKTGPMAHAIRQSPD
FT                   GRYAFASVLGADAWLRLPFDASTGILTDDTTPAYRLPDKSGPRHFVFSSNGRFAYLIDE
FT                   LDGKLHVLALSHGDADARPIQTVSILPPDFHGDKPWGADLHLTPDGRFLYASERTSSTL
FT                   AGYRVDATSGRLARIGTFATEQQPRGFAIDPSGKYLLAAGQLSPTLAVYRIDGHTGHLD
FT                   AIGKYPVGKGANWIEIVTYDGTN"
FT   sig_peptide     complement(173814..173888)
FT                   /locus_tag="Bcen2424_6025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(173987..175339)
FT                   /locus_tag="Bcen2424_6026"
FT   CDS_pept        complement(173987..175339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6026"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: bcn:Bcen_5661 TRAP
FT                   dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12758"
FT                   /protein_id="ABK12758.1"
FT                   /translation="MELAILSVSFLIFLVLGVPVSFALGIACVLTYMVEGLPIATAMQA
FT                   MISGMNAFSFLAVPFFIFSGELMLHGGIADRILRFAQATVGHFRGGLGMANVVACTLFG
FT                   GVSGSPTADTSAMGGVVIPLMKREGYSAAYAVNVTTHASLAGALMPTSTNMIIYAFAAQ
FT                   GITGMLHGQPVSGVSIGDLLFSGLLPVLWVMGFVLAAAYWQAVRHGYPRREDGSSALPR
FT                   FPGWYAVLRSFVGAVPGLMVIAIILVCVAKGIATATEAAAIAVVYSLVLTAVVYRTLTA
FT                   EKLRRALSHAARTTGVVLLLIAVSNMLRFQMSYLEIPDAIEGLLKQSTAAPWLMLLYIN
FT                   IIQVFLGTFVDMAAHILITTPLFLPIAMACGVGPVQFGIMLLLNCSLGLVHPPIGSVQF
FT                   VGCAIGNVSIGETTKMAWPYYLAIFSAINIVTYMPFFSTWLPSLISGHAVF"
FT   sig_peptide     complement(175268..175339)
FT                   /locus_tag="Bcen2424_6026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.910 at
FT                   residue 24"
FT   gene            complement(175344..175916)
FT                   /locus_tag="Bcen2424_6027"
FT   CDS_pept        complement(175344..175916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6027"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: bcn:Bcen_5662 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12759"
FT                   /protein_id="ABK12759.1"
FT                   /translation="MTRRTSLNSAAAAGGSAAAPDGTPPARPHAASLLRCVNDVLFRVL
FT                   AVIASSCLAVLTVLVFYAVVMRYVFENAPDFVEPIALLLVIVIAMFGAAMKVRDGGHIG
FT                   LDSLVRRLSPKARTVVIAIQHLSLIAFAIMIMIGCGSMAVETMGDRIPIIGLPEGVRYL
FT                   ITMPAAVAIIFFSLEHLLALRRSSSGQ"
FT   sig_peptide     complement(175860..175916)
FT                   /locus_tag="Bcen2424_6027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.860 at
FT                   residue 19"
FT   gene            complement(175913..176899)
FT                   /locus_tag="Bcen2424_6028"
FT   CDS_pept        complement(175913..176899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6028"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: bcn:Bcen_5663 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12760"
FT                   /protein_id="ABK12760.1"
FT                   /translation="MKHRFTGSRTALAVALMAGFAMSAQARVFRSADVHGDNFPTNMAV
FT                   KFMGDALSKQTGGKDSIKVFGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLI
FT                   PSFPFLFRDVDHFRKAMYGPAGQKILDAFTAKGMIALTFYESGARSIYAKRPVRSPADM
FT                   KGLKVRVQPSDLMVDEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHYEV
FT                   APDYSETQHAMTPEVLVFSKKIWDTLSPQEQAAIRKAAADSVPYYQKLWTAREASAQQL
FT                   VTKGGAKILPAAQIDRAAFVKAMQPLWIKYEKTPQMKQIVDEIEATK"
FT   sig_peptide     complement(176819..176899)
FT                   /locus_tag="Bcen2424_6028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.931 at
FT                   residue 27"
FT   gene            177482..179659
FT                   /locus_tag="Bcen2424_6029"
FT   CDS_pept        177482..179659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6029"
FT                   /product="glycoside hydrolase, family 28"
FT                   /note="PFAM: glycoside hydrolase, family 28; KEGG:
FT                   bcn:Bcen_5664 glycoside hydrolase, family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12761"
FT                   /protein_id="ABK12761.1"
FT                   /translation="MTLPLSRPNVRPNARPNRRPRVLGLLAALLATAAALTACGGDEAS
FT                   TGGGAASTAPPATSVFQVGTTTVDPNLPAEPALPADTQVCSTLEAANTLVSRPDGSLPP
FT                   EADPSTAGVGKAVPAATANPDQARIQAALDACGAAVDAEVGATIAAADAAATAAQKAAA
FT                   APNVNLAGASGEELAKPKYRASKFAVRLVVNHAGPGNGFISGPLTLPSGVTLWIDKGVT
FT                   LYASRDVKAYSPNAAGPYCGNTAVSATKAGSSSNCAALITGTNLVNAAVVGDGRIDGRG
FT                   YAELVTSDAKYPLMKVDLTCSNTYAAYKSGTVAPDGTACDDGGTVVDSKSTVRNMTWWD
FT                   LAYLGNMVQNGTTGFGSQSNFRLMVFNYAKNLTLYRITLNNSPNFHVVPSGVDGLTIWN
FT                   VKVQTPTLAAFANPAGNGNPLYNGQTFNADNVKNTDAFDPGAASKPTSAALSTGSTTTS
FT                   AAAISFDGYLKNFVFAYNYVSTGDDDIALKGSNNPAPAGSGLFGIDGNRDVRADRKWGV
FT                   VIAHNHIYWGHGISIGSETNGGVTNVQVYDNAFRDSEEGLRIKSDYARGGEVSNIHYAN
FT                   ICIRDAKNALLFTPYYSTKAVPASGPLYPNFHDISLANVVIEGAAGVKLQGFEANTGGY
FT                   GEPAFPLVMSLTDVVADTPDSIATIASDANLTLRNVNLPVFPSTANRVAVNGTAVHAID
FT                   PASVLDCSKAFVDFPGIDQSNPFGSTWAPAL"
FT   sig_peptide     177482..177604
FT                   /locus_tag="Bcen2424_6029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.664 at
FT                   residue 41"
FT   gene            complement(179980..181071)
FT                   /locus_tag="Bcen2424_6030"
FT   CDS_pept        complement(179980..181071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6030"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="SMART: regulatory protein, LuxR; KEGG: bcn:Bcen_5666
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12762"
FT                   /protein_id="ABK12762.1"
FT                   /translation="MQMNGLIPSAWIDDVYAAALGDQRWEAVLDGLRLTVGTRMATLLS
FT                   FDDAARMPAIERAAGDDPSWVAACHHRYNTEFYLYDPVVPVAADWPAGRWFEDVKHLSV
FT                   RQRTHGVFYREFMHPFGLGGISGLYIHRGEGAGAFLSVQSGPESHGLSDAQRRTIEIMG
FT                   GHISRALRIHARIGELEARVAAAESALDAVPVPVFLLGPRRELRYTNRAADQLIAAEPA
FT                   LRIVNGRFAPEGCVDDTQWRYAFARGGLLLRRTTGEPLPLALIPVPEQSRLARERPGVA
FT                   ALMTAADLRAPSARAQRLRVFYGLSSAEAELAVLLCCDGRSPQECAALRGVSIGTVRAQ
FT                   IKSIYTKTDVARAAQLTSLVMQT"
FT   gene            complement(181366..181617)
FT                   /locus_tag="Bcen2424_6031"
FT   CDS_pept        complement(181366..181617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12763"
FT                   /protein_id="ABK12763.1"
FT                   /translation="MLARDYVERELSHIQRMVALLDSETDVDDVSMSGAARVRHPSYWR
FT                   GRIEELLSTPDVPRHVRKLSEAVLAKIDEMEARFVAMK"
FT   gene            182093..183184
FT                   /locus_tag="Bcen2424_6032"
FT   CDS_pept        182093..183184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6032"
FT                   /product="Dihydrokaempferol 4-reductase"
FT                   /EC_number="1.1.1.219"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KEGG: bcn:Bcen_5668 dihydrokaempferol
FT                   4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12764"
FT                   /protein_id="ABK12764.1"
FT                   /translation="MAHHFCNGIPPMNIDTDLPVMVTGATGYVAGWLVQRLLEAGVTVH
FT                   AAVRDPDSPDKLEHLQRIAAGKPGTLRYFRADLLEPGSYADAMAGCGTVFHTASPFTVT
FT                   VRDPQKELVDPALLGTRNVLETANRTPSVRRVVLTSSCAAIYGDNADLAATPDGVFTES
FT                   IWNTSSSLTHQPYSYSKTVAEREAWKIARQQQRWDLVTVNPSLVIGPGINPYATSESFE
FT                   IVRQMGNGTMKAGVPDLGLGAVDVRDVADAHLRAAFLPNANGRYIVSAHDTNLPAMAAT
FT                   LLERYGADYPIPRRILPKWLVWLIGPLANKSVTRRVVARNIGLPWRADNSRSRNELGMR
FT                   YRPLAESMNDFFQQLVETGQLRR"
FT   gene            183181..184170
FT                   /locus_tag="Bcen2424_6033"
FT   CDS_pept        183181..184170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6033"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_5669 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12765"
FT                   /protein_id="ABK12765.1"
FT                   /translation="MNRFAISPGWQVMMVDLGLRADELLRRAQLPADLFTRPENGLTTR
FT                   EYFGLWHAMEDMANTPAVALRILDLLSVETFDPPLFAALCSPNLEIAIRRIGQFKPLIG
FT                   PMRLRVSHEVNALTLAVDFLERDVPPPGMLVAAELGFFVKLARLATRTELPARAVTLPR
FT                   EVSPHPGYARFFGVTPQYGDAPSVSVALQDARRPFVTANHAMWQIFEPDLRRRLDALSA
FT                   EAGIVERVRAALLELIPGGLATADGVAQTLAISKRTLQRRLGDEGANFKTLLAEVREKL
FT                   AWHYLDRSDLPYSQIAFLLGYQDPNSFFRAFNEWTGMTPEAARSRTAR"
FT   gene            complement(184213..184701)
FT                   /locus_tag="Bcen2424_6034"
FT   CDS_pept        complement(184213..184701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6034"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bcn:Bcen_5670
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12766"
FT                   /protein_id="ABK12766.1"
FT                   /translation="MNRDDKLKQVAAEFGFDPDETIRIGGKYTPVLVDGSTAYIAGQVP
FT                   RIGEVVHFVGIVGESVSLDDGRRAAGISALRALSLIRKHCGTLDAIATVPRMTVYVRSA
FT                   PDFTMQSEVADGASDVLVAVLGDAGIHTRSSVGVLQLPKGASVEADFIFGLKRSGTPG"
FT   gene            184929..185228
FT                   /locus_tag="Bcen2424_6035"
FT   CDS_pept        184929..185228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6035"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bcn:Bcen_5671 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12767"
FT                   /protein_id="ABK12767.1"
FT                   /translation="MATYKELKAQMDALAEKAEAARAAEFQAVVDDIRTKVAEYGITEK
FT                   DIFGTRRGRPAKQAGAPVQAKYRDPKTGATWSGRGRAPAWIKDAKNRNRFLIQE"
FT   gene            complement(185401..185733)
FT                   /locus_tag="Bcen2424_6036"
FT   CDS_pept        complement(185401..185733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6036"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: bcn:Bcen_5672 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12768"
FT                   /protein_id="ABK12768.1"
FT                   /translation="MQLQTGNLFSVDGRRGGDERIDLLVTSPRVNVERIVSMGHASPDG
FT                   FWYDDARAEWVVLLSGAAVLEFEEDATRLDMRAGDYVLIEPHCRHRVAWTHDEVQTVWL
FT                   AVYYER"
FT   gene            complement(186187..187110)
FT                   /locus_tag="Bcen2424_6037"
FT   CDS_pept        complement(186187..187110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6037"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5673 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12769"
FT                   /protein_id="ABK12769.1"
FT                   /translation="MISDQNGESESPSIRTNLPSLMALRCFDAAARHEHFGRAADELCL
FT                   THGAVSRAVRLLENDLGVALFERRSRRVFLTEAGRTLARAVHDGLGLMRHAAHALRTEA
FT                   ARARRSVLSCEPTLLMRWLIPRWPDFQARHAGVDIHLAAAGGPFSFDSGIDMAIRRNDF
FT                   AWPAGYHAEHLFAERVGPVCRPDKVGAWFASRRGGRALKPDAALLHTRTRPDAWNAWAA
FT                   ASNQPAANGRGQRFDHFYFSLQAAVAGLGVAIGPWHLVRDDIESGVLVAPMGFVEDGSD
FT                   YYLLTPAPVAEGSAQAALLAWLREMV"
FT   gene            187178..187795
FT                   /locus_tag="Bcen2424_6038"
FT   CDS_pept        187178..187795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6038"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bcn:Bcen_5674 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12770"
FT                   /protein_id="ABK12770.1"
FT                   /translation="MTEWIVVVTITPLAVISPGPDFAMVTRNSLMLSRRSGVLTACGIG
FT                   LGVTVHVSYTLLGVGLLIRQSPWLFNAVKLIGAIYLIYLGVKMLMTKSGGVQADSRVAA
FT                   LSDLAALRTGFLTNALNPKTTVFIVSLFMQAVRPDTPLIVQLGYGAFIAAAHAAWFSLV
FT                   AMCFSATAVRDRLLSLRHWIDRTFGCLLVGFGVALAIARGGR"
FT   gene            complement(187859..188491)
FT                   /locus_tag="Bcen2424_6039"
FT   CDS_pept        complement(187859..188491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6039"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   bcn:Bcen_5675 (acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12771"
FT                   /protein_id="ABK12771.1"
FT                   /translation="MTHVLYIEGSPNKAYSASIEVCEAFLDAYRHAHPDHEIRKLDIWD
FT                   LAMPEFDGAALAAKYAGLSGTALTQEQAAAWQQIERLAAPFHEADKFLFGVPLWNFSIP
FT                   YKLKHLIDVISQKDVLFTFDGTGFTGKLAGKKAAVVYARGLAYQSPGSFTPAAEFDLQR
FT                   PYMETWLKFVGVMDITGIVVERTLFGPDGKVDRRRAIDEARTIARTF"
FT   gene            188624..189502
FT                   /locus_tag="Bcen2424_6040"
FT   CDS_pept        188624..189502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6040"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5676 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12772"
FT                   /protein_id="ABK12772.1"
FT                   /translation="MNAPLDTALLHTFVAVADVRSFTGAGRRLNLSQSAVSAQIVRLEE
FT                   QVGQALLARNTRSVTLTGHGETLLGYARAMLNLSEEARARLGTGDAIDVKLRIGVSEDF
FT                   ATGWLPDLMRRHGAARRGLRLDLVVDIGDSLFQRHANGEFDLVIGSRCSHAGHGATLWQ
FT                   EPLVWAFARHEPLPEGDVPLACFPDPCPYRGAAIKVLALAGMRYRIACESPSVAGIRTF
FT                   ARAGIAIAPVPRSAIDDTLRELGLPEGLPELPAMEFVMMHDARMPAAAEFAAMILDETA
FT                   ARTGAGKRGRA"
FT   gene            complement(189555..191030)
FT                   /locus_tag="Bcen2424_6041"
FT   CDS_pept        complement(189555..191030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6041"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_5677
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12773"
FT                   /protein_id="ABK12773.1"
FT                   /translation="MAVPAEFPSSIDPAALLARQRSAFGAEGPPSLQLRKARLARLRAV
FT                   VLAHRRDVEEAVSADFGHRSRHETAIMELVGVIQAIDYLTRNLRRFMKPQRRHVGLFYR
FT                   AGQAHVEYQPLGVIGVMAPWNYPFALTFIPLATALAAGNRAMLKPSELTPRTSEVMRRM
FT                   LADTFPSEEVAVVLGGPDVGAAFSGLPFDHLLFTGSTQVGRQVMKAASDNLVPVTLELG
FT                   GKSPAIVARGHVDGRTMSSIVFGKLSNGGQTCVAPDYALVHEDDLDAFVAQYDAAVARF
FT                   YPDGPTSPDYTSIVSDRHYDRLKGLVDEARSRGARVIEAGVNPQGAATRKRTLAPTLIV
FT                   GAADDTAVMREEIFGPILPVRTYRTIDEVVDYVNARPRPLALYYFGVRDGDCETLLKRT
FT                   TSGNVGINNTVLHVAQEDLPFGGVGPSGMGAYHGIEGFRAMSHAKGVFVQGRWSLPSLL
FT                   RAPFGKLADMSLAALLGRSREPAGGRIEWSAKR"
FT   gene            191130..191783
FT                   /locus_tag="Bcen2424_6042"
FT   CDS_pept        191130..191783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6042"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_5678
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12774"
FT                   /protein_id="ABK12774.1"
FT                   /translation="MSLDEDADAGQKTYHHGDLRRAIIETALDTLQEQQGWQFTLREIA
FT                   RRANVSHSAPYRHFPDKAALLHELALIGFDRLHDDLVASVDPSADAPDVLLALAHAHLA
FT                   FGQRNPDLYRLMFAADAGEPSDIHLDPRVQAPFLLVVEILEHGQRAGTIRPRPALGQAT
FT                   ACWAHLHGLTMLAIDRRLVREKVGDHAIEDALTTLLDGLVLPEKRPRATKAKKS"
FT   gene            191841..192623
FT                   /locus_tag="Bcen2424_6043"
FT   CDS_pept        191841..192623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6043"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: bcn:Bcen_5679
FT                   ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12775"
FT                   /protein_id="ABK12775.1"
FT                   /translation="MCTAIRQSGGASKTFARGRSPGNRIMSKRILHVVSNVAHYADPSQ
FT                   PTGLWLSELTHAHHIFAARGYEQQLVSPKGGVSPLEPRSLKWPHADAASKAWRADKANA
FT                   ALLAHTARPDEIDPAGFDAIYFTGGHAVMWDYPDDAGLQRLTREIYEHGGIVSSVCHGY
FT                   CGLLNTKLSNGSLLVAGRRITGYSWVEEILAGVAKKVPYNVEQQMRERGARYEKALLPF
FT                   TSNVVVDGRIVTGQNPQSAKATAEQVVALLSLGAPAHV"
FT   gene            complement(192620..193135)
FT                   /locus_tag="Bcen2424_6044"
FT   CDS_pept        complement(192620..193135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6044"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: bcn:Bcen_5680
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12776"
FT                   /protein_id="ABK12776.1"
FT                   /translation="MAGSVPAGEYRDMKIGELAQRTGITPSRIRFYERIGLLTLVEREA
FT                   NGYRTYPQEAVTVLDLITAAQRADFSLDEIRTLVPSDLTQWQCGPLLDALCRKVRDIEA
FT                   LEVRLARSKAHVVALIAGLGAKPDTVDRAARAKRPLSRIRSEHAAHPGDAAAADTGDEP
FT                   VPRRTTGR"
FT   gene            complement(193223..194473)
FT                   /locus_tag="Bcen2424_6045"
FT   CDS_pept        complement(193223..194473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6045"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   bcn:Bcen_5681 saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12777"
FT                   /protein_id="ABK12777.1"
FT                   /translation="MPQPSYDLVVFGATSFVGQILARYLSDYLSGAGAGETLRWAIAGR
FT                   SDAKLRQVRDTLGAAGQSVPILVADAADEAQLRALCAQTQVVVSTVGPYALYGEPLVRV
FT                   CAQTGTDYCDLTGETQWIRRMIDKYEPAARQSGARIVHCCGFDSVPSDMGVFFLQQQAR
FT                   QQWSVPATHVKMRVKTLKGGASGGTVASVINVVREAAADPALRRALLDPYSLCPPRHGF
FT                   TVRQHAVRSAEFDRDCDAWIAPFVMAAINERVVHRSNALAGNAYGSRFTYDEAVMTGTG
FT                   LKGRVTALTMVAGLGAFMVGVLIGPVRGLMERFLLPKPGEGPSVAAQQAGRYDLRFFGR
FT                   ADDGRTLRVKVAGDRDPGYGSTGKMLGQAAISLALDGSRDGVKTGRGGGFWTPATMFDQ
FT                   RFIDRLVRHAGLRFEVI"
FT   gene            complement(194517..195434)
FT                   /locus_tag="Bcen2424_6046"
FT   CDS_pept        complement(194517..195434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12778"
FT                   /protein_id="ABK12778.1"
FT                   /translation="MDRRFTQVEFGPHTVDVPEGGYYDRFRMNPDLDAVARDPAAGNID
FT                   FFRRIPKRQVMSRVGPTWAPNFYYRSSSIQLLFLAPLDRLRTMLPIPLEPLRALPGYGL
FT                   VALTFFSYAVCDNDPYDEVSVAVVIRRPGAKGSHALELIDSMRRRSFFAHVLALPVTTE
FT                   IARVRGVHGYQLPKWLADIDVNIGATARARIAGPGGRPDLSLSVPLPALTQVPSQSHMG
FT                   TTTMINRIDGEWHQSSVQTNMLSFAQRLLPRNVELVRHGGPLSQLLDGLGASTIMRLDV
FT                   VEDAQLVLNLPTPLTAFDEPRKPR"
FT   gene            complement(195598..196047)
FT                   /locus_tag="Bcen2424_6047"
FT   CDS_pept        complement(195598..196047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6047"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: bcn:Bcen_5683
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12779"
FT                   /protein_id="ABK12779.1"
FT                   /translation="MRIGELAKLSGISASRIRFYEAEGLITAVERSANGYRDYADNAVW
FT                   MLEIISSAQSAGFSLEQIRHLLPVKAGNWQHDGLVAALERKVAEIEAMQKRLKENKAQL
FT                   LVAIDSIRNRPTELDCTERTRWVMERLRDHGVVPIRGKKSRTAAK"
FT   gene            196215..197045
FT                   /locus_tag="Bcen2424_6048"
FT   CDS_pept        196215..197045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6048"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_5684
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12780"
FT                   /protein_id="ABK12780.1"
FT                   /translation="MGYVTTKDGVDIFYKDWGPRDAQVIFFHHGWPLSADDWDAQMLFF
FT                   LAQGYRVIAHDRRGHGRSSQVWDGHDMDHYADDVAAVVNHLGVQGAVHVGHSTGGGEVI
FT                   HYVARHGEDRVAKAVLISAVPPLMVKTDSNPGGLPKDVFDNLQAQLAANRAQFYYDVPA
FT                   GPFYGYNRTGSTPSQGVIWNWWRQGMMGSAKAHYDGIVAFSQTDFTEDLKSTTIPVLVM
FT                   HGDDDQIVPYADSGLLSAKLARNSTLKVYAGFPHGMPTSNADTINADLLAFIRS"
FT   gene            197267..197674
FT                   /locus_tag="Bcen2424_6049"
FT   CDS_pept        197267..197674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12781"
FT                   /protein_id="ABK12781.1"
FT                   /translation="MTLQARGPFEVKLNPEPLSNVAEGSGLGRMSLDKHFHGDLEAVSH
FT                   GEMLAFRSSVQGSAGYVAMETVKGVLGGRKGSFVLQHSSTMTRGQPTQSITVVPDSGTD
FT                   ELLGLSGAMRIDIDDGQHAYRFDYALPDAPQ"
FT   gene            complement(197684..199249)
FT                   /locus_tag="Bcen2424_6050"
FT   CDS_pept        complement(197684..199249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6050"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bcn:Bcen_5686
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12782"
FT                   /protein_id="ABK12782.1"
FT                   /translation="MRKQLTIRGGLVATIAGYTMLLVLVVGAGIAALTIGNGSLEAMYR
FT                   DDTASLLHLKTSSERMLVLRERMSDVAQIISAGQPAKEEVAQLHTLLKQSNDELDAYTH
FT                   LHARDASEQALFDTLQSRRRALLDRVFLKALSQLDGDDAFNFLDTQRTAPPALFAAYQE
FT                   AIDALESFQVARQKARYEAAGINFHRIVWGMGAVAVLALVVGFVAQRVLAKAIIGPINL
FT                   AVDQFEKIAKGDLTGTVVVPGENEMAYLLNALKRMQDGLVDTVSQVRASTETIVGDVRT
FT                   IASGNVDLSARTEQQAVSLQQAAASVEQLTAAVRQNADNARDARTYVEGAAGIASRGGE
FT                   AMQRVVATMSEISTSSTRISGIVGVIESIAFQTNILALNAAVEAARAGEQGRGFAVVAT
FT                   EVRGLAQRCAAAAKEIRDLIGHSARRVEDGSGLVALAGSAMTELVAAVERVNAIMGETS
FT                   QAFDEQSSGIEQVNAAVIQMEQTMQRNAALVEEAAAAALSLDEQGARLSAAVAQFRLRE
FT                   AALA"
FT   sig_peptide     complement(199154..199249)
FT                   /locus_tag="Bcen2424_6050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.419 at
FT                   residue 32"
FT   gene            complement(199439..199669)
FT                   /locus_tag="Bcen2424_6051"
FT   CDS_pept        complement(199439..199669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6051"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG: bcn:Bcen_5687 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12783"
FT                   /protein_id="ABK12783.1"
FT                   /translation="MPDAIQVFPYVYVDDSDSICRRTLALQAIPLEAPADMPSGDRRLR
FT                   VKDACGNVWQIATHQRGASADEIRSTLGDCR"
FT   gene            complement(199662..200507)
FT                   /locus_tag="Bcen2424_6052"
FT   CDS_pept        complement(199662..200507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6052"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcn:Bcen_5688 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12784"
FT                   /protein_id="ABK12784.1"
FT                   /translation="MSNVTLPGQRVGDFTITAISDGYLTASLDFLSNIDATDAAGMQRA
FT                   AGQQAPSAVHINCYVVRGAGRTVLIDAGAGGIKQWGGRLMDNLRLAGIEPAAIDTVLLT
FT                   HAHPDHVGGLVHADGHVAFPNAELVAHRREVAFWRDDGNLSRASERARGNFRIARQVFD
FT                   AYRDVLRTFEEGEVLPGIAAIPLPGHTDGHTGYLLASGDQGLLVWGDIVHFPHIQIRRP
FT                   DVSIAFDQDASQAATTRSRLLDRVSSEGLLIAGMHLGEPGFARIRRASGEYGLFYETGA
FT                   "
FT   gene            complement(200526..200852)
FT                   /locus_tag="Bcen2424_6053"
FT   CDS_pept        complement(200526..200852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12785"
FT                   /protein_id="ABK12785.1"
FT                   /translation="MPNVTFHIDTERMPPDACLAELSDDCIDLCTRVLQAEITNVHVIY
FT                   VAVRHGCGHPVFAEIQYRDAPSRPPAVMNAFMEALDHAVVRRTGLTARIRCFGHAAPNL
FT                   HARN"
FT   gene            complement(200845..201375)
FT                   /locus_tag="Bcen2424_6054"
FT   CDS_pept        complement(200845..201375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12786"
FT                   /protein_id="ABK12786.1"
FT                   /translation="MIYTVECSFADPASEAEWNDFYSLDKLPALISVAGFHTSQRFKAI
FT                   SDGCPVYLAVHTIDGLDVLTGDEYRQKGGGNFARWQQHITDWHRNLYSDIGRAPAVNAD
FT                   ELLVLSAGGPDSLIELGLKPLAMQAVALEQFPARRWLAVLPRRAAPLGDNAPAGLYLYT
FT                   PMTKQLTKAARDA"
FT   gene            201544..202437
FT                   /locus_tag="Bcen2424_6055"
FT   CDS_pept        201544..202437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6055"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5691 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12787"
FT                   /protein_id="ABK12787.1"
FT                   /translation="MRRKIPSNSALLAFEAAARHGSFARAADELARTEGAVSRQIGRLE
FT                   AFLGVTLFERVGNRVRLAPNGTRYAVQVREILDRLERDSLYLMGQPVEGASIDIAAIPT
FT                   FATRWLIPRLKRFQDRHPNVTVHIAERMEPFLLAGSGFDAAIHFEHPAWAGMHLHPLLE
FT                   EVLVPVCSPALLERVGANPSLDALPRLHRRQNPDAWQRYAQETGIVLTNSAVGPRYDLH
FT                   SMLIEAALAGLGVALVPRLYIGAELEQRRLVAPWPDGTAVTKNFCLVLPEPIELSAAPV
FT                   RAFAEWVLSEARDGVR"
FT   sig_peptide     201544..201624
FT                   /locus_tag="Bcen2424_6055"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.600 at
FT                   residue 27"
FT   gene            complement(202495..203400)
FT                   /locus_tag="Bcen2424_6056"
FT   CDS_pept        complement(202495..203400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6056"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5692 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12788"
FT                   /protein_id="ABK12788.1"
FT                   /translation="MQNLDALLIFARVAEMASFTRAAESLGIQKGRVSTVVRTLERDMG
FT                   VALLHRTTRRVQLTEDGRAFYARATDLLAEVQELQSMFSGRGASLRGRLRVDMPTELAR
FT                   SVVVPALPQLMAAHPDLELELSSTDRRVDLVREGFDCVIRLGPIADETLIARPLGRLRM
FT                   TNAASPDYLARHGVPRTLADLHSQGHRMIHYTLTLGARHPGWEYPDGDGYAWLPLPSAM
FT                   QVNSVQTYHAAGLAGIGLIQAGYSALAHHIESGALVEVLPDLRPEPLAASLVVAHRRNL
FT                   SPRVRAFMDWIGGVLEPYLD"
FT   gene            203517..204107
FT                   /locus_tag="Bcen2424_6057"
FT   CDS_pept        203517..204107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6057"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   bcn:Bcen_5693 flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12789"
FT                   /protein_id="ABK12789.1"
FT                   /translation="MDQLNPPVKTAVVYHSGYGHTQRMAAAVADGAGAALVAIDADGNL
FT                   ADDAWNTLADADAILFGSPTYMGGPSWQFKKFADASSKVWFESGWQNKIFGGFTNSASI
FT                   NGDKLNTLEYFFLLAGQHGGIWVSMDIKPANLKASTRDDLNRMGAYIAPMAQTPADASP
FT                   EEMSPGDLETARRYGARVAAIAGQLRAGHSRSN"
FT   gene            204182..205237
FT                   /locus_tag="Bcen2424_6058"
FT   CDS_pept        204182..205237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6058"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bcn:Bcen_5694
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12790"
FT                   /protein_id="ABK12790.1"
FT                   /translation="MKYKQLGRTGLYVSELCLGTMTMGGNADAGMWAAIGAVGQDDANR
FT                   LIARALDAGINFIDTADIYSFGQAERVVGQALRDLGVPRHEIVLATKTAGVMGAGPNDQ
FT                   GASRGHIMDSVQRSLERLQVDHIDLYQIHASDPVTPIEETLRALDDLTRQGLIRYVGVS
FT                   NWRAGKIGKALGLSAALHATRFETLQAYYSIAGRDVERELVPLAVDEQMGLLVWSPLAG
FT                   GLLSGKFGPGAATEAGSRRGHFDFPPVDLDRAWPCVAEMRAIAGAHGVSVARIALAWLL
FT                   AKPAVTSVIIGAKRIDQLDDNLGAVDVVLTDDELARLDAVSALPPCYPGWMIARQEAGR
FT                   LPQPLTRTVSQ"
FT   gene            complement(205251..205445)
FT                   /locus_tag="Bcen2424_6059"
FT   CDS_pept        complement(205251..205445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6059"
FT                   /product="NAD dependent epimerase/dehydratase family"
FT                   /note="KEGG: bcn:Bcen_5695 NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12791"
FT                   /protein_id="ABK12791.1"
FT                   /translation="MTDDIDAKVVVVTGASSGFGEATARHPAQRGAKRVLGARRVDRLE
FT                   RLADDIGAGRHRRVEPPMR"
FT   gene            complement(205474..206325)
FT                   /locus_tag="Bcen2424_6060"
FT   CDS_pept        complement(205474..206325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6060"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bcn:Bcen_5696 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12792"
FT                   /protein_id="ABK12792.1"
FT                   /translation="MGATSTAPNTSPMRSTAGVDDRTRRPSRFVAATGLALLAAACTAM
FT                   QRTDTMQEPLSVDALKAVAPAFERYTSHTVFDGLWKRPHLSPRDRSIVTLSVLIARGQT
FT                   VEMPLHARLALDHGVKPAEISEMIAHLAFYAGWANAGAASIIVKHVYDERGIGPDQLAP
FT                   ADVTPLPLNEAAEAQRARTVSENFGAVAPGVVEYTTDALFRDLWLRPGLAPRDRSLVTV
FT                   SALVANGQVAQIPYHLNRAMDNGLTQAEASETLTQLAFYAGWPNVFSALPVFKDVFSRR
FT                   AA"
FT   gene            complement(206548..207123)
FT                   /locus_tag="Bcen2424_6061"
FT   CDS_pept        complement(206548..207123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6061"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_5697
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12793"
FT                   /protein_id="ABK12793.1"
FT                   /translation="MAGVRRKKAPDQVRAQLLAAASEIATHHGVAALTLDAVAERAGVT
FT                   KGALQYHFANKQGLLDALFGQATERFGAQLTARMAADSSGDGAAARAYLHAVLDAANPA
FT                   ASIEVLRVLVASMITEQDTRARWSVPMREWTRPDPVPLEQAATLMICRLAADGLWISEL
FT                   LDSVDVSAELRAEIVRQLDAMSRGVFPK"
FT   gene            207284..209347
FT                   /locus_tag="Bcen2424_6062"
FT   CDS_pept        207284..209347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6062"
FT                   /product="squalene-hopene cyclase"
FT                   /EC_number="5.4.99.17"
FT                   /note="KEGG: bcn:Bcen_5698 squalene cyclase; TIGRFAM:
FT                   squalene/oxidosqualene cyclases; squalene-hopene cyclase;
FT                   PFAM: Prenyltransferase/squalene oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12794"
FT                   /protein_id="ABK12794.1"
FT                   /translation="MIRRMNKSAPSSWSALDAAIARGRDALVRLQQPDGSWCFELESDA
FT                   TITAEYILMMHFMDRIDDVRQEKMARYLRANQRLDTHGAWDLYVDGAPDVSCSVKAYFA
FT                   LKAAGDSEHAPHMIRARDAILKLGGAARSNVFTRILLATFGQVPWRAAPFMPVEFVLFP
FT                   KWVPISMYKVAYWARTTMVPLLVLCSLKARARNPRNVSIRELFVTPPEQERHYFPPARG
FT                   MRRLFLALDRTIRPIEPLLPKRLRQRAIRHAEAWCAERMNGEDGLGGIFPPIVYSYQMM
FT                   QVLGYPDDHPLRRDCENALEKLLVTRPDGSMYCQPCLSPVWDTAWSTMALEQARGVAAP
FT                   ETGDTASGALRDLDGRIARAYDWLATRQVNDLCGDWIENAPADVEPGGWAFQYANPYYP
FT                   DIDDTALVTAMLDRRGRTHRAADGTHPYASRVARALDWMRGLQSRNGGFAAFDADCDRM
FT                   YLNAIPFADHGALLDPPTEDVSGRVLLCFGVTKRAADRASLARAIDYVKRTQQPDGSWW
FT                   GRWGTNYLYGTWSVLAGLALAGEDKSQPYITRALDWLRARQHADGGWGETNDSYLDPKL
FT                   AGTNGGESTSNCTAWALLAQMAFGDCESDSVKRGIAYLQSVQQEDGFWWHRSHNAPGFP
FT                   RIFYLKYHGYTAYFPLWALARYRRLAGAKDAGATRSCASGASAAPATDDALA"
FT   gene            complement(209433..210347)
FT                   /locus_tag="Bcen2424_6063"
FT   CDS_pept        complement(209433..210347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6063"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5699 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12795"
FT                   /protein_id="ABK12795.1"
FT                   /translation="MTTPSLRIRQIEAFRAVMQRHTVTRAARDLHISQPAVSRLIADLE
FT                   DRVGFVLFERQQGRFTPTAQARVLYEEVERAFVGLDRVAQAAEQIRAMRRGTLRVAGSP
FT                   AVALDLLPQLVTRFSHAHPGVDITLLAHSASTVVDKVASGQCDVGLIAEPVPHPAVRGE
FT                   RLAESAMRCIVPRGHRLARKRVVRPADLRDEAFISFPPSFEARSAIDRVFVEAGVSRVL
FT                   SIEAQLSQTIVAFVANGAGVALIDPVTAAYAGHRVAVKPFEPAVPDHFYLVTSASQPLS
FT                   MIGDAFCADLRDAFARMRAPRDM"
FT   gene            210497..211621
FT                   /locus_tag="Bcen2424_6064"
FT   CDS_pept        210497..211621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6064"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_5700 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12796"
FT                   /protein_id="ABK12796.1"
FT                   /translation="MTVRRFDVVVAGGGLVGMAIAWGIARLGQRVAVCDGDDIAFRAAR
FT                   GNFGLVWVQGKGGRCLPYARWSRESSARWHAFAAQLQRETGVDCAFERPGGIELFEQRA
FT                   ELDSATDLLESLRRQEAALSYEVLDPAALRRRVPAASPSLAGALWSSNDGHANPLTTLR
FT                   AMLQAFQQCGGVYLPRSEVAEIRPRAGRFEIDTRHAQLEAGRVVLAAGLDNARLAPMVD
FT                   LRAPISPLRGQIMVTERLAPFLDYPTLVVRQTPEGSVLLGDSAEDVGFDDGQTRPAMVD
FT                   IARRARTAFPALAHARIVRAWGALRIMTPDGLPVYEASATYPGAFIAICHSGVTLAATH
FT                   ADLVAPWIAGGAAPADLSAFTTARFDAPTEARHV"
FT   gene            211614..211913
FT                   /locus_tag="Bcen2424_6065"
FT   CDS_pept        211614..211913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12797"
FT                   /protein_id="ABK12797.1"
FT                   /translation="MFESLVPAAALLERVRIHIDGTPHDVPAHYSVAAAMLAAGSASCR
FT                   TSAVSGAPRGPFCMMGVCFDCLVEIDGVPNVQGCMTPVADGMQVSAMHGKARLA"
FT   gene            211910..213346
FT                   /locus_tag="Bcen2424_6066"
FT   CDS_pept        211910..213346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6066"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bcn:Bcen_5702 BFD-like
FT                   (2Fe-2S)-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12798"
FT                   /protein_id="ABK12798.1"
FT                   /translation="MTRRQCDLLIVGAGPAGMAAATAARAAGLSVVVADEGRAPGGQIY
FT                   RNVADAPAPLAQWLGADYTAGRPLVDGLLASGAHYLPRSVVWQVAFEPAPVAMLTQSGP
FT                   ARGTLEIGARAVLIATGAQERPWPVPGWTLPGVMGVGAAQTLLKASGLAPSADAVLAGS
FT                   GPLLWLFAAQLLNAGRRVRALVDTTPRDAWRRALPHALPALRGADYLLKGWRMLRAVRR
FT                   AGIPVYRGATDVRIDGESRAERIRFRDEDGIVQTLDTSLVLLHQGVIPSTQLARSLGCA
FT                   HEWDESSACWRPQCDARGRSSVPHVWIAGDGAGIGGARAAALAGEVSALDIAAQLGTLD
FT                   TQRQAARERPVLRALRRHLAVRPLLDALYTPPAALRRPDDDTIVCRCEEVTAGEIRRLA
FT                   ALGCQGPNQMKAFTRCGMGPCQGRWCGTTVGELIADVQQRGVGDVGHYRIRAPIKPVTV
FT                   GEMADALELSNDFQRGEFPS"
FT   sig_peptide     211910..211990
FT                   /locus_tag="Bcen2424_6066"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.943 at
FT                   residue 27"
FT   gene            213387..214169
FT                   /locus_tag="Bcen2424_6067"
FT   CDS_pept        213387..214169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6067"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_5703 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12799"
FT                   /protein_id="ABK12799.1"
FT                   /translation="MKTRLTILLSAAAMAFASPASAKEWTTIRIGVDPTYPPFESTATD
FT                   GSVKGFDIDLGNALCAKLKAKCVWVSSSFDGLIPGLQARKFDVILSSMAATEQRRQQID
FT                   FTDRLYRNQTRLIARTGSGLLPDAAKLAGKRVAVEQGTVQETYAREKWAPAKVEVVPYP
FT                   SYDQAYADLVTGRVDGVLMDAVQGQLGFLATPRGKGFSFAGGVVYDAKIMGNGDAAGVR
FT                   KADTDLRDALNRAIAQIRGDGTYNTIQAKYFNFDMYGN"
FT   sig_peptide     213387..213455
FT                   /locus_tag="Bcen2424_6067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            214462..215373
FT                   /locus_tag="Bcen2424_6068"
FT   CDS_pept        214462..215373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6068"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5704 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12800"
FT                   /protein_id="ABK12800.1"
FT                   /translation="MLDIRQLQYFIAVAEEEHVGRAAERLHISQSPLSRQIAQLEEKLG
FT                   LTLFERSQQRIRLTRDGRTFLSEAHAFLRHANRLESLARRLGRGDEGGLCIGYLETATH
FT                   SGVLPRALKTLRAERPSVHIALYNYPSAAQLEGLRERSLDIALVTEPPAPDDPELDSTM
FT                   VLNDPMLLALPDGHPLAKKKTLSADDLAAQAWIGVTQQESAPRHGAFVAACAKAGFSPD
FT                   ISVEATEPLAALGLVAAGLGVTMIQQSLRHQVPEGVVLRELPWFSYRTPLWAAWHKVNL
FT                   RPLVGIFREILTGEEVVAAAGK"
FT   gene            complement(215594..216010)
FT                   /locus_tag="Bcen2424_6069"
FT   CDS_pept        complement(215594..216010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12801"
FT                   /protein_id="ABK12801.1"
FT                   /translation="MAQAHAGIEIAASADTVWQLIGGFGALPDWLSYIPASELSEGGRV
FT                   RRLANPAGDAIVERLVAFDEAERSYTYAILEAPFPVVNYRSTLRVRENGPNASKVEWSG
FT                   TFTPHGATDDETVRLFRGIYEDGLAELAKRFAAA"
FT   gene            complement(216028..217047)
FT                   /locus_tag="Bcen2424_6070"
FT   CDS_pept        complement(216028..217047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6070"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bcn:Bcen_5706
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12802"
FT                   /protein_id="ABK12802.1"
FT                   /translation="MSLEDKLPGNKILGFGTAPLGNMFRNIPDAEAAATVEAAWQHGIR
FT                   YFDSAPFYGAGLAEIRLGDALAHHPRDEYVLSTKVGRVILDEIEDVSARDLGEKGGLFE
FT                   HGRPNRIVNDYTADATLRSIEDSLKRLRTDRLDIVWVHDIAQDFYGDEWLAQFEVARKG
FT                   AFRVLSKLREEGVINAWGLGVNRVEPIELVLDLAEPQPDGMLLAGRYTLLDHERALQRV
FT                   MPAAAAQNVGIVVGGPYSSGVLAGGTHFEYQKASPDILAKVDRIKAIAARYDVPIKAAA
FT                   LQFSMSHPATVAVIPGASRPERIAEDQAALNVAIPADFWRDMREQGLIAANAPLPTDR"
FT   gene            217382..217723
FT                   /locus_tag="Bcen2424_6071"
FT   CDS_pept        217382..217723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12803"
FT                   /protein_id="ABK12803.1"
FT                   /translation="MKTLVSSTLAALILSAPALSFAQQADHPLTRADVKAEMARLAAVG
FT                   YTPALDHNQYPAAILAAEQRVRENAVAQSAPNAAPTADNTGYGSEARTSGESGRAMIIN
FT                   GRNSIYRGH"
FT   sig_peptide     217382..217450
FT                   /locus_tag="Bcen2424_6071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 23"
FT   gene            218017..219216
FT                   /locus_tag="Bcen2424_6072"
FT   CDS_pept        218017..219216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6072"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_5708 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12804"
FT                   /protein_id="ABK12804.1"
FT                   /translation="MNRYPGLKRIARSAALAAVPLAALVALSGCQSDDKAPAATPSVIV
FT                   SAPVARDVNDVDVYTGRFEAVDTVDVRPRVSGYLDKVAFQDGATVRKGDLLFVIDPRPY
FT                   QAAVTAAQGALERAQSQLKLSRQDFERASILIKTDTIAQSLYDQRRQAVQSAQAEVTSA
FT                   QGALERARLDLSFTRIVAPMSGRISRKLVSEGNLVKGGDSDATVLTTIVSQDPIDIYFD
FT                   VDEESYLRYTREARKGGGNASSRQVAIALPGDVQPSLTGTMDFVDNRLDDSTGTLRQRA
FT                   RVANPDRRLSPGQFGRVYLSSRVAHPALLVPDAAVATDATRRVLYFVDANGTVAIRPVT
FT                   PGRLYGNLREIDAGLNAGDTVIVDGFQRVQAGDKVKAVPRAIEAAAVARAASGTTGSAQ
FT                   "
FT   sig_peptide     218017..218115
FT                   /locus_tag="Bcen2424_6072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.842 at
FT                   residue 33"
FT   gene            219213..222404
FT                   /locus_tag="Bcen2424_6073"
FT   CDS_pept        219213..222404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6073"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bcn:Bcen_5709 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12805"
FT                   /protein_id="ABK12805.1"
FT                   /translation="MNLGRLSVQQPVLAIVLSIVLTIAGALAYFSLAVSEYPDIAPPTV
FT                   VIQATYPGASAETVSQTVSTPIELEVNGVEDMLYMYSQATSDGSLNITVTFKPGTDVDK
FT                   AQVLVQNRVALATPRLPEPVQRSGVSVRKSSPTQLGTIFLYSPDQRYDPLYVSNYAIRN
FT                   VADVLKRIEGVGDINALGAREYSMRIWLDPERVASFGLSPADLIAAVRSQNTQLAGGVV
FT                   AQAPIANQAFQPNLVFEGRLKRPEDFSDIVVKQGKDGRLVRLKDVARVEVGALAYATDS
FT                   YMLRHPTIALQVLQQPGANAVATMAAVEKKMAELSRDFPKGIVYNIGYNPTAFIGDSIH
FT                   ELVKTIYEAVVLVVFVVLLFLQGWRPSIIPILSIPVSLVGTFAAMAVLGYSINNLTLFG
FT                   LVLAVGIVVDNAIVVVENVERHLAAGAGPRDATLLTMKEVGGALFAITLVLCAVFVPTS
FT                   FIPGISGQFFRQFGVTIAVSTAISFFTSVTLAPALSAMMLKAHAGDHDAPAPTSRIATL
FT                   FAPALRVARRFSNAFNRLFQRLSDAYGRLVRKVVRIIPAMAALYVVLIAATGYLLVSSP
FT                   KGFIPAQDRGYLVVLVRMPDGATLERTSAVARKIEDIALSVPGVARVPVFSGVNAATGT
FT                   NSANSAGLFPVFQPWPERKARGLTIDTIAAEMRKRLATITEASIVVAMPPPVQGLGSTG
FT                   GFAMRLEDRNGLGTAALAKATQDLVAAANRTPGMVGVYTPYSATSPQVHVELDREKAEM
FT                   LGVPSQAINDAVETYFGSTYINDFNIVGRTYRVTAQADLPFRVGASDLARLKVRNRDGE
FT                   MVPIGSVTRIDDMLGVDRAPRYNLYPATEINGDTAPGLGSGFAIKTMETLAKQVLPPGI
FT                   SFEWTDLSYQQTTAGNTGLLVFPLCVLLVYLVLAAQYGSWSLPVSILLIVPMCLLAASL
FT                   GVRALGQDVNILTQIGFIVLVGLAAKNAILIVEVARQLEADGAELVEAVVEACVQRLRP
FT                   IVMTSLAFILGVLPLVISEGAGAEMRQAVGAAVFFGMIGVTFFGLLFTPVFYVMVRRLA
FT                   MRKTAVAAVATEAVQ"
FT   sig_peptide     219213..219299
FT                   /locus_tag="Bcen2424_6073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.471 at
FT                   residue 29"
FT   gene            222401..223795
FT                   /locus_tag="Bcen2424_6074"
FT   CDS_pept        222401..223795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6074"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_5710 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12806"
FT                   /protein_id="ABK12806.1"
FT                   /translation="MKFVRLVAALSAAAVLTACTSAPVATVTPPPLAATYANADLAAGG
FT                   PAADTGAWWHGFHDPILDRLVDTALANNLDLQAAVARIDAARAVRIGAASQWFPSVDLN
FT                   AGASRQRLSASQAFPTDTPTTGNAFDLNASLAWEIDIFGRIRQGVSAADADIASAQNDA
FT                   AAVRIATIDETVRTYVTVRGLEQRLALVEANALSQRGTEESTRRLFDAGVVPIADVDRA
FT                   AAQTETTLAELPALQLQRQAAIHQLSIITASTPQDIYARLDPPAPEPVWTAAAPGIGTP
FT                   ADLLRRRPDVRAAEARVVAAYARIGVAEADLKPHLQLIGVIGAAIDGFSGASLARSLAW
FT                   MAGAGASAPLFDGGRRRSVVALRRAQADQALAAYRTAVLTAVGDVETSVAATARNHGRT
FT                   ERLERAVSNARGAYTQINRSWRSGESAFIDTLEVQRALLAAEDSLARARTEETLSRVRL
FT                   MSALGQ"
FT   sig_peptide     222401..222481
FT                   /locus_tag="Bcen2424_6074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.478 at
FT                   residue 27"
FT   gene            complement(223901..224803)
FT                   /locus_tag="Bcen2424_6075"
FT   CDS_pept        complement(223901..224803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6075"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5711 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12807"
FT                   /protein_id="ABK12807.1"
FT                   /translation="MKTTLDEMLAFVTIADTGSLTGAADKLHQPTSVMSRILRRLEEKL
FT                   DTTLIRRTTRRLEMTEEGKLFLDYAREIIASVEFAEEQIVSQREAPAGRLRINAAMPFM
FT                   QHVIAPMMPGFRDAYPAIEAELHTSDEIIDLLEQRTDVAIRIGELRDSTLHARRLGSSR
FT                   LRILASPAYLEKAGVPASVADLANHTLLGFVQPETLNHWPLRTADDGVYRIHPALQASS
FT                   GETLLTLALNGAGVVCLADYMTGTHRRDGSLVELLVDDTLEFRQPIHAVFYRNTTLSSR
FT                   IVSFLDYVSAQLKAGGDID"
FT   gene            complement(225010..225921)
FT                   /locus_tag="Bcen2424_6076"
FT   CDS_pept        complement(225010..225921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6076"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; Male sterility C-terminal domain; KEGG:
FT                   bcn:Bcen_5712 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12808"
FT                   /protein_id="ABK12808.1"
FT                   /translation="MKGSRIFVTGATGYIGGSVAARLVAAGHVVTGLTRDGDNAAKLAA
FT                   AGIMPVVGTLDDTALLHAFARDADCVVNAASSDHREAVETIIAALSGSGKAFLHTSGTS
FT                   VIADDAQGAHGDAIVFDETTPIVHPAKAERRAIDRLVMSAATLGIRSAVICNSMIYGDG
FT                   LGLRRDSAQLPLLAAIARDAGAVRVIGKGLNRWSNVHVDDVADLYLRAVHAAPPGAFYF
FT                   AENGEASFAEIGLALAARLGLRSVVEWDVADAAEVLGHSRAHFSLASNSRVKALRARRE
FT                   LGWAPRHGAMLDWIRHEMPVAA"
FT   gene            complement(226265..227434)
FT                   /locus_tag="Bcen2424_6077"
FT   CDS_pept        complement(226265..227434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6077"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bcn:Bcen_5713
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6077"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12809"
FT                   /protein_id="ABK12809.1"
FT                   /translation="MRFNATRVAATLFVAACATATAGSAAAVTQDDLHDTVTRHIAPLM
FT                   KQYAIPGMAIGIVADGKPQVFDYGVMSKQTGKPVTGDTLFEIGSVSKTLTATLAADAQE
FT                   GGELSLADPVARYLPELQGKPFGVVTLLQLGTHTPGGTPLQVPDSIRDDAGLIRYLDAW
FT                   RPEYAPGTHRKYSNVAIGMLGWLTAKAMHEDFATLMEQRLFPALGMTHTTIDVPAARMT
FT                   DYAQGYTKDGKPVRMSQGMLWQPAYGVRTTAADLLRFVQANLGMIQTAPRLQRAIERTH
FT                   TGYFRAGPLTQDLIWEQYPYPVALPTLLAGNAPKMLFDAVPASAIQPPLAPNPATWINK
FT                   TGSTGGFSTYVAFVPAKRIGIVMLANGNVPIEDRVKVAYRILGSLGDGR"
FT   sig_peptide     complement(227351..227434)
FT                   /locus_tag="Bcen2424_6077"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.866 at
FT                   residue 28"
FT   gene            228059..229363
FT                   /locus_tag="Bcen2424_6078"
FT   CDS_pept        228059..229363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6078"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12810"
FT                   /protein_id="ABK12810.1"
FT                   /translation="MAASAYRPRDVVNAPDIKAAIARRSAARGDPAEIRAWLGNHFFRW
FT                   VVGAFEQAQPLASLADYRALAGADRPAPEWLVRRFRAQPASAAPAASPASGPAADAARP
FT                   PAAEPAPLYFIDPEHMLLIDRERVLVEFLRSRAGTRLAQKLQRITCTMALDMWEREHQR
FT                   MQARRDKGWVPSSGLALREVLRTPNGIVFEFVGDHAALREELAYESYYMQHCLGQFADR
FT                   RRLRGGYGEQYAQAARDGRLRLFTLRGAGNQPHVTISLQATGDGLRIDQIKGKQNRHPV
FT                   RRYADDVRQFLRALAPRGERHPDCEGMGLVFEPDAPGAATGAWTFVTDVRSPDHLLSVM
FT                   SANFHLIEHFEQPPAVLQWLLLRNAPYALGQLRQIDPAVAAAARHALPADALPAARTPD
FT                   APPATAAFEIEGIAIDPALCATFALPAPADGSPSC"
FT   gene            229357..230139
FT                   /locus_tag="Bcen2424_6079"
FT   CDS_pept        229357..230139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6079"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12811"
FT                   /protein_id="ABK12811.1"
FT                   /translation="MLKLLLGAAVLWLVWYVWRSFRVAARLVREVDADQAAGADGAVPV
FT                   RQTTAVRLAHAQAEQAPPNRRRWALALADILLIRNGLRCDCDDLVYALPDSQREQLARQ
FT                   LRRELDLPADLPEWQIVQRVPSILAGWIRGVGRSHDGFYEQLAALGRVRDALAFDCART
FT                   AFLVRCIALLGWASEQHAWVVLLLNAQRAQDSFDSWEDFGLAYARARQQWLRGSGQDGP
FT                   ASSRATQEVREYLRNPSGNWLALPWKRYRIFDPQPVSS"
FT   gene            230136..232142
FT                   /locus_tag="Bcen2424_6080"
FT   CDS_pept        230136..232142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6080"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bcn:Bcen_5716 Sel1-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12812"
FT                   /protein_id="ABK12812.1"
FT                   /translation="MTADTDMSSASADLIPPAPSRWHICDVDALLRAGDHAALDAQLDA
FT                   ALAASFADRTAEARYVDALPADVQPCIDAGAEGLARLRAWQAANPRSAHAWLCEAHYWH
FT                   HWAYEYRGSGWAETVTEAGWIGAHACATLTLVAALRALVLAPTMWSAPMVIFTSVSSFG
FT                   EPEWLAQLVRERRWPVTELHLNAGAEDDATRAELQHMFARSGLNPDVPAACPPEFPDAL
FT                   PGAVQGKKLRKEKWYWMEATLHIHPKLFFPMRTFIWYMQPRWGGSHDHIRAFVASDACA
FT                   HLDAVEKDRLLHEIWRDDYAGNTLDADDDEDDARRAMTATLARAQAALHPYHRWETLHW
FT                   LAYSHFKRSEYEQAYARLQEAERNEPIDDNRAMAMGLRLALGLDPQGDWLPRAIERASD
FT                   ARACTSAMILRGYAHRTGTFGFAQDDARGDAWLEAARENEPGSLAWNQIATAFEYENRR
FT                   PADALAICQLGYEAGGNSCDYLLGCFYKEGMHVEADPYRAAHYFRESMEAGGNMAAYRL
FT                   GYTYHHIGQTSTDRAERVRMQTEAVEAARKAHEMGHTDGLECMLMFIGDIEDYPSRHRY
FT                   VDELRRHAEGGHPAAMAALSFFLADINDKSLYDYRESVRWIMGAQAIAPDDEYVLNITR
FT                   VSHEDGMLGKLRYKLQRKQIKAHEIPGADNAMV"
FT   gene            complement(232189..233001)
FT                   /locus_tag="Bcen2424_6081"
FT   CDS_pept        complement(232189..233001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6081"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_5717
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12813"
FT                   /protein_id="ABK12813.1"
FT                   /translation="MNAELDDDELVRFDAHGGTPLPAADAEGWLDHDGARIWHASFGRG
FT                   PAVVLLHGGLGHGGNWGNQVPALLAAGYRAIVIDSCGHGRSTRDDRPYSYERMASDVLA
FT                   VLDALQVDRARFVGWSDGACIALVLAARAPERAAGVLFFACSMDPGGTKEMAPSLLIDR
FT                   CFARHRKDYAQLSATPDQFDAFVAAVSEMMRTQPNYTAQDLAAIAVPVAIVQGEHDEFI
FT                   RPEHAAYLARTIPGATLTILPGVSHFAPLQRPARFNAAMLAFLDRLPG"
FT   gene            complement(233072..233554)
FT                   /locus_tag="Bcen2424_6082"
FT   CDS_pept        complement(233072..233554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12814"
FT                   /protein_id="ABK12814.1"
FT                   /translation="MQIDFSPTARSPLADSGVAANPSAATSPTGATNAASTTGTDGTTG
FT                   ATGTTSTSSPSGTKDSAGATGQTPGAAGASSEDPAVAQLKALIERLQKQLATLERQMAT
FT                   AAQRAKDDPAAAVEQQSLSAEASAISAALATAISQLAAALEKSGGSPSGGLVSTQA"
FT   gene            233960..234094
FT                   /locus_tag="Bcen2424_6083"
FT   CDS_pept        233960..234094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6083"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12815"
FT                   /protein_id="ABK12815.1"
FT                   /translation="MARIGAFCITTWLAAAILYFGQHSVAMIVLSGVVVFGGFDLLRP"
FT   gene            complement(234235..236937)
FT                   /locus_tag="Bcen2424_6084"
FT   CDS_pept        complement(234235..236937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6084"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="TIGRFAM: putative alpha-1,2-mannosidase; PFAM:
FT                   glycosyl hydrolase 92; KEGG: bcn:Bcen_5720
FT                   alpha-1,2-mannosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12816"
FT                   /protein_id="ABK12816.1"
FT                   /translation="MKNTRLLIVAALTGAALAACGGDDVNSPSIAGSGGTTGNGGTDGP
FT                   STSGPSQPGQPSQPGQPSTPARTNMQLTQFVNPLIGTQVNNDSGYGGNVNPGATVPFGM
FT                   VDFGPNTPRYNFNGSGGYLSSGGSGGTIDFFSVTHLSGVGCPGQGAVAMLPTDGANAIA
FT                   PGGRPTGIAYSYSDEVAQPGYYKVRLASGITTELSATARAGLARFTYTDKDKGFFSVDA
FT                   KLNGNSDSGSTSITANNVALAIAGDGKSMSGQAVAPAFCTPYGTIWNAPVYFYATFDKP
FT                   LRKQTGTSSVNTASNGAATLQFDLTDADKTVTVKVGISSVSVSNAQANLAAEGEKLAFD
FT                   DARTKASAAWNDRLNTIQIDQAKDPASLNATQKANLTKFYTALYHVFSAPTLYSDTNGE
FT                   FRSMRQPRNANGSYPTSVDRTGTVPQRATANVKDYAYKRPDGSQGGGANHYTGFSLWDT
FT                   YRSQAQLLALLAPREASDMMQSLVVDGLQCGAFPHWVDGSDDSTPMAGDNALNVIAGSY
FT                   KFGATDFDLVSAARLTKQSVFDPSSACNDRASAPGLANFLTAHYLSQSDDGHSSSATIE
FT                   RVLSDRSAAAFLQALPAGVLNAPSVGVTSDNIGTLYTRASWWRNIFDYPNKVIAARNAP
FT                   PAGAAPGTLGTLVQGAFHESTEPNYFWTFAQDWSALIDAIGGKQAAVARLNKLFSITTP
FT                   YSTVPTAGSLNGGESSNGLYIGNEPSFQSPWGYNWAGQPSGAQYILPIIMAQTFGTGRD
FT                   GLPGNDDMGATSSWYVWATLGMFPVIPSEAGLALSTPQFSGITVWLGNGKTLRLESDKQ
FT                   VAADDTGRAAFPYIQSLKVNGADYAGSWLPMGKIANGGTMSYALSATPTQWAAADNLTP
FT                   PSGPNADYTQMTAGSASTAMRMQHQGGVR"
FT   sig_peptide     complement(236872..236937)
FT                   /locus_tag="Bcen2424_6084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.861 at
FT                   residue 22"
FT   gene            complement(237357..238544)
FT                   /locus_tag="Bcen2424_6085"
FT   CDS_pept        complement(237357..238544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12817"
FT                   /protein_id="ABK12817.1"
FT                   /translation="MHSNPFRLRSARLLAALTLATTAVTVHAADWIVSGNDGKYQRVEG
FT                   RDTYLPSPPADTLTLLDASTFPPKVALQVDVENGIQGPPQAVAITPDAKLALVGAPTRY
FT                   DTAAKQLVFDTFLQVVNLDSAPPAITRIELGTHPQGIAIDRSGRLALVANVDGSVSILR
FT                   IDGTQVTLEGNLKIGKKRLAGISFTHDGKHALVSLRDEQGIAVLNVDDGKVTDSGTRLS
FT                   TGVAPYTIDVSSDNRWAVVSNVGLAGLPGYTGTLAGDADSVALIDVSRVPFRTVQYLTV
FT                   PSLPEGVAISPNGKWIAVQAMDGSNLTADNPGRHKLGKVLLFEIRDGRAVKVNEVPGGE
FT                   AAQGIVFTADSRHVIVQFNVERQLALYAVEGGKLRDTGKRIALTGGPSSLRTLPR"
FT   sig_peptide     complement(238458..238544)
FT                   /locus_tag="Bcen2424_6085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(238682..240184)
FT                   /locus_tag="Bcen2424_6086"
FT   CDS_pept        complement(238682..240184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6086"
FT                   /product="MlrC domain protein"
FT                   /note="PFAM: Uncharacterised conserved protein UCP012702;
FT                   MlrC domain protein; KEGG: bur:Bcep18194_C7545 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12818"
FT                   /protein_id="ABK12818.1"
FT                   /translation="MKILIARMNHETNTFSPVPTPLAAFGRNGPDWGDDAYRANRGMRT
FT                   AMAAFIDAAERAGADLVTPVSAAANPSGPVAADAYAAICDAIVAAAPGCDAVMLDLHGA
FT                   MVAEQSADGEGDLLARVRAALPDAPIAVALDLHANVTQKMVDHADVIVSFKTYPHVDMY
FT                   ETGEHAARLLLDRLHGRARPVLAWRQPPLMTSTLRSASAEGAMRRAVEAARAAEADGML
FT                   AVSILPGFSLADIPAPCISVVVVADGDRAAADAVAERIARQIWDARDEFVYRSAPLAES
FT                   VAQAAALAQGADRPVLMLDHGDNCMSGGPCDTMDLLEAALAHGLDGIVSGPLCDPDAVA
FT                   ALIDAGVGATVTVPVGNRLPSHGGVRREPFRATGIVRAITDGEYVITGPTYTGQRAYMG
FT                   RAAVLDIGTATLVVTERTQEPWDLGVFESVGVDPRRARFLLLKSRMYCRPVFVPIASAL
FT                   VECDSRGVTGSDYGLFRYERLARPVYPLDDIVEWSSGTRRTD"
FT   gene            complement(240181..241470)
FT                   /locus_tag="Bcen2424_6087"
FT   CDS_pept        complement(240181..241470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6087"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: bcn:Bcen_5723 amidase,
FT                   hydantoinase/carbamoylase; TIGRFAM: amidase,
FT                   hydantoinase/carbamoylase family; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12819"
FT                   /protein_id="ABK12819.1"
FT                   /translation="MQVQDLTPGVAASGLRVDGARLWDSLMRLARIGATDKGGVCRLAL
FT                   TELDRDARDLFVAWAKDIGCTVRVDAIGNIFARRAGERDDLPPVTTGSHIDTQPTGGKF
FT                   DGNYGVLAGLEVLRTLDDAGVRTRAPLEVAVWTNEEGSRFVPVMMGSGVFAGAFTLDHA
FT                   LAQCDRDGVSVRDALAAIGYAGSADDGHGAHPVGAYFEAHIEQGPVLEAHDTTIGVVEG
FT                   ALGQRWYDVTVHGMEAHAGPTPMELRRDALLVAADLVRAVNGIARAHPPHGRGTVGWVD
FT                   VHPNSRNVIPGRVTLTVDLRAADDATLAAMDAELRAACADHGAAAGMRIDIEPVVYFPP
FT                   QPFDPALVEQVRAGASVLGLSSMNVISGAGHDAVYLARVAPTAMIFVPCKDGISHNEIE
FT                   DADPAHLEAGCNVLLHAMLGAAGIAGGQAR"
FT   gene            complement(241505..242206)
FT                   /locus_tag="Bcen2424_6088"
FT   CDS_pept        complement(241505..242206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6088"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5724 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12820"
FT                   /protein_id="ABK12820.1"
FT                   /translation="MMLDVKEVHACYGKSHVLQGISLNVNEGETVTLLGRNGAGKSTTL
FT                   KTIAGVVAPTGGTVTFEGRPVAGQPAHRIAAGGLCFVPEHRGIFRLLSVEENLRLGARR
FT                   DSPWQLDEIYRIFPRLKERRRNGGAQLSGGEQQMLAIGRALMNHPRLLMLDEPVEGLAP
FT                   VIVEEIVEQLKRIKAAGVAILLVEQNLEVCTQLADRHFVIEQGVIVYEGSNAAFAADHD
FT                   VKDRYLGVGVA"
FT   gene            complement(242203..242970)
FT                   /locus_tag="Bcen2424_6089"
FT   CDS_pept        complement(242203..242970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6089"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5725 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12821"
FT                   /protein_id="ABK12821.1"
FT                   /translation="MSEAILEARGIVKRYGKFTALGGVDLRIMPRTVHSVIGPNGAGKT
FT                   TLFHTLTGTLPITSGSILFDGHDVSHEPDHKRVRRGIARSFQVTSLFPNLSVRENLRVA
FT                   AQGVESRRALNPWTPPRGALAHDGVVDDVLERLGLQRFADTAAGVLSHGQQRRLEVGMA
FT                   LAARPRAIFLDEPTSGMGIDDLDDMKALIRGLRDDYTVVLIEHNMGIVMDISDTITVMQ
FT                   QGRVLVEGQPDAIRGDARVRSAYLGNMITGGRA"
FT   gene            complement(242967..244010)
FT                   /locus_tag="Bcen2424_6090"
FT   CDS_pept        complement(242967..244010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6090"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_5726 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12822"
FT                   /protein_id="ABK12822.1"
FT                   /translation="MIDSSKPLPPGAAASQRLRPWRGLLQRPEGWLAVVAACVLPLVLS
FT                   SGSLATEVLVFALAALGCNLLLGYTGLLSFGQGIFFGLGSYAAGLVLTRGVASVSVALL
FT                   AAAVLGAVAAALVGWFSIRQRGTYFVMLTLAFGQLFYFLAYTTPDVTGGDNGLLDIPRP
FT                   ALAAFGHPLVALDSPWRYYGFVAVLFVAVFWLLLRVSRSVFGRTLLAIRDNEARAAAAG
FT                   YDVKRFKLAAFVISGAVTGLAGALHALMTGIAPLSNIDYHTSEMILVMTVIGGTGNLFA
FT                   SVLGAAFYVLFADWLSTLWPRWLLLLGLVLIAVSLFMQRGLWGLGERIVASLRRGDRAA
FT                   ATVKERQ"
FT   gene            complement(244007..244933)
FT                   /locus_tag="Bcen2424_6091"
FT   CDS_pept        complement(244007..244933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6091"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_5727 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12823"
FT                   /protein_id="ABK12823.1"
FT                   /translation="MHAFAAQRAPRASVTFLSDTEAMNVYLLQIVNGIGVGMLYFLLAV
FT                   GLSIVFGLLRFVNFAHGAFYLLGAYLCYQALQWSANFWVALAVVPLVVGAFAWIVEKLV
FT                   LRHVYAQQHEFHILATVGLALVLQECAILAWGPLGDNVPPPDALNGVVIWGGFVYPKYR
FT                   LFVIAFTAVLAALLWWVLEGTRLGSTVRAGSESTEMVSLLGINVTRVFSLVFALGAATA
FT                   ALAGVLAAPIRGVDPFMGIEALGVAFVVVVVGGMGNFLGALVGGLLVGIVQSLMSTLWP
FT                   EGARLMIYVAMAAVLLLRPNGLLGRAA"
FT   gene            complement(244938..246161)
FT                   /locus_tag="Bcen2424_6092"
FT   CDS_pept        complement(244938..246161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6092"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   KEGG: bcn:Bcen_5728 twin-arginine translocation pathway
FT                   signal; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12824"
FT                   /protein_id="ABK12824.1"
FT                   /translation="MRSVNLNRRELLKLAALSAVPGALGSMSSRVAFAQGAPIQLACPV
FT                   PMSGPFAANGKYADLGMQLAVKQYGKVLGAPLAYTALDTEGKPATAVRRVQEIAQQKGV
FT                   RFFAGGILSSESLAMGKEVQKADGVFITTAGADEITGKDCNAATFRWSVPTFGAIEQTV
FT                   RPLIQMLPKAKRWYTITPQYVFGDGLLSAAKAVFKEKGIEHVGNSYHSLAEKEFSGYLT
FT                   NAAAAQPDVLLILNFGSQSSDTLRQAVSFGMKRNCTILLAWASGLEQFEALGPDICDGV
FT                   YFGAQYWHGIDSPLNRDLVKRANAAFKANPNYSLAGSYICSKILIDAMVKAGSADPKKV
FT                   VAAMEGMKYDGLTGPEEIRKGDHQVLKNYYLLKGKPKSRMKNADDYADIVSSGQSFLPL
FT                   DKTGCKLA"
FT   sig_peptide     complement(246057..246161)
FT                   /locus_tag="Bcen2424_6092"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 35"
FT   gene            246376..247233
FT                   /locus_tag="Bcen2424_6093"
FT   CDS_pept        246376..247233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6093"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bcn:Bcen_5729 GntR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12825"
FT                   /protein_id="ABK12825.1"
FT                   /translation="MVMDRARAGLAVEIKQPKRADLVAEEIKRLITEKDLKPGDRLPRE
FT                   AELQQLYAVSKSTIREALKSLEVQGLIKVTTGPSGGGMVVEVPLDRTLQLLQNYLFFKD
FT                   VTIDDIYTVRKLLEPELAAGAVPHLTERDFAALESNIACCDGGSGVHDRGHMLRQRQED
FT                   TTFHDILAAANPNPFLRFSCELINEMIRQLIEFRNDTPLAEHKRFGEANVSIHKAILQA
FT                   ARERDVERVRALMVEHMTEAPKHVKRMKGKLRGRLILDSEIRRRAAAAPVAESGTAAAD
FT                   PEER"
FT   gene            complement(247364..248803)
FT                   /locus_tag="Bcen2424_6094"
FT   CDS_pept        complement(247364..248803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6094"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_5730
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12826"
FT                   /protein_id="ABK12826.1"
FT                   /translation="MRTSQQSYIDGQWLDPADARSIDVIDPATARRYAQLAIGDAADVD
FT                   RAVGVAKRAFDTYSRWSVDERVALLTRVLDIYQRRYEEVAQTISQEMGAPIAFARAMQA
FT                   AVGTAHLEQTIRALQSFRFSTQTGSLLVSHDPIGVCALITPWNWPINQIVCKVAPALAA
FT                   GCTMVLKPSEIAPFSAILFAEILHEAGVPRGVFNLVHGYGHEVGDALSRHPEVDMVSFT
FT                   GSTRAGVEVAKAAADTVKRVHQELGSKSPNLILPDADIEDAVTRGARSCFSNSGQSCNA
FT                   PTRMLVHVDHLARAEQAARREAERTVVGDPRSTETGIGPVVSRTQFDRIQHFIRLGIEE
FT                   GATLVAGGPGRPAGLTDGFYVRPTVFSNVTPDMTIATEEIFGPVLAIMTYRTEDEAVAL
FT                   ANDSVYGLAAYVQSTDLERARRIAARLRVGNVHINYPAWNPAAPFGGYKRSGNGREYAE
FT                   FGLVEYLETKGTTGYTEGGAR"
FT   gene            complement(248832..250229)
FT                   /locus_tag="Bcen2424_6095"
FT   CDS_pept        complement(248832..250229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6095"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bcn:Bcen_5731 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12827"
FT                   /protein_id="ABK12827.1"
FT                   /translation="MHAVDVNSAADLQALGKRHLLMHFTHADAYRENALTVFDRGEGCW
FT                   LVDRNGKRYFDGLAGLYCVQVGYSHGAEIGDAIREQMARLPFATNWGVGHEPAIRLAHQ
FT                   LATLAPEGLNRVFFTSSGSESNESAIKLVRQYHQSRGEPQRRKFIARRVAYHGTSFGAL
FT                   ALNGMTNFRKHFEPLMSGVRHVGNTKRYGRPAGETEAQFTRHLLDEIESLIVQEGPDTV
FT                   AAIVVEPLQNAGGSLTPPAGYAAGLRDICDRHGVLLVADEVICGFGRLGEYFGSARYGL
FT                   KPDIITFAKGIASGYVPLGGVIASDAVVDTVLDGPQQMFLHGATYGGHPVACTAALANL
FT                   VIMEREGVLANVRDNEAVFRQTLDGLLELPCVGDVRGDGYHYSLELVTDKAARRWAAGL
FT                   GAQAFVSTILAPAIFDAGLLCRAGVDHEGTPILQFSPPLVMSRDEIVWFVAQIRDILVE
FT                   SYARATR"
FT   gene            complement(250281..251669)
FT                   /locus_tag="Bcen2424_6096"
FT   CDS_pept        complement(250281..251669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6096"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bcn:Bcen_5732 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12828"
FT                   /protein_id="ABK12828.1"
FT                   /translation="MDNDRPGRTASAAAMHECGADAQRGDTDARKPHLLGLSTLVIFGL
FT                   AYMLPMTVFTTYGLVTSETNGHLTAAYAVTLIAMLFTARSYGHMARLMPSAGSAYTFAS
FT                   RNFGTSAGFMVGWALLMDYLFIPMISYLAIGIYMKQIFPAVPASVWIVGSIALITGLNI
FT                   VGIRLVNRVNLILIASQLVFIAVFVIASAHVAAGEGLSMAVALPSSGDARAIFAGSAIL
FT                   CLSFLGFDAVTTLSEETREPRRTVPRAILLCTLASGLLFMLIAYVGQLVFPDWHAFKDL
FT                   DSASLDLMRRVGGRTLSAFFVAVYVAGCFASAMAGQASVTRVLFAMGRDRVLPESVFGH
FT                   LHARLRTPVRATLAVGVVSLSALFITLDLASTMISFGALVAFAIVNLCVMRSYLGRPEH
FT                   RHAVGWIAYGLMPAIGFAMNVWLWSGLSRQTFYVGIGWLVLGLCQLVWLTRGFTRPAPT
FT                   LSMN"
FT   gene            251846..253015
FT                   /locus_tag="Bcen2424_6097"
FT   CDS_pept        251846..253015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6097"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_5733 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12829"
FT                   /protein_id="ABK12829.1"
FT                   /translation="MLLCRTGVLRTFRLCSVRPRHRIGTMDSRSQRNQSRAERSLRSAL
FT                   GLARPAGRQEDIPATVHAIAVALDECRVRHIAGAALLEGTGLGADEVASPNLHVNRGQE
FT                   QRCFRNLLRCSGVPSIGLSIGARLHVSTLGLAGYAMLISGSVMQAFRCMGQFPLFMGLY
FT                   FDVRVDAHAGGMSVTIGRYNGEPDLEVFQADMCLSSLRLIVSDLVGKPVWPEQVQLARR
FT                   TPRNAADYARHFGCPVVFNAADNRLVFTSVDGTEAPRLANEVSFNALHGQCEVLERQWA
FT                   ASVGTRFADRAKELMTRDLVRFKSMTALASALHLTERTLRRRLDKDGITFQSLLDDVRR
FT                   DEAVRLLDDHALTVAAIAERLGYSEPRSFRHAYRRWTGKTPRSESDADA"
FT   gene            253089..253487
FT                   /locus_tag="Bcen2424_6098"
FT   CDS_pept        253089..253487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12830"
FT                   /protein_id="ABK12830.1"
FT                   /translation="MRGKTAPTIARLPINVIGTRAPRRRFYRTDSVFESIFAHAALRNR
FT                   APGDASPRSPAGRRDLLIVLYSRQLHHKTHDLVRNVMSFRTSLRMHPFRHVKGASGPSG
FT                   RLPAARIHAVFTRRCPARTRLAVTAPPG"
FT   gene            253678..254394
FT                   /locus_tag="Bcen2424_6099"
FT   CDS_pept        253678..254394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6099"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_5735
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12831"
FT                   /protein_id="ABK12831.1"
FT                   /translation="MTRRTVQLVGSLVAIIAVGWALARGIGAETFHQRADDLAYYAGQH
FT                   MLLVVYSMTLAIAVGVPAGVLLSRPRFQHQAERFMQVFNIGNTIPSLAVLAIALGIFGI
FT                   GNVPAIVALFLASLLPVTRNAYEGMKNVPAALREAAKGIGMTGWQSLLRVELPNALPII
FT                   VGGVRTALAINVGTAPLAYLIGADSLGSLIFPGIYLDNQPLLLLGASLTAILALVLDGI
FT                   VAAGSRHWLARHGGAA"
FT   sig_peptide     253678..253749
FT                   /locus_tag="Bcen2424_6099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.843) with cleavage site probability 0.454 at
FT                   residue 24"
FT   gene            254391..255302
FT                   /locus_tag="Bcen2424_6100"
FT   CDS_pept        254391..255302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6100"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bcn:Bcen_5736
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12832"
FT                   /protein_id="ABK12832.1"
FT                   /translation="MTLHRILRSLARLCAAGVLCVAAGTPAFAAKLVLGAKNFTEQYVL
FT                   AELTSQYLRSRGYDVEVRAGLGSTLARSALENGQFDLMWDYTGTAALVYNKIQDKLSPE
FT                   EMYRRVKALDVPRGLVWLDASPLNDTYAIGLPSQLAQATGIRTVSQLAEHLKTDPAAKH
FT                   YVFGMDAEFANRPDGLKPLLAAYGMQFSRAQLKQMDPGLVYTALHNNQLKIGLVYTTDG
FT                   RVKGFGIVPLEDDRHFFPPYNATPVVRKGTLESNPKLATQLNALSAALDNDAMQAMAKA
FT                   VDLDGKSPRDVADAFLCTHPLP"
FT   sig_peptide     254391..254480
FT                   /locus_tag="Bcen2424_6100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            255314..255967
FT                   /locus_tag="Bcen2424_6101"
FT   CDS_pept        255314..255967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6101"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_5737
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12833"
FT                   /protein_id="ABK12833.1"
FT                   /translation="MSVFDYLASSWPELLQLTLQHVWLVAIAVGCAIVAGVPLGILINR
FT                   HDWLAGPLLGIATLVLTLPSIALFGLMIPLFSRFGQGIGAAPAITAVFLYSLLPIMRNT
FT                   YLALHNVEAGVKEAGTGIGMTSWQRLRLVELPLAVPVILAGVRTAVVMNIGVMTIAAVI
FT                   GAGGLGTLILRAIGQSSMMKLLVGAVLVSLLAIVADRLLQMLQRALTPKGVQKT"
FT   gene            255964..257142
FT                   /locus_tag="Bcen2424_6102"
FT   CDS_pept        255964..257142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6102"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bur:Bcep18194_C7553 ABC glycine
FT                   betaine/L-proline transporter, ATPase subunit; TIGRFAM:
FT                   glycine betaine/L-proline ABC transporter, ATPase subunit;
FT                   PFAM: CBS domain containing protein; ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12834"
FT                   /protein_id="ABK12834.1"
FT                   /translation="MIELDKLTKTFTRKDGQAVRAVDSVSLSVPEGEICVFLGPSGCGK
FT                   TTTLKMINRLIAATSGRVLINGEDTAQLDEVDLRRHIGYVIQQIGLFPNMTIEENITVV
FT                   PRLLGWDKKRCAERARDLMSMVALDPKLYLKRYPRELSGGQQQRIGVIRALAADPPVLL
FT                   MDEPFGAVDPINRESIQNEFFQMQRQLNKTVIMVSHDIDEAIKLGDRIAVFRRGQLVQY
FT                   DHPDTLLARPRDEFVAQFVGQDSTLKRLLLVKAGDAATQPETARVDTPLAHALAVMDET
FT                   DCRYLTVLDDAGRALGYVTRRAARTDGGGVCGERVTPFPAGVAADDNLRIVLSKMYQYS
FT                   VSWMPVLDPDGAWLGEITQDSIAAYLSSGRSRRQTGQPPGSPAEAVAAVATS"
FT   gene            complement(257298..257675)
FT                   /locus_tag="Bcen2424_6103"
FT   CDS_pept        complement(257298..257675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12835"
FT                   /protein_id="ABK12835.1"
FT                   /translation="MNKLLPMTIALLAGSGIGAAPLHAAGAMDAPPCSAAHAADQAGGN
FT                   GAMPGTSVRSFSTAGCSGAVLQGDRATATVDGDRIELRDGAVYVNGRSYGAVTPAQTVE
FT                   YEAARDRRTLKVDGKVRTPQR"
FT   sig_peptide     complement(257601..257675)
FT                   /locus_tag="Bcen2424_6103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 25"
FT   gene            257961..258941
FT                   /locus_tag="Bcen2424_6104"
FT   CDS_pept        257961..258941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6104"
FT                   /product="transcriptional regulator, MarR family with
FT                   acetyltransferase activity"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; regulatory
FT                   protein, MarR; KEGG: bcn:Bcen_5740 transcriptional
FT                   regulator, MarR family with acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12836"
FT                   /protein_id="ABK12836.1"
FT                   /translation="MDLIDAPAKPRDATILELRDFSRKLVRELGFMRATLADSDWAPSA
FT                   VHAILEIGMAPGINAKDLGAILRLDKSNTSRQLARLEAAGVVERRVSSEDARAIELYLT
FT                   AEGKKLQKRIDTFATDQVSNALRRMIPADQQALLRSLALYADALAQDNAARASVAPADA
FT                   PSIREGYQPGCIGDIASLHARFYAEHWGFGAFFEQRVATELAAFAGALPADGKALWLCQ
FT                   EDGRTLASLAIDGDPATGVAHLRWFIVNDALRGSGVGRRLMTLAMRFVDEYRFRETYLW
FT                   TFKGLDAARHLYESFGFALTSESAGTQWGTEVVEQRFSRPGPSGG"
FT   gene            complement(259038..259643)
FT                   /locus_tag="Bcen2424_6105"
FT   CDS_pept        complement(259038..259643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6105"
FT                   /product="Rossmann fold nucleotide-binding protein-like
FT                   protein"
FT                   /note="KEGG: bcn:Bcen_5741 Rossmann fold nucleotide-binding
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12837"
FT                   /protein_id="ABK12837.1"
FT                   /translation="MNTVRACTATISPETTMQRNNRTIGVMGSGKEPWLAFSEPLGAWL
FT                   AQAGFNLLTGGGQGVMLAVARAFAGVPGRAGRSIGILPTQADPVAGFVPLDGYPHPFVD
FT                   IPVLTPLPRREPGAAPDTINRNYVNVLSSDLIVALPGGPGTAEEIALAQRWRKPLVCFG
FT                   PDGAFRSLVADAVCTSSVDDVIRFIDDAFTAEQAQAAR"
FT   gene            complement(259640..260887)
FT                   /locus_tag="Bcen2424_6106"
FT   CDS_pept        complement(259640..260887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6106"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_5742 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12838"
FT                   /protein_id="ABK12838.1"
FT                   /translation="MAANMKSSALGGPSAPRVEQVGAYAWKALAGSAIGYAMDGFDLLI
FT                   LGFMLPAITAALHLTPGQGGALVTWTLVGAVAGGIVFGALSDRYGRVRVLTWTILLFAI
FT                   FTGLCAFARGFEDLLVYRTIAGIGLGGEFGIGMALAAEAWPAAKRARVSCYVALGWQVG
FT                   VLLAALLTPLLLLHIGWRGMFVVGVLPALLAWVMRNKLHEPEAFVQRATQPKSNAFRML
FT                   VADARTARTSVGIVILCSVQNFGYYGIMIWLPTFLSKQMGFSLTKSGLWTAATVVGMMI
FT                   GVWVFGQLADRIGRKPTFLLYQLGSVVTVIAYARLSDPTAMLWAGALMGMFVNGMVGGY
FT                   GTLMSEGYPTAVRATAQNVLWNIGRAVGGFGPVAVGALAAHYSFQTAIALLAGLYVLDM
FT                   VATLFLIPELKGVELE"
FT   gene            complement(261174..261503)
FT                   /locus_tag="Bcen2424_6107"
FT   CDS_pept        complement(261174..261503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6107"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bcn:Bcen_5743 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12839"
FT                   /protein_id="ABK12839.1"
FT                   /translation="MTQALQELEAQLRDLNIKLSEAKQKEKQAALAAFKEQVELLGISQ
FT                   QEVLSALGYIVQRKRKAPAKYYDPSTGRSWSGRGPRPKWLEGKDLETLAVDREAKTWWP
FT                   GDDQG"
FT   gene            complement(261823..263172)
FT                   /locus_tag="Bcen2424_6108"
FT   CDS_pept        complement(261823..263172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6108"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="KEGG: bcn:Bcen_5744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12840"
FT                   /protein_id="ABK12840.1"
FT                   /translation="MHSSLRDTTRTIAEAMLAGSPERDGVVARMAAVLGEAQPWTHECA
FT                   DLALVHFGADWADTDTDALAAVLAEAPAFVRAWYGDRRPAVIRIVRRPLVQRPLPAPLA
FT                   GCDVPHWPTPGDLAGWLGVSVPELDWLSDHWRVDARSSATPLHHYTYVAVDKRSGGCRL
FT                   VEIPKGRLREAQRRILHGLLDRIAPHGAVHGFRKGHGIVSFAAPHADREVVVRFDLADF
FT                   FVSVRAARVHALFATLGYPAEVARTLTGLCTNRVPSARLLAPDLRDRFDWIGRQRYRER
FT                   HLPQGAPTSPALANLCAFRFDLRLAALARSLDATYTRYADDLAFSGGGALARDIERLQI
FT                   RVAAIALEEGFTLQLRKTRVMRRGARQQLAGVVVNRHPNLARDAFDRLKAVLTNCIRHG
FT                   PASQNHDAHPDFRAHLAGRVAHAAALNAARGAKLRALLDRIAWEPGGGDC"
FT   gene            complement(263425..263997)
FT                   /locus_tag="Bcen2424_6109"
FT   CDS_pept        complement(263425..263997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12841"
FT                   /protein_id="ABK12841.1"
FT                   /translation="MLTRLRNGILRAQDLRESGAAIPAQRPSMACELVDLSAKRATWRV
FT                   PVPNQADCYLKAEPGGAERFVVHIDADMFYRRWLETSPTFPKQNSQDCVPRRAMSLDSK
FT                   FATAAAAFRSGRDAPVTLPSVGYWAAASGYEVAMSDGMTRTFWLLAHRVRSFPVSVADA
FT                   SWATILNGLAGIGVAPIAFSELFSRRA"
FT   gene            complement(264220..264975)
FT                   /locus_tag="Bcen2424_6110"
FT   CDS_pept        complement(264220..264975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6110"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR, HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG: bcn:Bcen_5746
FT                   transcriptional regulator, histidine utilization repressor,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12842"
FT                   /protein_id="ABK12842.1"
FT                   /translation="MSETERRLSARQASASADTVPARALPAYQQIKRYVVERIAKGDWK
FT                   PGGAIPTEAELVKEFGVARMTVSRALRELTAERVLTRIQGAGTFVERRHYESTVLEIRN
FT                   IADEIAERGHRHSARVLLIERSVDPDAIDALGLRAGPVFHSRIVHYEEDEPIQFEDRYV
FT                   NPALFPAYLEQDFTLETPNHYMVRLAPIQRAEFRIYAEKPNAQVRRHLVMEIGEPCLLL
FT                   RRRTWVGDQVATSVRLWHPASRFHLAGNM"
FT   gene            complement(265026..266519)
FT                   /locus_tag="Bcen2424_6111"
FT   CDS_pept        complement(265026..266519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6111"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   bcn:Bcen_5747 phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12843"
FT                   /protein_id="ABK12843.1"
FT                   /translation="MTVFRAARPLDWRQVAAVAAGEPLALADETRARVVAARELVDEIV
FT                   ARGIRAYGVNTGVGALCDVIVSPAQQSTLSHNILMSHAVGVGMPLGAAETRAIIAAAIN
FT                   NYAHGHSGVRADVVDQLVALLEHDCLPEVPAHGSVGYLTHMAHVALVCVGHGHARHRGE
FT                   RIRGDEALRRIGREPLVLGAKEGLSLVNGTPCVTGLAALALARAERLLDWADWIAAMSF
FT                   ENLGGQLAAFDPASLALRISPGIGQVGARLRALLADSGMLAAASGRHTQDPLSLRTIPH
FT                   VHGAARDVFDVTAEVVDRELASVTDNPIVAGTRDAPAVHSQAHAVGAGIALAMDSLASA
FT                   MAQVAAIAERRLDRLVNPLVSGLPAFLATPGGSCSGFMIAQYTAVALVAQNQRLAAPAS
FT                   LDGGITSGLQEDHLCHATPAALKALDIIENTTRVLAIELLAAAQAYDLQPGETGRAAST
FT                   DALWRHVRERAPAYHDDRPLADDIAIAAGIVAGVPPSLR"
FT   gene            complement(266527..267318)
FT                   /locus_tag="Bcen2424_6112"
FT   CDS_pept        complement(266527..267318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6112"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5748 ABC transporter related; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12844"
FT                   /protein_id="ABK12844.1"
FT                   /translation="MNTAAPVALSVRNIHKSFGDHHVLKGISLDAHEGDVISILGASGS
FT                   GKSTFLRCLNLLETPDDGSVALAGEELAMKRARDGKLHPSDRRQVDRIRSQLGMVFQNF
FT                   NLWSHMTVLDNLVEGPLRVQKRSRAEAVEEAEALLARVGLADKRGYYPAHLSGGQQQRV
FT                   AIARALAMHPKVMLFDEPTSALDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSN
FT                   RVMFLHQGEVDTDGTPDEVFGGQTSERFRQFVSSHHDRTTN"
FT   gene            complement(267346..268092)
FT                   /locus_tag="Bcen2424_6113"
FT   CDS_pept        complement(267346..268092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6113"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_5749 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12845"
FT                   /protein_id="ABK12845.1"
FT                   /translation="MSIDFAFLLDTLRQLLAAVPTTLGLFFASLVLGGLLSLVIVTMRV
FT                   SPRWLPNRFARAYILVFRGSPLLIQMFLVYYGLGQFGVIRESFMWPLLREPYVCAVLSL
FT                   ALCTAGYTAEILRGGLMAVPVGQIEAGYSIGLSGFSLLRRVIGPIALRQCLPAYSTEAV
FT                   LLVKSTALASLVTVWEVTGVAQQIIQQTYRTTEVFVCAAIIYLGLNFIVVRVLGALEWR
FT                   LSGHLRAPKPSGAPAAATRNTQRVAS"
FT   gene            complement(268105..268827)
FT                   /locus_tag="Bcen2424_6114"
FT   CDS_pept        complement(268105..268827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6114"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_5750 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12846"
FT                   /protein_id="ABK12846.1"
FT                   /translation="MAILEMLGFGTEGWGGVLLLAALMTVALTLAALAVGAMIGAAIAA
FT                   AKLSRYRTLRLLGDLYTTVFRGVPELLVIYLFYFGGSTLVTAVGQWFGAEGFIGVPPFV
FT                   IGALAVGMISGAYQAEVYRAAVLAVSKGELEAARSIGMPRSMVLRRILVPQVLRFALPG
FT                   IGNVWQLSLKDSALISVTGLAELLRTSQIAANSTHQYFVFFVAGGALYLLMTGLSNRVF
FT                   NRAEAIVGRSFRRNFARN"
FT   sig_peptide     complement(268693..268827)
FT                   /locus_tag="Bcen2424_6114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.705 at
FT                   residue 45"
FT   gene            complement(268928..270037)
FT                   /locus_tag="Bcen2424_6115"
FT   CDS_pept        complement(268928..270037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6115"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_5751 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12847"
FT                   /protein_id="ABK12847.1"
FT                   /translation="MVEFKICLVIIAIRPPESHQTCAAIPRNEARQTLEIRGFPAFPPF
FT                   LLITPCLAVFLLACLYRQIPEAACCTEGMANFNARRNLVNGKRIKWAIRTIGVIAAAAA
FT                   TLAAPVQAKEWKTVTVALEGGYAPWNLTLPGGKLGGFEPELLANVCERIKVQCNMVAQD
FT                   WDGMIPGLQAGKFDVLMDAISITPEREKILLFSRPYAATPATFAVTDTKILPKAAPGAP
FT                   IVKLTGDANADKPTVDTLRKQLKGKTIGIQSGTVYTKFINDSFKDIASIRVYKTSPERD
FT                   LDLVAGRIDASFDDVTYYAANNAKKDNASIVLAGPKLGGPIWGPGEGLAFRKQDADLKT
FT                   KFDTAIAAALADGTVKKLADKWFKTDVTP"
FT   gene            complement(270309..271274)
FT                   /locus_tag="Bcen2424_6116"
FT   CDS_pept        complement(270309..271274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6116"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: bcn:Bcen_5752 dTDP-4-dehydrorhamnose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12848"
FT                   /protein_id="ABK12848.1"
FT                   /translation="MPNQISPTGRSTVLLIGASGLLGRAVAACLARESSLTLLATIRNP
FT                   QSAGAKLLALPPENIAELDLLDQPSLERIFETHRPAAVILCAAERRPDVCERDPDAARA
FT                   INVTAPARIGALATRYGAWTLGISTDYVFDGKAAPYREDATPNPLNIYGRTKLEGEAAL
FT                   LAASPLSCVLRLPLLFGPIADWSESAVTSLVPAVVASSRPGADAVGMDAWAIRYPTYTP
FT                   DVAQVIRDLTLRHLAGESVTGIRHWSSEEPMTKYDIAQRIAAALGIDASLTPITQPTDA
FT                   TPRPYDCHLDAARVRALGIDYATPFDTALRTVLRDAPRAL"
FT   sig_peptide     complement(271188..271274)
FT                   /locus_tag="Bcen2424_6116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.442 at
FT                   residue 29"
FT   gene            complement(271583..271996)
FT                   /locus_tag="Bcen2424_6117"
FT   CDS_pept        complement(271583..271996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6117"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bcn:Bcen_5753 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12849"
FT                   /protein_id="ABK12849.1"
FT                   /translation="MRYVSLESKKDELLLAARVLMMILFVLFGWQKLNGFSGTVAYMAS
FT                   TGNPAPELAAVIAVAVELVGGVLIAIGFYTRPLALLFAAYTLATALIGHRYWALQGMEQ
FT                   YMAMINFYKNVSIIGGLLLLALTGPGRYSVDRK"
FT   gene            272024..272311
FT                   /locus_tag="Bcen2424_6118"
FT   CDS_pept        272024..272311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12850"
FT                   /protein_id="ABK12850.1"
FT                   /translation="MQPVPLRAESAREAGNGPLFARSDGKPHGPPPKNPTGDAATGGAR
FT                   RIGSGKARMQSTVLPRIINPSKHDSLSRLSGQSGKRAPSLRRPWFIANKI"
FT   gene            272587..274812
FT                   /locus_tag="Bcen2424_6119"
FT   CDS_pept        272587..274812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6119"
FT                   /product="LamG domain protein jellyroll fold domain
FT                   protein"
FT                   /note="SMART: LamG domain protein jellyroll fold domain
FT                   protein; KEGG: bcn:Bcen_5754 LamG-like jellyroll fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12851"
FT                   /protein_id="ABK12851.1"
FT                   /translation="MSKRFVERASLEELPNPARRALSLGLGLFPMLPLLPGLGVQAAQA
FT                   ALAGPARTPASASGVFRHPGLLITDDDFARIRGYIKAGQEPWAHWWSTLCAERFASLDA
FT                   RPFPLAGVYRADGSSRDMYVDIWRAWTLVLRWKLSDPQDNRYADKAVEFLDAWANTLKV
FT                   VGTVPPGSTAHDDHTFIILAGIQGHQWAQIGEVLRTYPGWAPANLKRFQDMLLNVFAPV
FT                   SSWFLSDGRIGSHANWDMASMVGAMAIGVFCDKPDLYRLACDCYAGNNRGTLRNFGNGA
FT                   IGHGVYFMHPGHFGQWEESGRDQGHSTLGMSLGGDLLEIAWNQGDDLYGLYNNRFLAAA
FT                   EYVARSNLLDESGKNYPMPYVRENNPSQPHPSFWTQVNYGQMGRNCWEPIYNHYVNRLG
FT                   LAAPNVARMVKLCEPKYGGSSDDVWWPTLIHRRPDYAGSMKPPSGLTAYLRGNRVVLSW
FT                   WGSVGATSYEIKRASRANGPFNLLGTVSASEVLTYSDIPSNGVWFYQITAQGAGAPGAG
FT                   SNVVRIAVPGEVRLSLPLNDPSGTGTHGALRTAAGTMTFIEGKLLDGATWSEGRRNDKA
FT                   IVFDGLKAGLQLPSGVFGDLDDFSLSLWVYANGLHWDSCVFYAGLDANAAMCIAPQTGS
FT                   GTLCFSIFGATFKDSQVVAAPWALPIRRWVHLAVTLQGNTCRLYVDGTEAAKSDEILLS
FT                   PRQVGDQVIFLGRNWAHPSFNGRIQGFRVYAGAWSAAEVAALARDAM"
FT   sig_peptide     272587..272715
FT                   /locus_tag="Bcen2424_6119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.558 at
FT                   residue 43"
FT   gene            complement(275033..275875)
FT                   /locus_tag="Bcen2424_6120"
FT   CDS_pept        complement(275033..275875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6120"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   bcn:Bcen_5755 formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12852"
FT                   /protein_id="ABK12852.1"
FT                   /translation="MAYLTPNEFVTRMVDAGESKLSMSTRDTLIRAYMAGAILALAAAF
FT                   AVSITINTGNALAGSLLFPVGFCMLYLLGFDLLTGVFTLAPLAVIDRRPGATWGGVFRN
FT                   WTLVFFGNFAGALTVALFMAIIFTFGFSEAPNAIGQKIGGIGEARTLGYAAHGAAGMLT
FT                   LFVRGVMCNWMVSTGVVAAMMSTSVPGKVIAMWMPILVFFYMGFEHSVVNMFLFPSGLM
FT                   LGAHFTVVDYLLWNEIPTVLGNLVGGLVFVGAALYSTHYKTAPKRAPASPVGVVARKA"
FT   gene            complement(276204..277559)
FT                   /locus_tag="Bcen2424_6121"
FT   CDS_pept        complement(276204..277559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6121"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; Nitrate and nitrite
FT                   sensing domain protein; KEGG: bcn:Bcen_5756 response
FT                   regulator receiver and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12853"
FT                   /protein_id="ABK12853.1"
FT                   /translation="MPATALQFALLAKHQEIASLRHLAEQIELVDLLGRLIHALQRERG
FT                   ATSIYLASSGKRFVAERAASRGESVPLVAQLRERLDLELTPARGSTSRLLSLIAWVLLD
FT                   LESLDVLREQIDHLALSAPDSVQAFSTVIGGLVELIFQFADSAADPSVSRMLIALVHVV
FT                   EGKEEAGQERAVGAHMFAAGTFSADQQQRLLYLIAAQERSLEVFASFASTAQSAWWETR
FT                   MTEPHMAALEKLRRVLCTAHAGDALDAVLSEAWFDAASARIDDLWHLQIALTLQVQETC
FT                   NARIDDAHRTLRDSERLMAQLRNNPPPHTQALAQFFAGDPLSARAAVHELPERLSGSDV
FT                   GTLASLKSLLESQSARLAGAEVELDAARRALYERKLVQRAKNTLMTRFSLREDEAYRML
FT                   QKASMDGNRPLADIAEDALTSPERFVDEHAQLSARRRTQRSAPDTPHDDGTT"
FT   gene            278108..279622
FT                   /locus_tag="Bcen2424_6122"
FT   CDS_pept        278108..279622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6122"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein; KEGG: bcn:Bcen_5757
FT                   flagellar hook-associated 2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12854"
FT                   /protein_id="ABK12854.1"
FT                   /translation="MPTNTPVNSGANANSLMQQAAQSIINGSTGNPAMDVGSLVKTLVN
FT                   AKTAGRAATLAASQTTGNTRISAFGALSSALGALEAGLTSLKNGALQSTFNAVASGKGL
FT                   TATAGAGAVAGTYTVGVTQIATAQALSSAGFNGSKALGTGTLTLSLGSQSFKVEVGGTN
FT                   NTLAGIAAAINGASGNPGISATVINGTDGAHLVLASSKTGAANAISVAVGNVSNDGGLS
FT                   NLGVTSTADPSGGASKIESANGAAAWRQSTAAQDAKFMLNGIASTSASNAVSGVLTGIT
FT                   LNLSAAAVSATDTQTLTVSTDTKSQAATITNFVSLYNTVVKTMGALSSYTAGASSQGAL
FT                   IGDSTLNTIRNSLASIVARGVDGGATTGKGNGHVNLLSIGIKLEKDGTLNVDSAKLDGA
FT                   LSANPSGVARLFNPENGIGTRLADQITQFTKKNGMIDVRTTALTADLKRVTQQQSDLSD
FT                   YAAQLTKQYQAQFTALNTLMARMNTNTQYLTRLFGGANSSGTLSNK"
FT   gene            complement(279750..280397)
FT                   /locus_tag="Bcen2424_6123"
FT   CDS_pept        complement(279750..280397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12855"
FT                   /protein_id="ABK12855.1"
FT                   /translation="MQHVTTTSRPPILAAPVDAMLHAVIDEVVHRSVSEATTRGGYMRC
FT                   ADYAIVGARVLTLLTGKPYRPFAGGEVMDFGGGNLYALCTTRERRRTARHLSQLARYHC
FT                   WIEARHDDALGRTRKEIVDFTLRHDETVANQLGMPFARAYQAYFWGWEDEHAVPAELHD
FT                   HPVFAKQGPVWRWAERECTSLLRAYEHERPGYFGRQVSRAIDWFADRVEGLG"
FT   gene            complement(280816..281763)
FT                   /locus_tag="Bcen2424_6124"
FT   CDS_pept        complement(280816..281763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6124"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bcn:Bcen_5759 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12856"
FT                   /protein_id="ABK12856.1"
FT                   /translation="MQHSQQSNVTIEGIVPVMLTPFDDAGAIDYAGLERLIEWYLAHGS
FT                   DALFAVAQSSEMQFLSLAERAALARFVVERVAGRVPVVASGHISDDLDAQVAELCAAAE
FT                   SGAQGVVLVTNRLDPQRKGSAALLDHLHRLLARLPSDLPLGLYECPAPYRRLLSDDELR
FT                   ACIDTGRFVMLKDVSCDLATVKRRVALAEGSPLKILNANAAIAWDAMKAGSAGFNGVFT
FT                   NFHPDLYQWLRTQGESNPALADELSTFLVVSAVSEALGYPALAKLYHQRIGTFGSIKCR
FT                   AIDYDVRERFWALDAVLDKIVAGTEHFRRRIAAS"
FT   gene            complement(281807..283126)
FT                   /locus_tag="Bcen2424_6125"
FT   CDS_pept        complement(281807..283126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6125"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5760 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12857"
FT                   /protein_id="ABK12857.1"
FT                   /translation="MNDNPPVPHAPPRIRRGQRIALALLMASGIVNYLDRGTLAVASSA
FT                   IRGDLGLSLAQMGLLLSAFSWSYALCQFPVGGLVDRIGPRRLLGIGLIVWSFAQASGGL
FT                   VSTFGWFIVARIVLGIGEAPQFPSAARVVSNWFPLRARGTPTGFFNAASPLGTALAPLL
FT                   LSVLVASFHWRWAFIVTGALGLVVAVVWFAFYRDPVRAQLSAAERNYLDADAQSVAAAP
FT                   KLTFAEWRSLFSHGTTWGMLIGFFGSVYLNWVYLTWLPGYLTMERHMSLIRTGFAASVP
FT                   FLCGFVGSLVAGWLSDLVTRRSRSPVVSRRNAVVAAMLGMVAFTIPAALVQSNTVALAC
FT                   ISVVIFLANAASACSWALATAAAPPSRIASLGAIQNFGGFIGGALAPILTGIIAQKWSF
FT                   VPALLTAAAIAFAGAMAYLLLVRKPIPEQAANAAPGPLPA"
FT   gene            complement(283187..284113)
FT                   /locus_tag="Bcen2424_6126"
FT   CDS_pept        complement(283187..284113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6126"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   KEGG: bcn:Bcen_5761 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12858"
FT                   /protein_id="ABK12858.1"
FT                   /translation="MSELTSPRIAVVGSVNIDLVTRAPRLPVPGETLLGTTFETVHGGK
FT                   GANQAVAAARLGASVAMIGCVGDDAFGARLHAALAAERIDVTHLHRIAGTATGVATITV
FT                   DDGGANSIVVVPGANACVDADRIDAARDAIAGAALLVCQLEVPVASVARAIACASAHHT
FT                   PVLLNPAPAQPLFDALLARVDYLVVNETEAESLTGIAVGDDASAARAADALCAKGVGNV
FT                   LVTLGARGVCWRGSAGRGRHRAMAVAAVDTTAAGDTFVGGFAVARAGGASMDDAIGFGQ
FT                   RAAAISVTRHGAQTSIPTRDEVNPMDT"
FT   gene            284355..285452
FT                   /locus_tag="Bcen2424_6127"
FT   CDS_pept        284355..285452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6127"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: bcn:Bcen_5762
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12859"
FT                   /protein_id="ABK12859.1"
FT                   /translation="MSTAPPRGGASRARRGSGRSVLGDVAKLAGVSTATVSRVYNDPGK
FT                   VSADVQQRVRDAALALNWIPNAAGRALASTRTHITGAIIPTLDDQVFASQVAGMQTIMA
FT                   EHGITLFLGCSNYDPAQALAQVRAMLSRGVEAVSLVGEAYPPELFELLAMHRVPYVVTY
FT                   AYRDDSPHCCIGFDNRAAFARLTTHLLDLGHRDFAIIMQPSTDNDRVQARLRGIHDTLA
FT                   AHGLAVRPVHQHEGAATIAFGRASLRAIAGSDAVTRPTAVICGNDALALGALLEAQALG
FT                   IDVPAQLSITGFDDVALAREIQPPLTTMWVDTDAIGRQAAHALLDALENGATGPGHAVQ
FT                   PELRIRESAAAPAKTQTQARTARGK"
FT   gene            complement(285548..286672)
FT                   /locus_tag="Bcen2424_6128"
FT   CDS_pept        complement(285548..286672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6128"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: bcn:Bcen_5763 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12860"
FT                   /protein_id="ABK12860.1"
FT                   /translation="MMSGDYIFIWEAADWPAWRFDLPALATPLADVSRAQGMLAGRLAD
FT                   VGLALRDEASLAALTDDVVKTSAIEGENLNVASVRSSIARRLGVDIGALAPVDRHVEGV
FT                   VDMVLDATTHSAAPVTEARLFGWHAALFPTGYSGLSRITVGGWRTDASGPMQVVSGPIG
FT                   RQRVHFEAPPAARVPDEIGRFLAWLNAPPAEPLLIRAGLAHLWFVTLHPFDDGNGRIAR
FT                   ALGDLVLARADRSPQRFYSLSAQIQRERNAYYDVLERTQRGSLDVTEWLAWFLNTLGRA
FT                   IDHAHTTLDAVLIKARFWQRCAGVAMNERQVKVMNRLLDGFEGKLTTTKWAALAKCSQD
FT                   TALRDITELVEQGMLRRSASGGRSTSYELVPFDG"
FT   gene            complement(286763..287680)
FT                   /locus_tag="Bcen2424_6129"
FT   CDS_pept        complement(286763..287680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6129"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5764 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12861"
FT                   /protein_id="ABK12861.1"
FT                   /translation="MEINDLRIFVATVDAGSFTAAADQLMLSKQFVSRRTMALEASLGV
FT                   RLLHRNTRNLAVTESGQEFYVRAQRILAEIADAEQAMSVRSTELHGSLKISAPLSFGIT
FT                   HVSPLIAEFLSAHPAVRLNLDLTDRRVDLIGEGFDLVLRIGSLEDSTLIARPLGAWRMI
FT                   ACASPAYLKRHGTPQTPADLAGHTCVLYGRERRVGWEFRVDGAVRTFDVQGPLVANNGE
FT                   VVRDAAIAGLGIALLPHFIVGAALDSGALVPVLDAYVPPPITLNAVFPQHREGFVTLRT
FT                   FIGFLAERLGEPAPTGVNGAGRVR"
FT   gene            287810..288535
FT                   /locus_tag="Bcen2424_6130"
FT   CDS_pept        287810..288535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6130"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: bcn:Bcen_5765
FT                   pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12862"
FT                   /protein_id="ABK12862.1"
FT                   /translation="MIDIRAANQRGRAEHGWLSSRHTFSFANYYDPKQVGFSDLLVIND
FT                   DRVAPGRGFGTHPHRDMEILSYVLDGALEHKDSMGTGSVIVPGDVQLMSAGTGVRHSEF
FT                   NHSQDTPVHFLQIWVGPAEKGAEPRYQQTNVAADDKRGKLALVVSPNGDAGSLKIRQDT
FT                   RIYAGLFDGDESTTLELDPSRFAYVHVARGSVTVNGVTLGEGDGARIRGEQALTIADGK
FT                   DAEVLVFDLRPVEVTAEWA"
FT   gene            288598..289200
FT                   /locus_tag="Bcen2424_6131"
FT   CDS_pept        288598..289200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6131"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: NADPH-dependent
FT                   FMN reductase; flavodoxin/nitric oxide synthase; KEGG:
FT                   bcn:Bcen_5766 flavoprotein WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12863"
FT                   /db_xref="GOA:A0KCF0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KCF0"
FT                   /protein_id="ABK12863.1"
FT                   /translation="MAKVLVLYYSSYGHVETMAQHIVEGAKSVPGVEVTLKRVPETIPV
FT                   DQARAIGVKVDQAAPVATVDELADYDAIIFGTPTRFGNMAGQMRTFLDQTGGLWMKGAL
FT                   VGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVIVGVPYACSGLVNMSEITGGTPYG
FT                   ATTLAGADGSRQPSANELDIARYQGKHVAELASKLAS"
FT   gene            complement(289306..289611)
FT                   /locus_tag="Bcen2424_6132"
FT   CDS_pept        complement(289306..289611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12864"
FT                   /protein_id="ABK12864.1"
FT                   /translation="MKQSRVVSVAVAVAASFGLSLTAAPAAYAQDPASAPAQKQLDKAQ
FT                   KKAARKAARARHASDLKAIGTGSGYRLTGDQSNYPQNAVQKAPATKAAPAAPASGQ"
FT   sig_peptide     complement(289522..289611)
FT                   /locus_tag="Bcen2424_6132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 30"
FT   gene            complement(289840..290574)
FT                   /locus_tag="Bcen2424_6133"
FT   CDS_pept        complement(289840..290574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6133"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: bur:Bcep18194_C7636
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12865"
FT                   /protein_id="ABK12865.1"
FT                   /translation="MTAFPKLGAIWVYLAASPLLGLTITLVAYLFAQAVYARARFNPLA
FT                   NPVLIAVAVIVVLLTLTHTPYPTYFEGAQFVHFLLGPATVALALPLYRQWSKLRRTALP
FT                   LLVGLLAGSLTAIVSAVGIAALFGASHQTIASLAPKSATTPIAMAVAAEIGGIPSLTAV
FT                   LVISTGIFGAVCARAILNLLRIDEPAVRGFALGVASHGIGTARAFQVSEEAGAFAGLGM
FT                   GLNGVLTAFVVPILLPVLSRWI"
FT   sig_peptide     complement(290476..290574)
FT                   /locus_tag="Bcen2424_6133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.783 at
FT                   residue 33"
FT   gene            complement(290571..290942)
FT                   /locus_tag="Bcen2424_6134"
FT   CDS_pept        complement(290571..290942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6134"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: bcn:Bcen_5769 LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12866"
FT                   /protein_id="ABK12866.1"
FT                   /translation="MLQAFAVLLIFQCLGEGVSYLFGLPVPGPVIGMLLLFGFVMLRPQ
FT                   VADAIEPTALELLRHLSLLFVPAGVGIMVSADRVRGDAVAVVVALAVSTTLAIAVTALV
FT                   TRALLRRQRRAGGTAEGAQ"
FT   gene            complement(291185..292219)
FT                   /locus_tag="Bcen2424_6135"
FT   CDS_pept        complement(291185..292219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6135"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bcn:Bcen_5770 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12867"
FT                   /protein_id="ABK12867.1"
FT                   /translation="MKIVKPLLIAAAVAAALSTAPAAFAAGADTVGPDAKTSAFLAALN
FT                   GQKGPGLETLSPAKARQVLVDAQNGVKVDLSGIDVSNRTIEQDGLSVPVTIVRPQGVTG
FT                   ALPVFVFIHGGGWVLGDFPTHERLVRDLVVQSGAVAVFVNYTPSPEARYPVAINQAYAA
FT                   TKWVAAHGAEIGVDGSRLAVVGNSVGGNMSAVVALMAKDKGGPAIRFQGLMWPVTDHNF
FT                   NTGSYNAYQQGHFLTRPMMKWFWDAYTKNEAQRNEIYASPLRASVAQLKGLPPALIQVA
FT                   QFDVLRDEGEAYGRKLDAAGVDATTTRYDGTIHDFGLLNALADDAPTKAATKAMANEIA
FT                   MRLK"
FT   sig_peptide     complement(292142..292219)
FT                   /locus_tag="Bcen2424_6135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 26"
FT   gene            complement(292277..292702)
FT                   /locus_tag="Bcen2424_6136"
FT   CDS_pept        complement(292277..292702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6136"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcn:Bcen_5771
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12868"
FT                   /protein_id="ABK12868.1"
FT                   /translation="MSIEKVLYRAHAKATGGRDGRATVPESGLDLKLTTPRELGGAGGA
FT                   GANPEQLFAAGYSACFIGAMKFVAARDKIAIPADAAIEGSVGIGAIPNGFGIEVELKIS
FT                   LPGLDRDIAQTLIDRAHIVCPYSNATRGNIDVTLTLV"
FT   gene            complement(292927..293493)
FT                   /locus_tag="Bcen2424_6137"
FT   CDS_pept        complement(292927..293493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6137"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_5772
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12869"
FT                   /protein_id="ABK12869.1"
FT                   /translation="METKPTVREQILDHAITLMMQRGYNGFSYRDLSDLVGVKTSSIHY
FT                   YFPSKDDLVLEAVAAYSDEVLAAMRTIDPALPADVKLSLYTKMFGRTLGDGNLICLCGM
FT                   LAADIETLPENVRQAVQAFFTANERWLAELLKQGVKEGTLQFSGEPETAARTLYAAFQG
FT                   SVLASRLFHTRARLEDVEAVWKTRS"
FT   gene            complement(293632..294228)
FT                   /locus_tag="Bcen2424_6138"
FT   CDS_pept        complement(293632..294228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6138"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_5773
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12870"
FT                   /protein_id="ABK12870.1"
FT                   /translation="MRKIDPERVEAKRRQILDAAIDCFARDGFHATSTASICKAAGMSP
FT                   GNLFHYFPTKAAIIEAIAQDDQREMAELFAKHADADDALAAIEEIALTLMELSSDPVYA
FT                   RICVETAAEATRNPDVAALFAANEAQVKGRMVALIKRGVAQGRIDGSLKPDLVATWLLA
FT                   LAEGAVGRVVFEPGFKPRAHRAMLRTIIQRMLKPQ"
FT   gene            294376..295395
FT                   /locus_tag="Bcen2424_6139"
FT   CDS_pept        294376..295395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12871"
FT                   /protein_id="ABK12871.1"
FT                   /translation="MKRIVIAGIALVLFGCVAAGALALRGLSDFELKGANVSTLTFHAG
FT                   DADLVGTLALPAHAPDAPIALLVHGDGPRTRFSDDAMLPLVNSLLDAGIGVFAWDKQGT
FT                   GRSSGDWLAQSMQDRANETVAAMARVRAAAGPMHKIGLLGFSQGGWVIPRVANAVRPAF
FT                   SVIVGGAVSWRRQGAYLTRRQLEATGLQPDRIDATLAAERRSNDAIFGRADVPADPARR
FT                   PDIEPRRFGFIALNYLEDASQALATMQGPVLAVWGALDRNVDAADEANAYAHAFGKRAA
FT                   RHVVVVPGATHALLRGRWFDYQLESDWPKWKTWLYMALGRHAYAPDTLGPIEAWIRSQ"
FT   sig_peptide     294376..294447
FT                   /locus_tag="Bcen2424_6139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.437 at
FT                   residue 24"
FT   gene            295486..297339
FT                   /locus_tag="Bcen2424_6140"
FT   CDS_pept        295486..297339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6140"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5775 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12872"
FT                   /protein_id="ABK12872.1"
FT                   /translation="MYSWFERRLPTFPLEDPVTPPKGFFSFVWACTKGARGWLLLIALT
FT                   SAALAAYEAALFAMMGHVVDWLSSSTPSEFGGRHFGALAGFAAILVGSALLIALHTMVK
FT                   HQVLAINFPMRLRWLFHRLMLDQSLSFYANEFAGRVTTKIMQTALAVRDALFMSVDVVI
FT                   GVTAYLIGILVLAASFDWRLMIPLALWALGYGAACAYFVPRLGAVGSRQADARALMTGR
FT                   ITDAYSNITTVKLFSHTRREADHARRAMEAFKATGDAQMRLVSAFEIVNHLLSTLLLIG
FT                   SAGLALVLWMHGEASAGVVAAVIAMALRLSSYSHWIMWEMTELFENVGTIQDGINTLTK
FT                   VRSVIDAPDAKPLTVRRGEIVFDNVQFAHEDNDRAVFDGLNLTIRPGERIGLIGRSGAG
FT                   KSTLVNLLLRFYDVGGGSIRIDGQDIAHVTQDSLRAAIGMVTQDTSLLHRTMRENLLYG
FT                   RPDATEREMQDAAVRAEASEFIGRLRDRHGRSGYDVEVGERGVKLSGGQRQRVAIARVM
FT                   LKDAPILVLDEATSALDSEVEVAIQRSLDTLMSGKTVIAIAHRLSTIAAMDRLIVLDEG
FT                   RIVEEGTHQQLLQAGGIYAALWAHQSGGFLGETADAESVAQ"
FT   gene            297516..298688
FT                   /locus_tag="Bcen2424_6141"
FT   CDS_pept        297516..298688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6141"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_5776
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12873"
FT                   /protein_id="ABK12873.1"
FT                   /translation="MKQIRSFALLALPAALVAAGAHAQSSVTLYGIADAGIAYVHNAQN
FT                   ANGSNASSLVKFSSGNLSGSRWGLRGIEDLGSGLSALFQLENGFNIGTGALGQGGREFG
FT                   RKAVVGLGSSTYGTVTLGRQYDPIVDLVQGLTQDNYFGGVFATPGDLDNYDNSLRVSNS
FT                   VKYTSPLISGFQFEALYGFGGVAGATGSGRTYSFGASYANGPLSLGAGYFYANGGTTVA
FT                   NGVRTWSSSADTLFNTVINQGFSSAKSIQIVRVAGQYVAGPATFGLAYSNTQYGADTLS
FT                   AFSQNAKFNNGSAFFNWQFSPALRAGVGYNYTSLTGPASAHYNQVNLGADYALSKRTDL
FT                   YALFGYQKASGNTLDASGATVKAAASVGSYGVNSGTDTQELAIVGIRHKF"
FT   sig_peptide     297516..297587
FT                   /locus_tag="Bcen2424_6141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            298791..299435
FT                   /locus_tag="Bcen2424_6142"
FT   CDS_pept        298791..299435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6142"
FT                   /product="Glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   bcn:Bcen_5777 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12874"
FT                   /protein_id="ABK12874.1"
FT                   /translation="MLTVWGRRNAFNVQKVMWLVDELALAHRHVPAGGRFGVLDTPAFL
FT                   AMNPHGRIPVIDDDGTVVWESHSILRYLAARYGRPGFWRDDPAEQSRADRWMDWAQTTL
FT                   QPAFLNGVFRDYYRTPPEQRDTARVEQSIAQCAQYFRVLDTVLAGQPFLAGDAITLADI
FT                   AAGTHLYRYFELDIARPDVPHVVAWYERLKARPAYRTNVMIPFDDLRGKLG"
FT   gene            299595..300755
FT                   /locus_tag="Bcen2424_6143"
FT   CDS_pept        299595..300755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12875"
FT                   /protein_id="ABK12875.1"
FT                   /translation="MMSAQDVPVEFASRKDNAVAVHRNAGLDALRACLTLLVVFHHCAI
FT                   TYGAIGGWYYHEVAAGPSVASALLTLFCAINQAFFMGLLFFLAGYYTPPSIERKGAVRF
FT                   LADRSLRLGLPLLIYGFLIGPATIALAQSGAGHPFPDTLRHLWQKGTFENGPMWFAEAL
FT                   LIFSVAAALLHIVFPRTVARVTNRVARVPSDTTLAAAALLTGIAALALRSRWPVGINVW
FT                   GLQLGYFASYVVLYAAGCRTARAHWIEHLPAPQVRRWSRIALMALPVLPVAYLIAKHVP
FT                   AWHGRPQDVIYAFWEPLVAWGAILFLVDRFQQRFDTLTGAWRPLSRRAYAIYVIHPPVL
FT                   VAVALAWRNVPASPFPKFAVTGSIACVACYLIAGLLLRVPRFASIL"
FT   gene            complement(300791..301258)
FT                   /locus_tag="Bcen2424_6144"
FT   CDS_pept        complement(300791..301258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12876"
FT                   /protein_id="ABK12876.1"
FT                   /translation="MKRASGVPILWAAFGAAVGSTVIELLLWAIAGDDAVRNLLRDARL
FT                   TAAIVMGRSVLAASGGFDPLVMGVATLVHAALSLVYAAVLARLVRNLSRVAALLAGGAF
FT                   GLLLYGVNLYGFTTIFPWFIAVRGAITLIAHLVFGVTAAAVHDVARRDASR"
FT   sig_peptide     complement(301199..301258)
FT                   /locus_tag="Bcen2424_6144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.825 at
FT                   residue 20"
FT   gene            complement(301316..301984)
FT                   /locus_tag="Bcen2424_6145"
FT   CDS_pept        complement(301316..301984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12877"
FT                   /protein_id="ABK12877.1"
FT                   /translation="MNRPDKSSKARAALDQLFSGLAPADAKRESPRPGNPFATDDEVSS
FT                   ASGGRGGVEVTLSTRIQLRGYPSADAFMKRMAEAWGLEWGTYDSIRAVATLPAGWRSRR
FT                   LPEVTQIVDERDVLRAESSLQGGEMSYLKVHPRYYIDARKRFGWSKSSKASDDPDLDGP
FT                   DWNCFVVDREKSVEVHELTTSSLKADMDNARATLLKWLDEHYPKHRDPFAYWSDCEGAS
FT                   "
FT   gene            complement(302192..303169)
FT                   /locus_tag="Bcen2424_6146"
FT   CDS_pept        complement(302192..303169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6146"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5781 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6146"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12878"
FT                   /protein_id="ABK12878.1"
FT                   /translation="MNMAHSSDARRADGPARARQVAGGLSVAAPMPGPRPPLASLETVC
FT                   TVAREGSFLAAADVSGVTHGAISRRVAAVENWLGMALFERHARGVRLTPDGQRFVGRIE
FT                   QAFAIIDGAADQWRSPRTPRLVRMSVVPAFAQLWLLERQPALESEAPALRIELGIELRN
FT                   VDIAGGEADLSIRYGRGNWRRLETRPFMPERLYPVAHPRLAAQLARMRRATGDAALLDM
FT                   PLLHDSDVTGWRTWFDALGIPFKPRVQDRRFEDYNLVLAAAEAGLGVALARTPLADAYL
FT                   KRSALVRVSRHEVDSLLSYHFVHAKGENRPEVLALMERMVKALG"
FT   gene            303227..304126
FT                   /locus_tag="Bcen2424_6147"
FT   CDS_pept        303227..304126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6147"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bcn:Bcen_5782 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12879"
FT                   /protein_id="ABK12879.1"
FT                   /translation="MNTLSSSTSRGARQPLVAAAAVAFTIVSWASAFPFIRIGLQGLAP
FT                   LQLAAARFATAAVLVIAWLAWRRPPLPTKADAWRFLACGLLGIALYNALLNTGEQTVSA
FT                   GAASFIVNTLPIFTALLAAVFLRERFNRWGWLGSLVSLAGIAVIAQGQPGGLVLGSGST
FT                   LILGAALCSASYFVLQRRLIPVYGALPCTAYTLLAGAVLLAPWLPGALVSLGGGSRDTA
FT                   LAVVVLGVFPAALGYATWTFALGYFGAARAASFLYLTPAVATLLSVALTGERPGIATAC
FT                   GGLLAIAGVIVVALRGRS"
FT   sig_peptide     303227..303319
FT                   /locus_tag="Bcen2424_6147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.962 at
FT                   residue 31"
FT   gene            304746..305900
FT                   /locus_tag="Bcen2424_6148"
FT   CDS_pept        304746..305900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6148"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bcn:Bcen_5783 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6148"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12880"
FT                   /protein_id="ABK12880.1"
FT                   /translation="MERSTVGMRCKPLITVALAAAAFAAASSAMADQVVKIGSVEPTTG
FT                   GISHLGKDNENGARLAVEEINAKGLTIGGQKITLQLDPQDDAADPRQATQVAQKLVDDK
FT                   VVAVVGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPAL
FT                   ANYAHSKGIKSVAVVDDSTAYGQGLANEFEKKAKALGLKVMSHDATNDKAVDFRAILTK
FT                   IKGENPDAIMYGGMDATGGPFAKQAKQLGLRAKILSGDGVCTDSLAELAGPAADNVLCS
FT                   QAGAALEKMPGGAGFLAKYQKRFNQGIKFDAPFAYDAVYIVVDAMKRANSTDPAKILAA
FT                   MPATKYDGVIGTTTFDAKGDLTHGIISIYGYKGGKKTFLDQVKM"
FT   sig_peptide     304746..304841
FT                   /locus_tag="Bcen2424_6148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 32"
FT   gene            305988..306290
FT                   /locus_tag="Bcen2424_6149"
FT   CDS_pept        305988..306290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12881"
FT                   /protein_id="ABK12881.1"
FT                   /translation="MCAMAYAEFQQELKKAQLTAREFARLIRMNESSITNYSSKGTVPS
FT                   HLAVIAKLIGTLAAHEIDFRRVIRQMRIEPKRPRGVGVFPAAEKPRSRKAAKADA"
FT   gene            complement(306393..309449)
FT                   /locus_tag="Bcen2424_6150"
FT   CDS_pept        complement(306393..309449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6150"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bcn:Bcen_5785 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12882"
FT                   /protein_id="ABK12882.1"
FT                   /translation="MSIAPLPRPASPSANVYRDFLAALQVAGFAGEIRADHANRTVQAT
FT                   DNSIYQRLPQAVICPAHADDVQLLARLLAEPAHRDVAVAARGGGTGTNGQSLTDGIVVD
FT                   LSRNMNRILEINAQARWVRVEAGVVKDQLNAALKPHGLFFAPELSTSNRATVGGMINTD
FT                   ASGQGSCTYGKTRDHVLELDFVLMGGERLHSDALDDEELARRCARQDRVGKVYRTARRI
FT                   SDDKAALIDAKFPKLNRCLTGYDLAHLREPDGRFNLNSVLCGAEGSLGFVVEAKLNVLP
FT                   IPKYSVLVNVRYAGFMDALRDARALLELAPLSIETVDSKVLMLAMKDFVWSSVAEYFPQ
FT                   DDARPTLGINLIEFSGDDERDVDARVRAFVEHLRTDTSVERLGHTLAAGDDAVKRVYAM
FT                   RKRAVGLLGNVQGEARPQPFVEDTAVPPENLAAYIAEFRALLDGHGLQYGMFGHVDAGV
FT                   LHVRPALDMKDPKQAALVRPLSDAVAELTQRHGGLLWGEHGKGVRSEYAPAFFGELYPS
FT                   LQQLKAAFDPHNQFNPGKIATPPDPTLRLLKIDEVPTRGDHDRQIDERVWQSYGTAMHC
FT                   NGNGACYNFDPDDAMCPSWKATRERVQSPKGRASLMREWLRLQGQAGVDVVAAARTRQP
FT                   FLRGLAERWRNSRNARNARDGDADFSHEVYDAMAGCLACKSCAGQCPVKVNVPEFRSRF
FT                   LELYHQRYLRPLRDYLIGSLEFTMPWMARVPAVYNGLMGAGWVRTLLERQVGMVDSPLL
FT                   SRFDLAAVIRAWRVKPADPHALAALSDAQRARSVVIVQDTFTRYFDTEQLATLIELAAR
FT                   LGFQVWLAPLAPNGKALHVQGFLHAFEKAAIRNATQLAALARSGVALVGLDPAMTLTYR
FT                   QEYLKVTGLADVPKVALPQEWLLDALPQAGAGGATVSYRLLPHCTEKTNAPDSGKQWAQ
FT                   VFARRGLRLQVQATGCCGMSGTYGHEARNLATSKTIYAQSWAAHVDGVQQEGEALATGY
FT                   SCRSQVKRLSSKQVRHPLQALLDHVRAVG"
FT   gene            309501..310493
FT                   /locus_tag="Bcen2424_6151"
FT   CDS_pept        309501..310493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6151"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5786 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12883"
FT                   /protein_id="ABK12883.1"
FT                   /translation="MIFWQVSAQPGIAVSFDLPPETNEFLPGEACIKLMNYRRLTPSMS
FT                   LLLVFEAAARHESYTRAAEELSLSQSAISRQVQTLEDQLGVPLFRREGRSVKLTEVGRR
FT                   YFAELSGALGRIRGATLQAMSHQAGAGTLRLATLPTFGSKWLLPHLHGFYAAHPGVTVH
FT                   LHSRIGAIDFLHDDLDAAITVGAGDWPGLHAHRLYNEFLIAIAPPDTGRGRKADARTPA
FT                   WAARQTLLGVTSNQQAWAEWFSHYRLEHRQMRIGPSFELTSHLIQAVRAGMGIGLVPKV
FT                   LVEDELSRGELVPIGDAITSQRSYYLVYPPGNETLPSLVAFREWLLTSC"
FT   gene            complement(310516..311364)
FT                   /locus_tag="Bcen2424_6152"
FT   CDS_pept        complement(310516..311364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6152"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5787 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12884"
FT                   /protein_id="ABK12884.1"
FT                   /translation="MKKLDLDVLAMVVAVAESGSFAQGAQAVHRSPSAVSMQIRTLEDA
FT                   LGKPLFIRDTRNVTPTDDGRMLADYGRRMLAMRDEAWASVVRPEIRGRVTIGVPDDYIS
FT                   SLLPQVLGKFAAMHPRVEVRVIGQPSSALVPMLKDNTVDLACMTRVKGVSGELIRLEPI
FT                   VWTGSPKRNVWEERPLPVALFSHGSTARDHAIKALNRRKIPFRMSYESPSFLGLLSMVE
FT                   AGLAIAPLARCCVPDHLLQLSESHGLPSLGELDVVLARSAQSARPPCDYLAEQILGEWR
FT                   A"
FT   sig_peptide     complement(311296..311364)
FT                   /locus_tag="Bcen2424_6152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.511 at
FT                   residue 23"
FT   gene            311476..312123
FT                   /locus_tag="Bcen2424_6153"
FT   CDS_pept        311476..312123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6153"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bcn:Bcen_5788 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12885"
FT                   /protein_id="ABK12885.1"
FT                   /translation="MQTSGSLYGFLVIGGMLAVTPGPNMVYVMSRSIAQGRAAGLVSLA
FT                   GVMLGYLFYMFAAAFGITTLFMSVPYASSVLGAVGATYLLYLAWQAVRPGGRSPFEVKT
FT                   LPNEQPLRLLAMGATTSVLNPKLAMLFVSLLPQFIDYGHGSVFGQSLFLGSLLIAAFAS
FT                   ANGLVAICSGSLAKFLHGRPTLLLAQRWAMGAVLGGLGVEMLVEASKSAGIA"
FT   gene            complement(312181..313284)
FT                   /locus_tag="Bcen2424_6154"
FT   CDS_pept        complement(312181..313284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6154"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: bcn:Bcen_5789
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12886"
FT                   /protein_id="ABK12886.1"
FT                   /translation="MSLPDPSADGVKFAYWVPNVSGGLVVSTIEQRTDWSLEYNQKLAR
FT                   TAEAAGFDYALSQIRFTAGYGAEYQHESVSFSQALLHATTKLKVLAAILPGPWHPAVVA
FT                   KQLATIDHISNGRIAINVVSGWFKGEFTAIGEPWLEHDERYRRSKEFIQALKGIWTQDN
FT                   FTFKGDFYRFNDYTLSPKPVQKPHPEIFQGGSSRAARDNAASVSDWYFTNGNTPENLKA
FT                   QIDDIRAKAAANNHRVRIGVNAFVIARDTEEEAKAVLDDIIRHAHVEAVHAFGDAVKQA
FT                   GKASPEGEGNWAKSTFEDLVQYNDGFRTNLIGTPQQIAERIVALKAIGVDLVLAGFLHF
FT                   IEEVEYFGKRVLPLVRELEAQRQAVAA"
FT   gene            complement(313322..313882)
FT                   /locus_tag="Bcen2424_6155"
FT   CDS_pept        complement(313322..313882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6155"
FT                   /product="FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bcn:Bcen_5790 FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12887"
FT                   /protein_id="ABK12887.1"
FT                   /translation="MSHTLNVVAISGSLQRPSRTLALTDAIVTALGAALPIETRLIELG
FT                   EIGSRLAGALTRAQVPPDLDALIRAIETADALVVASPVYRASYTGLFKHLFDLVRHDAL
FT                   VDVPVLLAATGGSERHALVIDHQLRPLFSFFQARTLPIGVYASESDFDQYQIASPALRE
FT                   RIALAVNRAVPQLRAPVLSAAAA"
FT   gene            314336..315463
FT                   /locus_tag="Bcen2424_6156"
FT   CDS_pept        314336..315463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6156"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5791 sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12888"
FT                   /protein_id="ABK12888.1"
FT                   /translation="MTSISASPRPLNLRVVTASRDPAGLQAAAPVRTLPERHAQARAQA
FT                   QVFADPRSLALLEQVRRVAPSDANVLIVGETGTGKELIARHVHELGARRDGPFVAVNCG
FT                   AFSETLVDSELFGHEKGAFTGAFSAKPGWFEAAHGGTLFLDEIGDLPLAMQVKLLRVLQ
FT                   EREVVRLGSRTGIPVDVRVVAATNVDLQQAVAAGKFRGDLFYRLNVVQLAVPPLRDRPG
FT                   DILPLARHFFDIYRDRLGGGPRRIDPRAERRLQAHGWPGNIRELENVIHHALLVSRHDV
FT                   LQDTDLHIAPPCVPAVAAQATDSSADAQAALEHALRDLFDDGHGNLFEHIEDTVMRVAF
FT                   EFSHRNQIRTAQLLGISRNVLRARLIRAKAITALK"
FT   gene            315716..317425
FT                   /locus_tag="Bcen2424_6157"
FT   CDS_pept        315716..317425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6157"
FT                   /product="homodimeric dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="KEGG: bcn:Bcen_5792 dihydroxyacetone kinase, subunit
FT                   L; TIGRFAM: dihydroxyacetone kinase, L subunit; PFAM: Dak
FT                   kinase; Dak phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12889"
FT                   /protein_id="ABK12889.1"
FT                   /translation="MKKLVNRPSDVVREMLEGIARQSPHLAILGDEHVLVRQPLPEPSQ
FT                   RPVAILSGGGSGHEPAHGGYVGEGMLSAAVCGEVFTSPSTDAVLAAIRASAGPNGALLI
FT                   VKNYTGDRLNFGLAAELARAEGIPVETVIVADDVSLRGRVERGQRRGIAGTVLIHKLAG
FT                   AAAARGLPLARVASIARDAAAELGTMGVALDGCTIPGADKSGFSLADHEIELGLGIHGE
FT                   KGVERRAPLPADALADTLLSSIVADLVLDRDERVALFVNGLGATPDMELAIVLRAAFDN
FT                   LSRRGIVVARAWAGTFLSALNMPGCSISVLRLNDERAALLDAPTQARAWPGGGLVNTRI
FT                   RMAAAVSQDASPPPLDAAGRAWAARLQPALHAVAQTLIDHEQTLTDLDAAAGDGDLGAS
FT                   MRRAAQAILELPDTAYGTPAGALAALGAALRRAIAGSSGPFYATALLRASRRLADGADS
FT                   AEPSPRDWAAAFRAAVDAISELGGAQAGDRTMLDALVPAVDAFGRALDGDRDPASAWAA
FT                   AVEAAERGAEETTRMTPRAGRASYLGERAIGTPDGGAVAVSYWLRALLPHVR"
FT   gene            complement(317445..317732)
FT                   /locus_tag="Bcen2424_6158"
FT   CDS_pept        complement(317445..317732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6158"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   bcn:Bcen_5793 protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12890"
FT                   /protein_id="ABK12890.1"
FT                   /translation="MATYIVFTRESTQDQHELDIYASQVGATLAGHPVKVLAAYGPQEI
FT                   LEGEGPEGVVIVEFPSKEAAHAWYRGPEYQAVVQHRFKGARYRAVLVEGV"
FT   gene            317996..319381
FT                   /locus_tag="Bcen2424_6159"
FT   CDS_pept        317996..319381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6159"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_5794 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12891"
FT                   /protein_id="ABK12891.1"
FT                   /translation="MRYVPSWTSVSAASSIPDDATTQRGDEPHSLPRVAIAAAALGNAT
FT                   EWFDYGIYAYGLAYISAALFPGNTASATLFALGTFAISFLIRPLGGLFWGPLGDRLGRK
FT                   RVLGLTVLTMSGATLLVGVLPSYATAGWLAPAALIVLRMVQGFSTGGEYGGAATFIAEY
FT                   APDSRRGLCGSFLEFATLAGFSLGAFLMLGFALLLGDSAMHAWGWRLPFLVAAPLGLIG
FT                   FYLRSRLEETPVFRELEEQAHRREKSATAALPIRLLLVRYAKPLLLLGGLVVALNVVNY
FT                   VLLAYMPTYMHKELGVSENMSLLIPLIGMLAMMVLLPFAGWLSDRVGRKTMWWFSLVGL
FT                   FVAAVPMFTLMTHGPLGAFIGFAVLGVLYVPQLATISAMFPAMFPTHVRYAGMAIAYNV
FT                   STSLFGGTAPIVNDWLIGKTGNALIPAYYMMAACAVGLIALLAVIETRGCSLRGEAVPG
FT                   QPG"
FT   gene            complement(319782..321125)
FT                   /locus_tag="Bcen2424_6160"
FT   CDS_pept        complement(319782..321125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6160"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bcn:Bcen_5795
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12892"
FT                   /protein_id="ABK12892.1"
FT                   /translation="MSKSEYLKLADTIAADIADGTLRPGDRLPPQRNFADQRKIAVSTA
FT                   SRVYAELLRRGLVVGEVGRGTFVSGDARRGAAAPGEPRDVRIDLEFNYPILPDQTTLIA
FT                   RSLSGLESVAELASALGQATSSGTPALRNVSAACLAGNGWAPSPEQLVFTGNGRQSIAA
FT                   AVGAIVPTGGRCGVETLTYPFIKGIAARLGITLVPLAMDEGGVRPDAVLKAHRDANLSA
FT                   IYIQPAIQNPLGMTMNAARREDLLRVVEKLGIPVIEDNVYGFLDDQPPLAALSPDNCIV
FT                   IDSLSKKVAPGLTLGFIVSPHRLRETVMASVRSGGWTASGFAFAAAQRLMSDGTVAELA
FT                   RLKRIDAVARQKLAADRLSDFDIQTNGKCFHLWLTLPAHWRSQALVAAAARRDIALTPS
FT                   TTFAAAPGHAPNAVRLALAAPTMDQLDAGLLTLSGILNAREEDFDSTE"
FT   gene            321428..322210
FT                   /locus_tag="Bcen2424_6161"
FT   CDS_pept        321428..322210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6161"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bcn:Bcen_5796 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12893"
FT                   /protein_id="ABK12893.1"
FT                   /translation="MISSTGMDLQLTLITILIAFAGVFLISFMKGAFGGGFSIVGIPLL
FT                   SLVIDPVTAGGMLAPLFIAMDLFALRYWKPSTWSKPDLMLLLPGLVTGIGVGYLTFRLL
FT                   DHRAIAIVMAAITLIFVGLWWVGGAALTIRPRSTPKAITAGLASGVTTMVAHSGGPPLA
FT                   MYLLPLGLGKEVYAGTTSMFFTVGNATKAVPWLLLARPTGNVWVVMGVCLCAIPAGVVA
FT                   GWRLHAKLDQRQVYRACYGLLVIAAVKLLWDGVTGYLA"
FT   gene            322634..323566
FT                   /locus_tag="Bcen2424_6162"
FT   CDS_pept        322634..323566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6162"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcn:Bcen_5798 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12894"
FT                   /protein_id="ABK12894.1"
FT                   /translation="MNAPIRNVQPVIVALGNEGSGELVPSRYAVRIGDVDVVLISDGVL
FT                   PLPTSTMSTNVSEADRNAWFDGRFLQRDMFDWALNIALVRSADHLILIDSGVGDGFEYF
FT                   TRAGRSVMRVESAGIDLAAITDIVITHMHMDHVGGLNVDGVKAKLRPDVRIHVSAAEVA
FT                   FWKNPDFSKTVMPETVPPALRKAAARFVELYGENIVQFDRTVEVATGVSARVTGGHTPG
FT                   HCVVDIASNGEKLTFAGDAIFEVNFDNPDWQNGFEHDPAAAVDVRLALFNEAADTGALL
FT                   AAAHVAFPSIGHVARNGDGFRFVPVVWDY"
FT   gene            complement(323707..325101)
FT                   /locus_tag="Bcen2424_6163"
FT   CDS_pept        complement(323707..325101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6163"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bcn:Bcen_5799 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12895"
FT                   /protein_id="ABK12895.1"
FT                   /translation="MQQSIDALLREDRAHFMHPSTHAYDHETGALPGKIVRGGEGIRIE
FT                   DHQGKRYIDAFAGLYCVNIGYGRTEVADAMYEQAKQLAYYHTYVGHSSDAIIELSSRII
FT                   DWSPAGMKKVYYGMSGSDANETQVKIVWYYNNVLGRPNKKKIISRERGYHGSGIVTGSL
FT                   TGLPSFHQHFDLPIDRVKHTVCPHWYRKAPAGMSEAQFVAYCVDELEKLIAREGADTVA
FT                   AFIAEPVMGTGGIIEPPAGYWPAIQAVLRKHDILLISDEVVCGFGRLGSKMGAQHFGIE
FT                   PDLITVAKGLTSAYAPLSGVIVGEKVWDVIARGSQEHGPMGHGWTYSGHPVCAAAALAN
FT                   LAILERENLVGNAEEVGKYFGAKLRDAFDAHPLVGEVRSVGMLAALEFMADKDARVPFD
FT                   PSLKIGAQVSAAALQRGVIARAMPHGDILGFAPPLVMTREEADEIVGIVKKAVDEVAER
FT                   NISAVA"
FT   gene            complement(325122..326600)
FT                   /locus_tag="Bcen2424_6164"
FT   CDS_pept        complement(325122..326600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6164"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_5800
FT                   succinate-semialdehyde dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12896"
FT                   /protein_id="ABK12896.1"
FT                   /translation="MLPGHPVLFKSTCYVDGRWIHSDSAATVAVVNPADQAVIGHVPML
FT                   ERAQIVAAIDAAQRAYDTWRWTPQAVRSAALLRWHALILRHVDDLAALLSLEQGKPLAE
FT                   ARGEIRYAASFVEWFANEAKRVAGRTIPTHIDGAHLGTVMEPVGVAALITPWNFPAAMI
FT                   TRKAAAAIAVGCAVVVKPAHETPFSALALAQLADEAGFPAGVFNVVLGEPQMAMETLVG
FT                   DARVRAVSFTGSTRVGRLVTETAAKAGIRKVALELGGNAPFIVTEDADLDQAVRIAVGA
FT                   KFQTSGQDCCAANRMLVARPLYDAFVERYAHAVRALKTGPAFEQGVDVGPLMHQAAFDA
FT                   TVARVEDARARGARIVAGGRPHALGGWFYEPTVIADAAPGMRVVDEENFAPISAVSAFD
FT                   TLDEAVETANDTEYGLAAYVCATRIDTIFQLVRRLDFAMVSVNGVKFTGAPIPFGGMKA
FT                   SGLGREGGAEGFEPFTETKYFCLGNLGLPVAATA"
FT   gene            complement(326722..327192)
FT                   /locus_tag="Bcen2424_6165"
FT   CDS_pept        complement(326722..327192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6165"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bcn:Bcen_5801 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12897"
FT                   /protein_id="ABK12897.1"
FT                   /translation="MIKLDRYDLAILRLLERDGRITKSKLAEAVNLSISPAWERVRKLE
FT                   ESGVIRGYRADVDWIGTFSGSRIVVEVTLSRHTAPDMRRFEDRVAAASEVAQCYATGGG
FT                   VDYVLHVVARDIDHYQRFIDALLMEDLGIERYFTYIVTKVVKCASGGAPDWL"
FT   gene            complement(327206..328234)
FT                   /locus_tag="Bcen2424_6166"
FT   CDS_pept        complement(327206..328234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6166"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bcn:Bcen_5802
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12898"
FT                   /protein_id="ABK12898.1"
FT                   /translation="MRASPITPTVDFDADGEQHGFLKLPYSRDDSAWGAIMIPVTVVKR
FT                   GDGPTVLLTGGNHGDEYEGPVALSKLAGSLKAADVTGRVIVVPFMNYPAFRAGCRTSPI
FT                   DAGNLNRSFPGRPDGTVTEKIADYFQRHLLPLATHVLDIHAGGRTLDFVPFAAIHVLEN
FT                   RDQEARCERAMRAFGAPYSMRMLELDSVGLYDSAAEEAGKVFVSTELGGGGTSTAASVA
FT                   IAERGVYGFLAHAGVIAKDVIDGNAPRSTTTLLDMPDGSCFTTSEHRGLLEMCRDLGSE
FT                   VDAGDVLARVHDIDRTGVTPIEYVARRRGLLAARHFPGIVQPGDTIAVVADIVERNIPV
FT                   AV"
FT   gene            complement(328239..329447)
FT                   /locus_tag="Bcen2424_6167"
FT   CDS_pept        complement(328239..329447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6167"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: bcn:Bcen_5803 peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12899"
FT                   /protein_id="ABK12899.1"
FT                   /translation="MSAVIETQTAAPRLAFARSEYAARIAKTRAAMERAGIDLLIVTDP
FT                   TNMGWLTGYDGWSFYVHQCVLLALDGEPVWFGRNQDANGAKRTAFMAHENIVGYPDHYV
FT                   QSSVRHPMDYLSTEVIAARGWSTLRIGVELDNYYFSAAAYASLQQHLPVARWVDATALV
FT                   NWQRAVKSPREIEYMRVAARIVERMHAHIVETIEPGMKKSDLVAQIYATGIGGADGFGG
FT                   DYPAIVPLLPTGADAAAPHLTWDDSTFARGAGTFFEIAGCYCRYHCPLSRTVYLGKPPA
FT                   HFIEGERAVVEGIEAGLAAAKPGNVCEDIANAFFAVLRRAGIDKDSRCGYPIGASYPPD
FT                   WGERTMSLRPGDRTVLEPGMTFHFMPGLWLDDWGLEITESILITETGVETFCNVPRKLF
FT                   VKE"
FT   gene            complement(329458..330462)
FT                   /locus_tag="Bcen2424_6168"
FT   CDS_pept        complement(329458..330462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6168"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: bcn:Bcen_5804
FT                   ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12900"
FT                   /protein_id="ABK12900.1"
FT                   /translation="MAHPVTLLGHAQLRALVPLDLAAIDQVEAAFASLATDAVVMPPIL
FT                   NLALPARHAEVDVKTAYLPRFDSFAIKVSPGFFDNPSLGLPSLNGLMLVLSARTGLTEA
FT                   VLLDNGYLTAVRTAAAGAVAARRLARADARRAAIVGAGEQARLQLAALMLVRDITHVTV
FT                   WARDTARAAQFAADVRAAHGVDATVARSVHAALADADIAVTTTPSRAPLVHAEDLHPGL
FT                   HVTAMGSDADYKTELAPSVFGAARYFCDRLQQTRVAGELAHAIAAGAVAADAVFPELGE
FT                   VIAGRRDGRTHRDDITICDLTGTGAQDTAIAVLALQRARAAEVGTIFHNDLTT"
FT   gene            complement(330464..331435)
FT                   /locus_tag="Bcen2424_6169"
FT   CDS_pept        complement(330464..331435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6169"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: bcn:Bcen_5805
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12901"
FT                   /protein_id="ABK12901.1"
FT                   /translation="MSFLSLSDVYRARRRLAGRADGTPLVASAALSARAGAPVYLKLET
FT                   LQPTGSFKLRGATNALAELAAQRVTRVVTASTGNHGRAVAHAARALGIDAAVCMSSLVP
FT                   ANKVDAVAALGARVVIVGESQDDAQAEARRLVRDEGYAYVPPFDDPRIIAGQATIGVEI
FT                   LEALPDTATLVVPLSGGGLFSGVAFAAKAIRPPIEVIGVSMARGAAMHASLAAGRPVDV
FT                   TEQPTLADSLGGGIGLDNRYTFDMTRALADDVVLLDELSIARGIAHAYREERLVVEGAG
FT                   AVGLAALLDERIVRRDRGGPIVVVVSGANIDMAAHRRLVSEN"
FT   gene            complement(331543..332955)
FT                   /locus_tag="Bcen2424_6170"
FT   CDS_pept        complement(331543..332955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6170"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bcn:Bcen_5806
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12902"
FT                   /protein_id="ABK12902.1"
FT                   /translation="MGRTEVSAGWRDALGAVHGIESKYKRLVKAIASDIENGALAPGAR
FT                   LAPQRDVASSLGVSVQTVTNAYKELERQGLIRCEVGRGSFVAARVTESMSNYILDTTER
FT                   ELVDFSIARIVHTPEHDAAWRSVCTALAGTDDQPWIRSFRPIAGLDAHRDAGAAWLASL
FT                   NMPVHRESLLVTNGAAHGIFLALASIVGPGDTVLCESLTDHGVIGSANVLGFTLKGLEM
FT                   DEHGIRPEHFEEMCDGERISALVCTPTLNNPTVSLMPESRRRSIARIATRYGVYVIEDD
FT                   VYGPLPEKAGTPIASLIPELGFYCTSMTKSVLTGLRTGYLAMPRRLALRVESVLRVSSW
FT                   MATSPIAEIATRWIADGTARRLVELQRQRLAVRQEMVKAALGPYVLGAHPNALSAWLRV
FT                   PDYWQAERIVRELRTRKIAVTSPDPFLVGGTERPNAVRVCIGAETSDAACNAALETIAG
FT                   VFEQYPHLNDFH"
FT   gene            complement(333135..333938)
FT                   /locus_tag="Bcen2424_6171"
FT   CDS_pept        complement(333135..333938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6171"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bcn:Bcen_5807
FT                   citrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12903"
FT                   /protein_id="ABK12903.1"
FT                   /translation="MTSASARSWLFVPGNRPERFETARAAGADAVIVDLEDAVPPDGKP
FT                   AARAAVVARLDAARPVWVRVNAADTAWFADDLAAIAAHPGAAGVMLPKCETRAQIDAVL
FT                   AHAHGTLELLPIVETAAGIAGLDQVCAAPRVVRVAFGTLDFQVDLGIDGDGEELNAFRS
FT                   WIVLASRLAGIAPPVDGVSTIIDDPAAIERHARDARRFGFGGKLCIHPKQLDAVHRAYA
FT                   WTDAEQAWARRVLDAVDASGGAAVALNGRMVDMPVILKARRILRG"
FT   gene            complement(333935..335329)
FT                   /locus_tag="Bcen2424_6172"
FT   CDS_pept        complement(333935..335329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6172"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: bcn:Bcen_5808
FT                   MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12904"
FT                   /protein_id="ABK12904.1"
FT                   /translation="MMTNTIPATAFGRTLATFASQLRFDAIPADVVARTVNLYVDWLGS
FT                   ALAGKGARPVETIAAFARRAGGSRGGPGTADVLIDRTHATPYFAAMTNGAASHFAEQDD
FT                   VHNGSVFHPATVVFPVALALAQARGASGRDFIAAAVAGYEVGIRVGEFLGRSHYKVFHT
FT                   TGTAGTVAAAATAGRLLGLSPERMLDAFGSAGTQASGLWEFLRDAADSKQLHTAMAAAN
FT                   GLMAAELARDGFRGATRILEGTQGMAVGMSTDADPARLTDRLGDRWATAETSFKYHASC
FT                   RHTHPAADALLAVMARERLAAADIETVVAHVHQGALDVLGAVTVPRTVHQAKFNMGTVL
FT                   ALAALHGHAGVDEFERDYAAAHVAAFRDRVSMALDDEVDRAYPARWIGKVTVTTRYGGT
FT                   FAGRVDEPKGDPGNTLSRDEIARKVRTLAAFSGAASDAEVERLLADAWQVASCDAIGTL
FT                   FPEVSA"
FT   gene            complement(335346..336524)
FT                   /locus_tag="Bcen2424_6173"
FT   CDS_pept        complement(335346..336524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6173"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bcn:Bcen_5809 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12905"
FT                   /protein_id="ABK12905.1"
FT                   /translation="MRPLDGIKVITLEHAIAAPFCTRQLADLGARVIKIERPGSGDFAR
FT                   GYDERVHGLSSHFVWVNRSKESLTLDVKQPDAAAVLDALLADADVLVQNLAPGAAERLG
FT                   LGYDALKHTHPRLIVCDISGYGGDGPYRDRKAYDLLIQSEAGFLSITGSAGQPAKAGCS
FT                   IADIAAGMYAYTSILSALLMRGRTGEGCRIDVSMLESMVEWMGYPLYYAIDGQSPPSPS
FT                   GASHATICPYGPFPAGDGKTVMLGLQNEREWKLFCEQVLRQPALADDPRFNANSKRHAA
FT                   RDVVDALIVDAFATLTAADVMQRLDAAGIANARMNTLDDVWLHPQLQARERWRSVDTAA
FT                   GPVPALLPPGLPAGVEPRMDAVPALGQHTDAILSELGYDRARIDALRANGTI"
FT   gene            complement(336537..337742)
FT                   /locus_tag="Bcen2424_6174"
FT   CDS_pept        complement(336537..337742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6174"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bcn:Bcen_5810 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12906"
FT                   /protein_id="ABK12906.1"
FT                   /translation="MTRSLSFLPSSTTDMQTTQHDPYQDIREAVRDLCSQFPGEYFRQI
FT                   DDARGYPDAFVDALTKAGWLAALIPQEYGGSGLGLTEASIIMEEINRAGGNSGACHGQM
FT                   YNMGTLLRHGSAEQKRAYLPKIASGELRLQSMAVTEPTTGTDTTKIKTTAERRGDRYVI
FT                   NGQKVWISRVQHSDLMILLARTTPLADVKKKSEGMSIFVVDLHDAIGHGLTVRPIPNMV
FT                   NHETNELFFDNLEIPAENLIGEEGQGFKYILDGLNAERTLIAAECIGDGYWFIDKVSQY
FT                   VKERVVFGRPIGQNQGVQFPIARAFVNVEAASLMRFDAARRFDAHAPCGAQANMAKLLA
FT                   ADASWEAANACLQFHGGFGFACEYDVERKFRETRLYQVAPISTNLILAYVAEHILDLPR
FT                   SF"
FT   gene            complement(337739..338599)
FT                   /locus_tag="Bcen2424_6175"
FT   CDS_pept        complement(337739..338599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12907"
FT                   /protein_id="ABK12907.1"
FT                   /translation="MPTSSPQPAASASLDAWLGKTETLGDDITAFPLNALAATLDRPSL
FT                   GDVVPPMWHWLYFLPVAPLAEVGPDGHPKRGGFLPPVPLPRRMWAGGRLTFHAPLRAGQ
FT                   RATRESTIANIEDKTGRSGRLVFVTVQHRIEAGGALCVEEEHDIVYRDAPQPGAPAPKP
FT                   VAPPAGEAWSRTVTADAVMLFRYSALTFNGHRIHYDRSYVTQEEGYPGLVVHGPLIATL
FT                   LVDLVHRERPDATLASFAFRAVRPTFDGQPFTLCGKPSDDGRTIELWAKDRDGWLTMQA
FT                   TATLA"
FT   gene            338921..339400
FT                   /locus_tag="Bcen2424_6176"
FT   CDS_pept        338921..339400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6176"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: bcn:Bcen_5812
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12908"
FT                   /protein_id="ABK12908.1"
FT                   /translation="MTNLHDLRLAVSSLLVLTARKWRRTSDGVLTAYNVSEACATPLLI
FT                   AGRLGEGVRQGTLAEHVGIEGPSLVRLLDQLCAAGLARRDEDPHDRRAKTISLTAAGRA
FT                   VTAQMEDDLRALRAQVLKGVSRADLEATLRVLHAFNAADPHPPASRPPHSADSAS"
FT   gene            339397..341520
FT                   /locus_tag="Bcen2424_6177"
FT   CDS_pept        339397..341520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6177"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: bcn:Bcen_5813 fusaric acid resistance protein
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12909"
FT                   /protein_id="ABK12909.1"
FT                   /translation="MTYPSLRDWLFSGKTFAASMLALYLGLYFQLPRPYWAMASVYIVS
FT                   NPFVGATRSKALYRALGTALGAAAAIFFVPPFVETPLLFSIIVATWCGTLLYLAISDRT
FT                   ARSYVFMLAGYTMPLVALPTVTDPSTIFDVAIARTEEIVLGIVCASVVGSAVFPNRLAP
FT                   TLIERTDAWFKDAAFYGRETLSGHLAGKALSACRQRLAATITGLEFLLSQLGYDHAHPR
FT                   VLARAQALAGRMQLFLPLMSSLADPLIALMRDLHVRPPALDALLADAAKWFDAPLPAVK
FT                   AGSDGAMAHDPVADDLRERIAALQPPDSALTSWDGALLSNALWRLRQVIDIWQDCRSLR
FT                   ALIANESGVWQPRYRHWRLGGTERFFDRGMMLFSTLTVVFAIVFACWLWISSGWHDGAA
FT                   AVTLVAVSCSFFAALDEPAPLVFKFFLSTTASVVFAGLYLFVVLPHVHDFVMLVLMFAG
FT                   PFILIGTLLPRPQFNMVTMLVAVNTATFISIQSAYEADFFVFLNSNLAGVAGLLFAYVW
FT                   TRATRPFGAELAVRRLLRSGWEDVARSASTQPLDDQRNHASRMLDRVTQLLPRLGASDD
FT                   HRHPSIESFRDLRIALNALDLRRSRRRLSGDVPDAIDRVLAGVTDHYTRCAAANARQPV
FT                   PPALLATIDDALRRVAGRNLPGAAPADGAAAPTVPATHRRLRDTLHALVGLRLSLYPAA
FT                   AAQAPQAPDGARA"
FT   gene            341555..341767
FT                   /locus_tag="Bcen2424_6178"
FT   CDS_pept        341555..341767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6178"
FT                   /product="protein of unknown function DUF1656"
FT                   /note="PFAM: protein of unknown function DUF1656; KEGG:
FT                   bcn:Bcen_5814 protein of unknown function DUF1656"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12910"
FT                   /protein_id="ABK12910.1"
FT                   /translation="MIGEIDIFGVFVPAPLVLMLIAYLINIVVRAVLERVGFYRLVWHR
FT                   SIFDLGIYVFVLAAVVIVSHQLVAT"
FT   gene            341769..342743
FT                   /locus_tag="Bcen2424_6179"
FT   CDS_pept        341769..342743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6179"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_C7724 secretion protein HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12911"
FT                   /protein_id="ABK12911.1"
FT                   /translation="MKKTWLSAGQVLLTLIVVIVAGLVLWRIINYYMFSPWTRDGHVRA
FT                   DVIQVAPDVSGLITSVQVADNQEVKRGQVLFVIDQARYALAERLAEATLAQRRATLAQA
FT                   KREYARNLQLGNLVASEQVEESRTRVEQGEASVADAQVSLDTAKLNLQRTTIVSPVDGY
FT                   LNDRAPRVGEYVPAGRAVLSVVDRNSFRVDGYFEETKLRGIHIGQPVDIIVMGEPHALR
FT                   GHVQSIVAAIEDRDRTQGANLLPNVNPAFSWVRLAQRVPVRVVLDEVPDDFRMIAGRTA
FT                   TVSMRGADARRNDAKPAGASTASAAAPVPAASGTAASAAGASQ"
FT   gene            342740..344236
FT                   /locus_tag="Bcen2424_6180"
FT   CDS_pept        342740..344236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6180"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_C7725 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12912"
FT                   /protein_id="ABK12912.1"
FT                   /translation="MKRHGLRIAATLAPLALALSACKSVGPDYKLPQHAYVNAPLANHA
FT                   LDDANGALVSRDAVPGNWWQLYDDPVLDGLVRDALKSNTDLRVAAANLARSRAALVVAN
FT                   EQGGFSGSAEAAVQRAQESAEQYLLENKLPVVNEGTVGINVSYELDLFGKLRRGVEAAR
FT                   ADSEAVKAAGDLARITVVADVVRAYVEACSAGDELAIAKQSLALQQQRVKLSQRLRDAG
FT                   RGNQTDVTRGVTQVRTLSADIPRFEGRRKVAQYQLAALLARAPADLPKAAAECERLPKL
FT                   RQPIPIGDGAALLRRRPDVREAERQLAAATARIGVATAALYPSVSIGASAGSIGVAADL
FT                   FSSTTNRWSFGPLISWSFPVNGQRARVREAEAATGGALAHFDGVVLNALRETQSSLATY
FT                   AADVQRTDALRTAYESARNSADETHRLYAAGRESFISDLDATRTLTSVRAQVAAAEGQV
FT                   AADQVRLFLALGGGWDGDGAAAAADAGSAATAPAAGQSTP"
FT   sig_peptide     342740..342811
FT                   /locus_tag="Bcen2424_6180"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.704 at
FT                   residue 24"
FT   gene            344411..344836
FT                   /locus_tag="Bcen2424_6181"
FT   CDS_pept        344411..344836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6181"
FT                   /product="Molybdenum-pterin binding protein"
FT                   /note="TIGRFAM: Molybdenum-pterin binding; PFAM: TOBE
FT                   domain protein; KEGG: bcn:Bcen_5816 molybdenum-pterin
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12913"
FT                   /protein_id="ABK12913.1"
FT                   /translation="MRTSARNQFAGQIGAVKPGAVNDEITLRTQDGLEIVAVITHGSAA
FT                   SLGLAAGTKAFALVKASSVIVMVDVDSSKVSARNCVAGTVASIAKGAVNSEVVIKAAGG
FT                   AEIVAIVTNDSVERLGLASGTAASAIFKASSVIVGVE"
FT   gene            344912..345499
FT                   /locus_tag="Bcen2424_6182"
FT   CDS_pept        344912..345499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6182"
FT                   /product="NifQ family protein"
FT                   /note="PFAM: NifQ family protein; KEGG: bcn:Bcen_5817
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12914"
FT                   /protein_id="ABK12914.1"
FT                   /translation="MTASADHAYEEALQSLHFAAANADVPDAQLFGTLVTARAGRNELS
FT                   LLGLPPGQFAGLLTRQFPHLRSVDTIALTSAVAPLPLPATHSAFVATLHARLMDEANPA
FT                   VARDDADCLATIIAHACLRPDHLWRDLGLDGRDAVSAMLARFFPTLAARNVAHLRWKKF
FT                   LAQEVAASLGVPPGPAPGCPGCEDFGFCFPRT"
FT   gene            345573..345866
FT                   /locus_tag="Bcen2424_6183"
FT   CDS_pept        345573..345866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12915"
FT                   /protein_id="ABK12915.1"
FT                   /translation="MASAHLPLRDFDATFGFHEKAADDVHPINNGCTIVKPQTGCRHAL
FT                   RSSTRSAARGFRHANAGNPRCRTDDRLFPPPINGHLAMQGTRRSRHRQCRCR"
FT   gene            complement(345848..346909)
FT                   /locus_tag="Bcen2424_6184"
FT   CDS_pept        complement(345848..346909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6184"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bcn:Bcen_5819 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12916"
FT                   /protein_id="ABK12916.1"
FT                   /translation="MNPRHSAIFVALAAAALFGAATPLAKALIGAMSPFMVAGLFYFGS
FT                   GVGLGIGILLRGWHSRRASAADAAPLHRAGLPWLAGAIAAGGVAGPALLMLGLSSTPAA
FT                   TSALLLNLEGVLTAVIAWVVFRENVDTQVFLGMVAIVAGGTLLSWTPGRAGVPVGALLI
FT                   VGACLCWAVDNNLTRKVAANDAMVIACMKGLIAGPVNIGIALAAGATLPALPVAAAAML
FT                   TGLGGYGISLVLFVVALRHLGSARTGAYFSVAPLFGVALSLLIWPALPPATFWIAAALM
FT                   ALGLWLHVRERHEHTHVHERLEHTHRHRHDDHHQHAHDFPYDGNEPHTHPHVHLPITHS
FT                   HAHFPDIHHRHRH"
FT   sig_peptide     complement(346832..346909)
FT                   /locus_tag="Bcen2424_6184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.807 at
FT                   residue 26"
FT   gene            complement(347396..348067)
FT                   /locus_tag="Bcen2424_6185"
FT   CDS_pept        complement(347396..348067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6185"
FT                   /product="ProQ activator of osmoprotectant transporter
FT                   ProP"
FT                   /note="PFAM: ProQ activator of osmoprotectant transporter
FT                   ProP; KEGG: bcn:Bcen_5820 ProQ activator of osmoprotectant
FT                   transporter ProP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12917"
FT                   /protein_id="ABK12917.1"
FT                   /translation="MGFEQLAELRAQLAAKAKQERNAKRPAAPTDAGAKPKSGDQPSRG
FT                   AKPGAGAKTQHRAKLASAKPAAPVDPVIVAIGKLQRKFPRAFPKNPAPKVPLKVGIWDD
FT                   LAREAQAVGLNEAELREAMSTWCRGNRYWSCLVEDAVRVDLQGNEAGRVTHDDAARARR
FT                   LKARRPGKGAAQSAKGAPQQPKAEQQAEAAAAPQPAQAEAEAPVQTDAAPQVEQQSAGN
FT                   E"
FT   gene            348722..349306
FT                   /locus_tag="Bcen2424_6186"
FT   CDS_pept        348722..349306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12918"
FT                   /protein_id="ABK12918.1"
FT                   /translation="MVSQDDTPHDGLTREEIHHRQIDMRGYRRSDGLFEVTACLADRKT
FT                   SDFTPPGGARTVAALTPLHDLGVTLVFDVDMVVRGVSTFMRSHPYAQCSGGGNSLQALV
FT                   GLNIGAGWNSEVRKRLPSCDTCTHLKELLGPIATTAYQTMVGMRRSSLDYRDSEGKPLK
FT                   IDSCYAYGASRDLVKRLWPEYHQPSAPTKGS"
FT   gene            complement(349424..349915)
FT                   /locus_tag="Bcen2424_6187"
FT   CDS_pept        complement(349424..349915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6187"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   bcn:Bcen_5822 flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12919"
FT                   /protein_id="ABK12919.1"
FT                   /translation="MKTLLIVYHTMTGGTQQMAEAAAGAAREQPGVDVRMQRADATSAD
FT                   DVLAADAYLFATPENLAAMSGLMKDFFDRCYYAALDRVNGRPYAAMICAGSDGQNALRQ
FT                   IDRIATGWRLKNVAPGLIVCTHAQTPERILATKTIDSDALARCAELGAGLAAGLALGVF
FT                   "
FT   gene            complement(350119..350772)
FT                   /locus_tag="Bcen2424_6188"
FT   CDS_pept        complement(350119..350772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6188"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_5823
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12920"
FT                   /protein_id="ABK12920.1"
FT                   /translation="MDTSTPPQRLTDRKRAAIVDAAIEEFLAAGYDATSMDRIAARADV
FT                   SKRTVYNHFPGKETLFAAILNKLWDATRTGSSPTYRADVPLREQLLALLDRKLRLMNDE
FT                   AFLALARVAIGAAIHSPERARDMVERLGEREEDVTVWVRAAAAAGRLSVTDPVFAAHQL
FT                   HGAVKAFAFWPQITMGQPPLTAQEQQKVAESAADMFLAYYARPDDGAARHRRQD"
FT   gene            350856..351980
FT                   /locus_tag="Bcen2424_6189"
FT   CDS_pept        350856..351980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6189"
FT                   /product="Zn-dependent hydrolases of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: bcn:Bcen_5824 Zn-dependent hydrolases of the
FT                   beta-lactamase fold-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12921"
FT                   /protein_id="ABK12921.1"
FT                   /translation="MASPLVLIHRILGFAAARRGRTLSGSSPQHNGERFANVAPRPAEG
FT                   LGKTLGIAWNMLVNKPRHTVPAGALPVDSLTRAELDAAPDRSLYRLGHSTLLLKLRGEF
FT                   WLTDPVFAERASPFRRIGPKRFHAPPIALEDLPPLRGVILSHDHYDHLDRDTVLALAAT
FT                   TDVFVTTLGVGDRLIEWGIDVNKVRQLDWWQSIDVAGLTLTATPAQHFSGRSLFDGNST
FT                   LWASWVIVDDDLRVFFSGDTGYFDGFREIGERLGPFDVTLIETGAYDAQWPYVHMQPEE
FT                   TVQAHIDLRGRWLMPIHNGTFDLAMHRWQEPFERVTALALVRGIELSTPRMGERLDLDA
FT                   PHRGERWWRTVDEHAATPAAKSRRWQLCASQATK"
FT   gene            352108..353124
FT                   /locus_tag="Bcen2424_6190"
FT   CDS_pept        352108..353124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6190"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: bcn:Bcen_5825 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12922"
FT                   /protein_id="ABK12922.1"
FT                   /translation="MHPASLRYISGQRNDDVAIAAFDQASDRSTGRSRENELRQSLAER
FT                   VARWTEGVDHLDTAIPNLSFHRREAPTQPMECMVEPSFGLVVQGAKRVMQSGDAYIYDT
FT                   DRFLITSLDLPGSTQIIEASPDKPFLGLGLKLDFRVMAELMMQVAPDHDDAPAGRGLVV
FT                   GDMTEPLYDALNRLLALLDDPNAIAVLAPYVEREIYYRLLTSDQGARLRQIASAGSQCN
FT                   RVSRAIRWLRAHYDESLRVDDLAAQVQMSSSTFHHHFRQLTGMSPLQYQKWIRLNEARR
FT                   LMLAERLDAASAAFRVGYASPTQFNREYSRLFGNSPRRDIDSLRGGGDVALSIVASY"
FT   gene            complement(353522..353986)
FT                   /locus_tag="Bcen2424_6191"
FT   CDS_pept        complement(353522..353986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12923"
FT                   /protein_id="ABK12923.1"
FT                   /translation="MPLAWANRAGGWFRSEYQISALEGPDMQGDSCNLGHYWRRIHVLA
FT                   TCSNANGSVRETFSENRSLPEILVWQWFAPYSSCCFTANELGDARKWGRMVFWHVGNED
FT                   WRGFTEIRCGEYVIRSFQYVSRWSNCSGCRSAGISASLDRVAPSIDWWEF"
FT   gene            complement(354400..354642)
FT                   /locus_tag="Bcen2424_6192"
FT   CDS_pept        complement(354400..354642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12924"
FT                   /protein_id="ABK12924.1"
FT                   /translation="MVSYGIRYEPETTMLRGLEEEAGCHVTSLRALIASRSGHIERKFS
FT                   MRLRRGLRKNRFISITEVLHIILTYVYPAMRRVVT"
FT   gene            354911..355606
FT                   /locus_tag="Bcen2424_6193"
FT   CDS_pept        354911..355606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6193"
FT                   /product="plasmid segregation oscillating ATPase ParF"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   bcn:Bcen_5826 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12925"
FT                   /protein_id="ABK12925.1"
FT                   /translation="MAFKIAVSNQKGGTGKTTISVNIAAAFEAGGNKVALIDADPQGTS
FT                   VRWVTSGENTLPMTVLSLAPAGRGIGGEIKKQDANFDVIVVDCPGNLEDPRIASVLEVA
FT                   DFCLVPLSPSPADLYSTVAMIRMIESMRAVRNPQLSSALMLNSVNGKTKMREEILKILR
FT                   AEEIGEHLLDSQIAQREVYRQTFALGTTIHHHNRYLKGLKEARAEIEKLVTEMAQYIAS
FT                   TRATGAAHG"
FT   gene            355599..356630
FT                   /locus_tag="Bcen2424_6194"
FT   CDS_pept        355599..356630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6194"
FT                   /product="ParB family protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: bcn:Bcen_5827 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12926"
FT                   /protein_id="ABK12926.1"
FT                   /translation="MAKDTSKDKKPTGNLHLAAGLLRGLAQENAALETRLPEPAAAPAA
FT                   VVDTAPASGPAGTAPAGTPELGAPQKVLVKDCIPNPFNPRVFYSESSLHELALTLKREG
FT                   QIEPIKVTRLPEFPGKLVVIDGQRRLRATSINGDETINATFRTDHTPEQLYTIAYRANH
FT                   DHERQTIFDDAIAWKRLLDEKVFSDQNTLAEKIGKDKASISKTLSLNALPNTLLERMAS
FT                   ANDVVGLQAAYFLKLIFERLGEATADRLLTAVIDRKKSVRDLENFLRAQSDGTKKAGRT
FT                   RYSVRHDFALESRAIGQLKTYPDGRLDLQLKGVDASHQEALADKLKTVIDAYVAELATA
FT                   PSK"
FT   gene            complement(356726..358042)
FT                   /locus_tag="Bcen2424_6195"
FT   CDS_pept        complement(356726..358042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12927"
FT                   /protein_id="ABK12927.1"
FT                   /translation="MPRKPASKGSDKQVSLFQTPEPPDLLRKAVQAIHIAPKSGKIGLQ
FT                   QRKMFSSLIKNALRQEAFEPGRTSFSISIASLSHESGLNSNNTKYVKDTVNSLISTVVN
FT                   WDYLAADRSTVWKASGLLAGAELEQSVLKYSFSDQIRSELLNPEIYALIDMRIAREFRR
FT                   SHSLALWENTVRYEGIGITAKIPLPKFRDLILGQDKASQSYKEYKLFKSKVLVPCIQEV
FT                   NEVSDHTLELIEHKSGRSVEAVQFKVTRKQSTDTVEDGDVKNEALVEEVAKFGIPRSEA
FT                   RRLITQYGVQRIKAAIAYTLNRTTKKNATPVDNVAAYFRKALTHGYTLADGQGTEAAAP
FT                   AKESAQSKQEQIRDKYLAAKVEEAGAYFRELEIDDQTKLIERYNETVAGSKDLTLSPKK
FT                   KASKLAQTSFFRWLALDTWGEPTSDDLLEFLLKSSLAGN"
FT   gene            359995..360243
FT                   /locus_tag="Bcen2424_6196"
FT   CDS_pept        359995..360243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12928"
FT                   /protein_id="ABK12928.1"
FT                   /translation="MSPQVTFCITRWQRLPDESPHAETTQRNRLDRRRSESWSFMGGTV
FT                   ARAASNDVVTCGSTAAAVIAQARRYPRRVSAYRYHHP"
FT   gene            360434..360796
FT                   /locus_tag="Bcen2424_6197"
FT   CDS_pept        360434..360796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12929"
FT                   /protein_id="ABK12929.1"
FT                   /translation="MVFQTVMVIKKESSAMRIQIRKLTLAATAAAFLFGSAVPVFAQET
FT                   ASAPAAPAAQDAKAAKSEARKAARAKRKAEHKAARAKNNAELKKLEDAGYKPAANDPNY
FT                   PQNLQNAEKKAGAASQ"
FT   sig_peptide     360434..360562
FT                   /locus_tag="Bcen2424_6197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 43"
FT   gene            complement(360966..361856)
FT                   /locus_tag="Bcen2424_6198"
FT   CDS_pept        complement(360966..361856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6198"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5831 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6198"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12930"
FT                   /protein_id="ABK12930.1"
FT                   /translation="MARRLPPLNSLRAFEAAARLGSFTLAADELCVTHGAISRHVQQLE
FT                   AWLGRPLFERHNRRVELTAAGRAYLAEVGASFDRIALATAQHFGHAQQRVLRVSAPATF
FT                   SLRWLVPKLSSFQVAHPAIEVRLSTSNEPIDKLRDKVDLIVRGGPQAIDGYVAEEFLSE
FT                   VRLPVCAPKLLEGRSLDTPADLAGFTLLHAATYPGMWPEWLAAAGHPNLVPRHSLTLEH
FT                   FYLTLQGALDGLGVAMGPIALVADDIAEGRLVQPFSEPALPPWRYFTYVASARADDDAV
FT                   RAFKDWLKATGRATV"
FT   gene            361934..363295
FT                   /locus_tag="Bcen2424_6199"
FT   CDS_pept        361934..363295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6199"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   bcn:Bcen_5832 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12931"
FT                   /protein_id="ABK12931.1"
FT                   /translation="MAHKRPTWPNQCLNFSHGVRSMPNVVVVGAQWGDEGKGRVVDWLA
FT                   AQADLVARYNGGHNAGHTLVVGGNTYKLALLPSGIVRGKRGVIGNGVALDPEALLAEIG
FT                   RMAELGLPVTPDNLSIAENATLVLPIHRAIDEAQERLRREPIGTTLRGIGPAYEDKVGR
FT                   RGLRVGDLAEPDGLAAKLDVLVDHHNAWFRGLGLDEYDRDAMLATLVALAPKILPFVRP
FT                   VWADLNDATDRGERILFEGSQAVMLDIDWGTYPFVTSSGTVASAAAAGTGLGAAKLGHV
FT                   LGVTKAYATRVGGGPFLTELTDATGETLRARGQEFGVNTGRPRRCGWLDAAQLRQAVRI
FT                   SGIDSLALTKLDVLDGFESIALCVGYEFDGARVDHLPASLDAQSRAKPLYERFEGWQGS
FT                   VKGVRERAALPRAAQDFIARIEAVAGAPVSMITTGAERDDTIVLRDPFDAAAAA"
FT   gene            363596..364546
FT                   /locus_tag="Bcen2424_6200"
FT   CDS_pept        363596..364546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6200"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5833 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12932"
FT                   /protein_id="ABK12932.1"
FT                   /translation="MDTLQMMRIFVRVAEEGSFTSAAQRLDITTAYASRSVAQLETHLR
FT                   TRLLNRSTRRIALTDAGQRYLDRCQRILGYIDEAEAEAADAQAKPSGRLHVHATTSFGQ
FT                   SYVMPAVVRYRERYPSVAVELTLSQHVPDIIDEGYDVSLQLSTTELPDSGLVSQRLGDV
FT                   GSVLCASPAYLKARGTPRTVSDLAGHACLRLVTPLFPRDRWHLDGPNGRETVELPLPDF
FT                   QVNIADALGTALRAGLGIGSLPMSAALPALASGALVRVLPDYRLQKLTVYTLYASRQYL
FT                   DAKIRTFVDFLRECVPEMLAADEAALNACCASRQS"
FT   gene            364819..365790
FT                   /locus_tag="Bcen2424_6201"
FT   CDS_pept        364819..365790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6201"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; SMART:
FT                   extracellular solute-binding protein, family 3; KEGG:
FT                   bcn:Bcen_5834 ABC transporter, substrate-binding protein,
FT                   aliphatic sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12933"
FT                   /protein_id="ABK12933.1"
FT                   /translation="MADRHSSIRRRLIHAGLAIATGAAAHPGLALASAAGARTLRIGYQ
FT                   KGPLSLLKARGTLQGKLATLGVNVTWTEFPSGPPQLEALNAGSIDFGDVGEAPPIFALA
FT                   AGAPLVYYAQTPAGPATEAVVVAKDSPVKTFADLRGKRIALVKGSNTHFLLVRLLQAAK
FT                   LGYTDVTPVWLSPSDARAAFENRSVDAWIIWDPFLAVVQQAFGARIVADGTGLVENRSY
FT                   YFASRTYAQHNADVLDAVVSELATVQRWLDANRAQGAAEFSKLWGIPEPAVALAFRRAR
FT                   FGVEPVTRDTLAYQQRIADVFYQAGILPKRVDVSLAAPPSLA"
FT   sig_peptide     364819..364917
FT                   /locus_tag="Bcen2424_6201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.903 at
FT                   residue 33"
FT   gene            complement(365852..366973)
FT                   /locus_tag="Bcen2424_6202"
FT   CDS_pept        complement(365852..366973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6202"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: bcn:Bcen_5835 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12934"
FT                   /protein_id="ABK12934.1"
FT                   /translation="MIGLISDRFRQSRALDSPYDVSAVPCASTGDRSRTHCIAHSANRL
FT                   PNMEIDARTPPQPRTPPDHDARSPARLATARLAALIAAYAPHDGMFDLPLRGMRVARAS
FT                   APSPQWNHGVHHACLSLVGQGAKSIRVGDATYGIDESRMLVAIADLPVTGRVTRANPAE
FT                   PFLYAQLELDPRRIAALTPVVFPHGLPKAVDYGALDTLDATPEIVDAVARLMQLIAQPD
FT                   DLDLLAPLIVDEILIRLLRGPSGARVAQIGDAGSTTQRISRAVAWIRDHYLDPMAVDAL
FT                   ARQVEMSPSTFHHHFRAVTSMSPLQCQKVLRLQEARRLMCLSAMDARQACRSVGYVSAS
FT                   QFSREYARLFGDAPGRDVARLRGEAVPLSRVAP"
FT   gene            367430..368311
FT                   /locus_tag="Bcen2424_6203"
FT   CDS_pept        367430..368311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6203"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5836 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12935"
FT                   /protein_id="ABK12935.1"
FT                   /translation="MDQLQSIRAFVTVAREGGFRRAATRLRVSTAMASRLVDALETRLG
FT                   ARLLQRSTSHQSLTEIGELYLARVERILGAIDEIDGRFVAMGSKPEGVLRVAAPVAFGL
FT                   SQLSALLDRFVHRFPDVRPTVTLTDAHVDLTAEDIDVAFLTDGMPVSGAHALHTLAAYE
FT                   SVRVAAPDYVAAHGGAAASGDWPDIAAVRLELPAADDDPMAGVRSGAATSNAGVGHLEM
FT                   ARRLAVAGMGAAVLPAYLVEADLAAGTLVRVAPLHPLAPVTLKLAHARAARLPAAARAF
FT                   IEFAGAAFRPAR"
FT   gene            368537..369775
FT                   /locus_tag="Bcen2424_6204"
FT   CDS_pept        368537..369775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6204"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_5837 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12936"
FT                   /protein_id="ABK12936.1"
FT                   /translation="MRVERVPYRLITAATVAVFLAACGKKEAAPPPQTPEVGVVTVQPQ
FT                   AVPAVTELPGRTSAFLVAQVRARVDGIVLRREFTEGTDVKAGQRLYKIDPAPYIAALNS
FT                   AKATLARAQANLVTQNALVARYKVLVAANAVSKQDYDNAVATQGQAAADVAAGRAAVDT
FT                   AQINLGYTDVVSPISGRVGISQVTPGAYVQASQATLMSTVQQLDPVYVDLTQSSLEGLK
FT                   LRQDVQSGRLKTSGPGAAKVSLILEDGKTYSEPGKLQFSDVTVDQTTGSVTIRAVFPNP
FT                   NRVLLPGMFVRARIEEGVNENAFLVPQIGVTHDQKGQAIALVVSAANKVEMRPLTTTGT
FT                   YGQNWIVEGGLQAGDHVIVQGVDKVRPGATVKTVAAQLAPAPDAASATSAGAAPASTAT
FT                   SAAASSAAASNAQ"
FT   gene            369791..372982
FT                   /locus_tag="Bcen2424_6205"
FT   CDS_pept        369791..372982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6205"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bcn:Bcen_5838 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12937"
FT                   /protein_id="ABK12937.1"
FT                   /translation="MAKFFIDRPIFAWVIAIVLMLAGVASIFKMPIAQYPTIAPPTIQI
FT                   QANYPGASAKTVEDTVTQVIEQQMSGLDNFLYMSSTSDDSGNATITLTFSPGTNPDVAQ
FT                   VQVQNKLSLATPNLPQVVQQLGMQVTKSSSNWLMWFAFNSEDGRMSKEDLTNYVASHVL
FT                   DPLSRVNGVGQTLLLGSQFSMRIWLDPIKLTNYSLTPTDVTAAITQQNVQIAGGQIGGT
FT                   PAKPGTVLQATITESTLLRTPEQFGNILLKVNQDGSQVRLKDVGRAALGSENYTFDTKY
FT                   MGQPTAGLGIQLATGANALATANALRAKIDELSKYFPHGLVVHYPYDTTPFVRLSIEEV
FT                   VKTLIEGIVLVFLVMYLFLQNLRATIIPTIAVPVVLLGTFAIMGLAGFSINTLSMFGLV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPKEATRKAMSQITGALVGVALVLSAVFVPVAF
FT                   SGGSVGAIYRQFSLTIVSAMVLSVLVALVLTPALCATILKPIEKGHHEEKKGFFGWFNR
FT                   TFDRSRDRYTSGVNHVIKRSGRWLVIYLAVFLAVGVMFARLPKSFLPDEDQGYMFMIVQ
FT                   TPSGSTQETTGKTLDNINTYLTTAEKDVVDSVFTVNGFSFAGRGQNAGLVFVKLKPYEQ
FT                   RQRSDQKVQALIGRTFAHYSTYKDGMVIPFNPPSIPELGTAAGFDFELTDNAGLGHEAL
FT                   MAARGQLLGLAAKDPALALVRPNGLNDTPQYKVDIDREKANALGVTAAAIDQTFSIAWA
FT                   SQYVNNFLDTDGRIKKVYVQSDAPFRMTPEDMNIWYVRNSAGGMVPFSAFSTGHWIYGS
FT                   PKLERYNGVSSIEIQGQAAEGKSTGQAMAAMEALASKLPEGIGYSWTGLSFQEIQSGSQ
FT                   APILYAISILVVFLCLAALYESWSIPFSVIMVVPLGVVGALLATMLRGLENDVFFQVGL
FT                   LTTVGLSAKNAILIVEFARELQAGGNMGPVRAAIEAARLRLRPILMTSLAFMLGVLPLA
FT                   ISNGAGSASQHAIGTGVIGGMITATFLAIFMIPMFFVRVRAIFSGETENVDDAWRLVQG
FT                   DLQRGHDDAHDSKGQ"
FT   gene            372985..374511
FT                   /locus_tag="Bcen2424_6206"
FT   CDS_pept        372985..374511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6206"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_5839 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12938"
FT                   /protein_id="ABK12938.1"
FT                   /translation="MQKHALTATAVALAAALFATGCTMAPHYKRPDAPVAQAYPAGGVY
FT                   ATQPGAAGAHSANGQAATAIGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQY
FT                   QITRAGLFPTLDGTGTGNIQRLPAGVSTTRAPLISRTYNVGLSASWELDLFGRVQSLKD
FT                   QALAQYLSTAYARQASEISLVSQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQF
FT                   DNGTGSELELRQAQTVVETALANQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDAQ
FT                   NLLTDVPAGLPSDLLTRRPDVMQAEQTLLAANANIGAARAAFFPRISLTAAFGTASPTL
FT                   GGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLANVQKRIEIANYEKAIQSAFREVSDG
FT                   LAARGTYDQQIAALERNEHAQQRRFDLSDLRYKNGVDSYLSVLTAQTDLYSAQQSLISA
FT                   RLARWTNLVDLYRALGGGWIQRAGEAPRAPDTPGDYSKAAAPAPASAVNG"
FT   sig_peptide     372985..373050
FT                   /locus_tag="Bcen2424_6206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.560 at
FT                   residue 22"
FT   gene            complement(374618..375331)
FT                   /locus_tag="Bcen2424_6207"
FT   CDS_pept        complement(374618..375331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6207"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: bcn:Bcen_5840
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12939"
FT                   /protein_id="ABK12939.1"
FT                   /translation="MSQTSGSTITFRRPDGQELQGYLATPARTEGAPAVVIIQEWWGLN
FT                   DQIRGVADRLARCGYFALVPDLYRGKSTVEEEEAHHLMTGLDFGDAASQDIPGAVAYLK
FT                   TLAPRVAVTGYCMGGALTLLSLQYAEADAGVTWYGLPPLDYIDPAKLKVPLMGHWATQD
FT                   AFFKIDQVDALEKKLTDAKVGFEFHRYLAHHAFANETAVGPGRIAGTQFDPVWSETAWD
FT                   RTLTFFGRTLWTKQA"
FT   gene            complement(375608..375919)
FT                   /locus_tag="Bcen2424_6208"
FT   CDS_pept        complement(375608..375919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12940"
FT                   /protein_id="ABK12940.1"
FT                   /translation="MKSFITAVVAATALCASYGAFAQSNPSGQLTRAQVRAELVQLEQA
FT                   GYKPEVSDQYYPRALQTAQARVTNAEEAGYGAQAAAGTRAGRAIAVKQEGRDSVYFGQ"
FT   sig_peptide     complement(375851..375919)
FT                   /locus_tag="Bcen2424_6208"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 23"
FT   gene            complement(376208..377173)
FT                   /locus_tag="Bcen2424_6209"
FT   CDS_pept        complement(376208..377173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6209"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bcn:Bcen_5842
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12941"
FT                   /protein_id="ABK12941.1"
FT                   /translation="MPKVVGIFAVPGVQLLDVSAPLDVFAQANVECGKPFYTPRIIASG
FT                   PGPVRSSSGARLLPDWVAPDIPERIDTLLVAGAPNAGQILLRTDVLAWLRSAAVQSRRY
FT                   GSICTGAFILAATGLLKGRHLTTHWAAAEAFAQAYPSVAVDADALYVRDGKLRTGAGVT
FT                   AGLDLALALVEEDLGREIARRVAAQLVMFFKRPGGQLQFSRKGEARPAGRSVLQEVQRW
FT                   IVAHPELEHSVADMAKHAGMSPRHFARLFRAEVGMTPAAWVEATRISVARQLLEDGRDT
FT                   PKQVAAKCGFANVDTLRRAFTRHVGITPAEYRKRQVTLAA"
FT   gene            377342..377983
FT                   /locus_tag="Bcen2424_6210"
FT   CDS_pept        377342..377983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6210"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; KEGG: bcn:Bcen_5843 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12942"
FT                   /protein_id="ABK12942.1"
FT                   /translation="MTVNVAGITLPDTRLTREITELVRDTESELLFHHSSRVFYFAALA
FT                   GRRRGLEYDPELLYCGCMFHDMGLTHRHSSACERFEVDGANAARDFLKGKGISQQDIDV
FT                   VWTSIALHTTPGIPQHMHPVVALVTAGVEMDVLGLAYPEYSDVEREAVVRAHPRTPHFK
FT                   EDIIQAFYDGIKHKPGTTFGNVKADVLADKDPHFHAGNFCSVIRSSAWAG"
FT   gene            378054..378320
FT                   /locus_tag="Bcen2424_6211"
FT   CDS_pept        378054..378320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12943"
FT                   /protein_id="ABK12943.1"
FT                   /translation="MVEPVAARAGVDVPVVFQREPISGGDFVMLKPIAVSIIATPAKFS
FT                   ALLANAPEPVCRTVSRPAGARRDFECTETVGAGTGAIRHARRG"
FT   gene            378646..379101
FT                   /locus_tag="Bcen2424_6212"
FT   CDS_pept        378646..379101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6212"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   bcn:Bcen_5845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12944"
FT                   /protein_id="ABK12944.1"
FT                   /translation="MSTIAFHPSGVAHPRQAEFTILEQLLAIRVRSGADLAELASARVD
FT                   VSVIDRLSERGLKSDELAFIIPRRTLSHRRQAHERLSPEESDKAIRLARIVAQATATFG
FT                   DQDKAMAWLRNGLQRFGGRTSLDMASTEHGARLVEEALTQIDEGYFA"
FT   gene            379098..379577
FT                   /locus_tag="Bcen2424_6213"
FT   CDS_pept        379098..379577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12945"
FT                   /protein_id="ABK12945.1"
FT                   /translation="MTTLWRISNYADLKGIGGLRAGGRWHFAGQPVVYLAEHPALALLE
FT                   TLVHFEIATVAQLPSGYQLLRIEVPESVDVAEIAEGDAPDDWRTNVDWTRSAGTEWLHT
FT                   QPSALLRVPSVVVPHAHNFLLNPLHPAASEIHIAEVMQSPYDTRILRLVQSKPGE"
FT   gene            complement(379625..380560)
FT                   /locus_tag="Bcen2424_6214"
FT   CDS_pept        complement(379625..380560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6214"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bcn:Bcen_5847 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12946"
FT                   /protein_id="ABK12946.1"
FT                   /translation="MDTDRWIHDPVGAFRAWQETAATGAGRRPFAPRSVVQHVAMFERF
FT                   LRHLSAQRVSLATFGPDHVAAFLAELDRTCTPGTSTRVRYAKLIDRLGRHLVDAGVRTI
FT                   HPADRSTRDLAWPDGEPEPCYLPPDADAALQRHVQPRADDTPADCRNRAIVALLLASGI
FT                   TSAEIRAASADAPEFDARPPVFLVPRNRARPARRIELPTFAIAPLAAWRARSTDVPPSA
FT                   LLFPAPRGGAMNDMFLLLVVRDALNAIGFRAADMSPRVLRNTYARRQLLAGHAHADVTA
FT                   MLGLASMRTVTRIRQTLPPDAAADRAAHEH"
FT   gene            complement(380640..381152)
FT                   /locus_tag="Bcen2424_6215"
FT   CDS_pept        complement(380640..381152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6215"
FT                   /product="small integral membrane protein"
FT                   /note="KEGG: bcn:Bcen_5848 small integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12947"
FT                   /protein_id="ABK12947.1"
FT                   /translation="MIIRLSKAAMVLAMAFFASLVAFGNITDYATNFAFVHHVFLMDTT
FT                   FPANGIMYRAIGTTWVHHAGYIGIISMETLTAVLCWIGGARLLRARRAGDAAFRAAKGH
FT                   AIAGLTLGFLTWQVAFMSVGGEWFGMWMSKQWNGVPDAFRFFITLLLVLVYLTMNNDGV
FT                   DDTRTAH"
FT   sig_peptide     complement(381078..381152)
FT                   /locus_tag="Bcen2424_6215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            complement(381431..382786)
FT                   /locus_tag="Bcen2424_6216"
FT   CDS_pept        complement(381431..382786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6216"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   bcn:Bcen_5849 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12948"
FT                   /protein_id="ABK12948.1"
FT                   /translation="MSHDPISPPVDARLPAWQLALFGLQHVLSMAASPITAVFLIAKVL
FT                   ALPADLTVQLIGATFFACGIGTLLQSLGAGSIGARMPFVMVPGGAPTMLFAGIAAQSGL
FT                   PTAAGAALLASAFYWVLLPVFTRCLRLFPRVVVGAMLLLVSINLIRIYATIVVGQPGSA
FT                   DFAQPRALGLALATIVATVIVAGTFRGTAGRLAVLIGLMAGATLGWALGAMPALADVWH
FT                   GPLFTHPVWLPFGMPRFDVLAALPLLIFTAISMAEATAQTVAVGETCGKAISLPRDVPK
FT                   TIRGDALASLAGALFGTPLIVMSAENIGVVQTTGVRSRYVTAAAGAILIVIALFAPLAR
FT                   LAYAIPAAVVGGTALIVFAMIGVMGIRLLANVDLHARANQYTLAAALVVGLAPILVPNL
FT                   YRHFGAPVQIVLGNGMAAGTLAAIATQLAFAALARLGGHAHAGAAAAPSHDA"
FT   gene            complement(382845..383969)
FT                   /locus_tag="Bcen2424_6217"
FT   CDS_pept        complement(382845..383969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12949"
FT                   /protein_id="ABK12949.1"
FT                   /translation="METAVTTVDQITQRRRGVGLIAHDPALSAGGYTLIAPQTADGNVY
FT                   LVGIDGEVVHQWKMPVRPGRHAVILANGNLGYNGNHPRSESRYAPWSMWHGGDFYEVTP
FT                   QGETVWRYEDPAHHHDAQWLPNGNLLYAACEPVDAAFARRVPGGTAQGDDEVMFADVIR
FT                   EVNRAGQIVWEWHAREHLRPEDFPIAAGFGRYHWPLVNGLAVDANGRVLMSLRTTSGII
FT                   GVNRATGRVDLHIGPDVVSHQHAPVPLPNGHILAFDNGNFRHGAHVVFSRVVEIDPATQ
FT                   RVVWSYADDVVNLFYTPFMGNAQRLPNGNTHITESSTGRLFEVTPAGEVVWEYVIPWFA
FT                   EYPDEAARKTGPGQLNSVFQTFRYSAAQLPWLRT"
FT   gene            384072..385037
FT                   /locus_tag="Bcen2424_6218"
FT   CDS_pept        384072..385037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6218"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5851 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12950"
FT                   /protein_id="ABK12950.1"
FT                   /translation="MRSISQTFRCFDEVARRGSIRKAADALHLTAAAVHQQIRNLEEQV
FT                   GVPLFDRLPRGMQLTLAGEIVIAAVRRGQRDFDNALTQVEDLRALRRGHVNLAVPASTA
FT                   EKLVPDAILAAMQRYPGVTYSVRLGNGESIVRWVETGEVDIGYALRRRTAPGVVEVRAF
FT                   AQPLGVVTAPGHPLASTGGKVRMRDCFEHPLILMTPDTELRAMFDQIDARQPRGVRPLV
FT                   ETGSVSMVRRLAAEGAGVGFLIAENVADDVAAGRLAWTPLADAGARSFSCIYQRADMSA
FT                   TVAMAMFLELFSEAIDAMEHGFARGGPASGTRRRAKKVTT"
FT   gene            385261..387246
FT                   /locus_tag="Bcen2424_6219"
FT   CDS_pept        385261..387246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6219"
FT                   /product="gamma-glutamyltransferase 1, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   bcn:Bcen_5852 gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12951"
FT                   /protein_id="ABK12951.1"
FT                   /translation="MNRTAIFPYASALLAAALLTACGGDVENEAARTTAPSTDASCLAV
FT                   DNSGATVVVGSNQPGDPSLPEASSGYRTGMKPVYAKTYLVATSNAYASAAGCAVLKKGG
FT                   TAADAAVAVQAVLGLTVPEATGLGSGGVLLYYDARGKTVQAYDGRETAPAAATENYLRY
FT                   VDDATDHSAPLPNARASGRSIGTIGVPRLIEALQQDHGRLPWQSLFGDAITLATNGFPI
FT                   GGRLADAIAANAANLKRDPEAAAYFLNADGSPKTLGTVLKNPAYARTLSLMAQSGANAL
FT                   YTGQIAQDIVAKIAATKGADGSTLTPGKTTVADLAAYQAKRREPVCTTYRSYWVCGMPP
FT                   PSSGGIAVASALGILENFDLKSLKPTAIDLEGGKPTVAGVHLVTEAERLAYADRDKYVA
FT                   DTDFVPLPGGTWDTLLNKPYLKSRAALIDTTKSMGTAQPGNLGAVPLGVDTTLIEHGTN
FT                   QFTIVDGDGNVLSATTTVESSMGSFHMTNGFLLNNQLTDFSANPLDTSGNPVANRLQPG
FT                   KRPRSSMAPTIVFGQAADGSRGDFVMATGSPGGGTIPQYVVKTLVGALDWGLDAQQSAG
FT                   LVDFGASNSPTTTIGGEHPNVNAANNGANDPLITGLLALGHKVSTSAQASGVNTVMRVT
FT                   VGQSPALQGGTDPRREGVVLGDTFRP"
FT   sig_peptide     385261..385332
FT                   /locus_tag="Bcen2424_6219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.523 at
FT                   residue 24"
FT   gene            387662..388204
FT                   /locus_tag="Bcen2424_6220"
FT   CDS_pept        387662..388204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6220"
FT                   /product="Late embryogenesis abundant protein"
FT                   /note="PFAM: Late embryogenesis abundant protein; KEGG:
FT                   bcn:Bcen_5853 late embryogenesis abundant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12952"
FT                   /protein_id="ABK12952.1"
FT                   /translation="MNKIHTILLGAALTAMATSAAFAQTAQTGAQGSAGVGAQVQTPLL
FT                   GGGVGVQAGAGANAAGSGAGAGNVVGGALSGVGKTVGGVGSAAGTAVGGATQAVGSAAG
FT                   ATKDAAASTVHATKSHVKHVASSTKSHAQGAVSTAGDVAGGAKAKAGEALEGATNSVQG
FT                   GASVGVKGSASAQGGAL"
FT   sig_peptide     387662..387733
FT                   /locus_tag="Bcen2424_6220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 24"
FT   gene            388845..390095
FT                   /locus_tag="Bcen2424_6221"
FT   CDS_pept        388845..390095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6221"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bcn:Bcen_5855
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12953"
FT                   /protein_id="ABK12953.1"
FT                   /translation="MKFIHAADIHLDSPLHGLSAYPDAPAAQLRNASREALRQLVDRAI
FT                   EEEVAFLVIAGDLYDGDWKDHNTGIFFGQQMGRLRRAGIRAFVLGGNHDAESEMTKKLT
FT                   LPDNVTVFGHRKPETVRLPEFDVALHGQSFKDKAVVDNLAIGYPDPVPGYYNIGVLHTA
FT                   LEGYAAHANYAPCTLAELHAKGYDYWALGHVHEFQQWTGPSTVVFPGNLQGRHIRETGR
FT                   RGAVLVTVEQGNTQVERLYLDVLRWEAVSVDASDCLSVADLSRKVGQSLETLLTVDGHV
FT                   PRAVRVTVTGRTPAHGLFFGRAPQLRAEVLNQIGIIGNERLWLEKVRLATSAADQQPGE
FT                   SEPLEALEDLKQILADAAHDPDFLALLERDLKPFVGKVRSDVKEEVPLLTMARAGELTA
FT                   LVEQVGPALLARLARGE"
FT   gene            390099..393569
FT                   /locus_tag="Bcen2424_6222"
FT   CDS_pept        390099..393569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12954"
FT                   /protein_id="ABK12954.1"
FT                   /translation="MRISQLDLIKYGKFTDETLRFPSASEDFHVIVGPNEAGKSTIRTA
FT                   VSELLFGMKLQTPLDFLHSTPELRIGGVLESGTGEFAFHRARGRSPLRTPADDKLPDDY
FT                   LASILDGATREFFEQMFGLDHGRLVDGGRSILDASDKLGQVLFESAAGVGSLGPVREEL
FT                   DARALELWAPRRSGSAFALAETAFNEAVTELKTVQVRTRDWVDRKDAREAVEQQIEQAR
FT                   AEQRRLEALRSKLERVRRLAPYLKELTVKDAALAELGAVVELPPTAYADLLKAQGDLAA
FT                   EQKVLEERRADLLAKRQARDAIAADADTLALEADIEALDRLRGACMNHAQDLLLLGADV
FT                   ERHLLAASSAAAQLGWPTDEASLRAALPTALSLKTVANLLREHGLLHQALAGARESLDE
FT                   RTRELAQVREQQARLSTVDVPEALRAALADAQGFRNSGAREQALAHEIAAAERTLSGAL
FT                   DALGQWRMPVDALRALDVPSAARLGALLKEDSERASAAAAARDARDGALEELERLELQE
FT                   KHFAENHKVVTTADVLAARARRDGAWGEIRSGAVDLATGAPALDDAIRLADELVDAQLG
FT                   ATQAAATLQSLRQQVESARAGVTRRQAALDERERELAAHRDAWAALATAAAVPGMPLAA
FT                   MGDWLAKRDTVFAAQADLDRQRREFDTMRAARAGAEAALRAALLTVSRGGEADGLAALV
FT                   AVAETFVQSAEKAAAQKDSLDDRAREAERGCATAQSRADHAQTAYDAWQAQWRDALADA
FT                   KLSASATTLAAAEGALGLADTVMAELAEADAPRNRIATIRAELNALEAGARRLAEALAP
FT                   EWLASGDWLDVARRLTMRLAAAREIARAIDRADEAVRQADGKVADAAAAVAGADARIQP
FT                   LLQLAGVASIDAALPLAERSDRQRQLRQAVDAAHEALVRDGDGLSRSAVEAEVAEQDIA
FT                   DVPAHLEAVKQSLADIGKRLNELSQQQVVADQAFGAIDGQANAAVAEAKRQEALAAMGD
FT                   AAEQYLEAATASRLLKWATDRYRDQKQGPMLRRAGEIFAGLTLGEFAKLTVDTERTPPA
FT                   LYARRTRGTSVEVAGLSEGTRDQLFLALRIAALELQLGSRTALPFVADDLFINFDDARA
FT                   KAGLDALRDLSTRTQVLFLTHHDHLLPLVRDVFGARVNVVELQRAPAGA"
FT   gene            393690..394214
FT                   /locus_tag="Bcen2424_6223"
FT   CDS_pept        393690..394214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6223"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: bcn:Bcen_5857 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12955"
FT                   /protein_id="ABK12955.1"
FT                   /translation="MKKLVAAIAFAADKHRNQRRKDEEASPYINHPIALADVLANEAGV
FT                   EDERVIVAAVLHDTVEDTETTEQELLRLFGKDVADIVMEVTDDKSLPKEERKRLQVEHA
FT                   ATISRRAKLVKLADKICNLRDIARHPPADWPLERKQAYFDWAKSVVDPMRGVHPGLEAI
FT                   FDTAYAARPAD"
FT   gene            394224..394901
FT                   /locus_tag="Bcen2424_6224"
FT   CDS_pept        394224..394901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12956"
FT                   /protein_id="ABK12956.1"
FT                   /translation="MCSARFAARQPAAVAGVDVGGDRKLCDLVILRGSTVVCREARIAP
FT                   ESLPALCLAHDVVAVGVDAPSLWWTGSGRRAAEQALARERISCFPTPSREQAVASTSGF
FT                   FDWMFMGERVYRALADAYPLLTDARYAGGRASFETYPYAITCAMLGKAVASAKLKRNQR
FT                   RQLLERLGIDVSTLSSVDARDATLCALTAQYVIEGNAHAYGDAAGGYIRVPMMRETIVL
FT                   DAS"
FT   gene            complement(395055..395525)
FT                   /locus_tag="Bcen2424_6225"
FT   CDS_pept        complement(395055..395525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12957"
FT                   /protein_id="ABK12957.1"
FT                   /translation="MPRPNHALISMMDSTTQPGDADLRDEYAALRERAILLEQQVPPLL
FT                   QRISDMLPRISGESELADTHRERLVGARNAALVSIENYQQAIPFLQTADSIIEQLDKTP
FT                   ERDEDIEWRESLLQRLDELIDVAVVMIDDADSYFEQAQACDLSSVPTSILED"
FT   gene            396193..397670
FT                   /locus_tag="Bcen2424_R0082"
FT   rRNA            396193..397670
FT                   /locus_tag="Bcen2424_R0082"
FT                   /product="16S ribosomal RNA"
FT   gene            397735..397811
FT                   /locus_tag="Bcen2424_R0083"
FT                   /note="tRNA-Ile1"
FT   tRNA            397735..397811
FT                   /locus_tag="Bcen2424_R0083"
FT                   /product="tRNA-Ile"
FT   gene            397850..397925
FT                   /locus_tag="Bcen2424_R0084"
FT                   /note="tRNA-Ala1"
FT   tRNA            397850..397925
FT                   /locus_tag="Bcen2424_R0084"
FT                   /product="tRNA-Ala"
FT   gene            398202..401082
FT                   /locus_tag="Bcen2424_R0085"
FT   rRNA            398202..401082
FT                   /locus_tag="Bcen2424_R0085"
FT                   /product="23S ribosomal RNA"
FT   gene            401237..401349
FT                   /locus_tag="Bcen2424_R0086"
FT   rRNA            401237..401349
FT                   /locus_tag="Bcen2424_R0086"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(401612..402091)
FT                   /locus_tag="Bcen2424_6226"
FT   CDS_pept        complement(401612..402091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6226"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_1605 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12958"
FT                   /protein_id="ABK12958.1"
FT                   /translation="MTRAEMHKLFTVRAARAADADELTRLAHLSKAHWGYPKEWLDLWQ
FT                   NDLTVSRETIEGAIGYVAESGESIIGFWIRASLNSDRPTPGWLFVHPDHMGQGVARALW
FT                   ESVRTEAAARGIKSFVIEADPNAAPFYLTLGAEKIGEKESSAIPGRFFPILRIMV"
FT   gene            complement(402223..402594)
FT                   /locus_tag="Bcen2424_6227"
FT   CDS_pept        complement(402223..402594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12959"
FT                   /protein_id="ABK12959.1"
FT                   /translation="MDAIRTVIEPSETALRAAMLANDVEALDALLDDDLVFTVPTGQVI
FT                   SKEDDLAAHRAKLLRLDTLDVIEMRASAVDEMILTTTRAALAGRFDGAAFTGTFAYTRL
FT                   WRRSGAHWRVVAGHASQVI"
FT   gene            complement(402648..403247)
FT                   /locus_tag="Bcen2424_6228"
FT   CDS_pept        complement(402648..403247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12960"
FT                   /protein_id="ABK12960.1"
FT                   /translation="MVNVDESAASIFGVIGTAVSLLAAIPYGLAIYRRTVRPHLFTWLV
FT                   WSVVTAIAAAGQFVAGAGPSAWCTAAIAVTCFLTLIASLFRGEHGWTGLDWLFLCAALS
FT                   AIPLWMLTDDPTVSICLVTLIELAGLGPTVRKTIRDPLSESLVYFALCVLKYALALLAL
FT                   STWSVAVAFYPVVNLIASIGICMVMLVRRQSLSNAR"
FT   sig_peptide     complement(403176..403247)
FT                   /locus_tag="Bcen2424_6228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.708 at
FT                   residue 24"
FT   gene            complement(403411..404415)
FT                   /locus_tag="Bcen2424_6229"
FT   CDS_pept        complement(403411..404415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6229"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1602 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12961"
FT                   /protein_id="ABK12961.1"
FT                   /translation="MGPQMISPDFVDDALACLRRRDLPTAPVLRAAGLPAAVHEPVTPQ
FT                   QYGRLWLAIAGTLDDEFFGLAARPMRRGSFTLLCHAVLHAGTLDKALRRALKFLRVVLD
FT                   EPHGELVVADGQAQVVLAQSGAPYPAFAYRTFWLILLGVACWLIGRRIPLQRIDFACPS
FT                   LGQRSDYHQFFGVPVHFDRPDSRLAFNAAYLALPTIRSEQTLRTFLRGAPGNLLVRYRH
FT                   DTGWVAKTRAHLKALPAAEWPDFDTLAVRLDTTPATLRRRLRSEGQSFAAIKDELRGAL
FT                   AQSLLRGHALSVAEIAVELGFTEPSAFHRAFRKWTGTSPGAFRRDVHAAKAES"
FT   gene            404559..406226
FT                   /locus_tag="Bcen2424_6230"
FT   CDS_pept        404559..406226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6230"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_1601 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12962"
FT                   /protein_id="ABK12962.1"
FT                   /translation="MPEGATARAVPAYADAVARFSIETAAAQLSGDLERGLNACVECCD
FT                   RHAKADAIALDWIDAGGQHHRFTFAQMQALSARVANLLVAQGVKPGDVVAGLLPRTPEL
FT                   VATILGTWRAGAVYQPLFTAFGPKAIEHRLRMSDARLVVTNVANRAKLDEIADCPPVAT
FT                   VREAGEALRMRDIDFRTALDAQSDTFEPVPRKGSDLFMMMSTSGTTGLPKGVPVPLYAL
FT                   LAFSAYMREAVDLRAGDRFWNIADPGWAYGLYYAITGPLLLGHATTLYEGSFTVDSTYD
FT                   VIDRLGITSLAGSPTAFRMLMAAGTEAAARVKGRLRAVSSAGEPLNPEVVRWFHAALGA
FT                   PIHDHYGQTELGMVVNNHHGLTHVVHVGSAGFAMPGYRVAVLDEAGRELGPGEPGNLAI
FT                   DIARSPLLWFRGYWQQDTPAIAGGYYRTGDNVELEPDGAVSFIGRADDVITSSGYRIGP
FT                   FDVESALIEHPAVSEAAVIGVPDPERTEIVKAFVVLSKGFDGTPELAEELSLHVKRRLS
FT                   AHAYPRAIDFVDALPKTPSGKIQRFVLRKMEAEKVAQP"
FT   gene            406240..407007
FT                   /locus_tag="Bcen2424_6231"
FT   CDS_pept        406240..407007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6231"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Insect alcohol
FT                   dehydrogenase family; KEGG: bcn:Bcen_1600 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12963"
FT                   /protein_id="ABK12963.1"
FT                   /translation="MNIKDRVFLITGAGSGLGAAVARMVVAQGGKAVLLDVNDEAGAGL
FT                   ANELGAAARFVKTDVTSEADGQAAVAAARDAFGRVDALVNCAGVAPGEKVVGRDGLHSL
FT                   DRFARAVSINLVGTFNMIRLAAEAMSKQDADAEGERGVIINTASVAAFDGQIGQAAYAA
FT                   SKSGVVGMTLPIARELARFGIRVVTVAPGIFATPMMAGMPQDVQDALGKSVPFPPRLGR
FT                   PEEFAALVRHIAENTMLNGEVIRLDGALRMAPR"
FT   sig_peptide     406240..406323
FT                   /locus_tag="Bcen2424_6231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.944 at
FT                   residue 28"
FT   gene            407026..408216
FT                   /locus_tag="Bcen2424_6232"
FT   CDS_pept        407026..408216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6232"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bcn:Bcen_1599 acetyl-CoA C-acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12964"
FT                   /protein_id="ABK12964.1"
FT                   /translation="MTTQDPIVIVGAARTPMGGFQGDLAAASASDLGAVAIRAALERAN
FT                   VPAERIEEIVFGCVLPAGQGQAPARQAALKAGLPLAAGATTVNKMCGSGMKAAMFAHDL
FT                   LLAGSAAVAVAGGMESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYEKGRLMGT
FT                   FAEDCAQAYQFTREAQDAFAIASLTRAQRAIAEGRFVSEIAPVTVKAGKTESVVSIDEQ
FT                   PGKAKLDKIPTLKPAFRDGGTVTAANASSISDGAAALVMMRRSEAERLGLTPKAVIVGH
FT                   ATHADKPGLFATAPIGALRKLSEKTGWNLRDVDLFEINEAFAVVPMAAMRDLDLPHEKV
FT                   NVHGGACALGHPIGASGARVMVTLLAALETYGLTRGVASLCIGGGEATAVAIERIA"
FT   gene            complement(408353..409045)
FT                   /locus_tag="Bcen2424_6233"
FT   CDS_pept        complement(408353..409045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6233"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; Tetracycline
FT                   transcriptional regulator YcdC, C-terminal domain protein;
FT                   KEGG: bcn:Bcen_1598 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12965"
FT                   /protein_id="ABK12965.1"
FT                   /translation="MRHDEAAIAATDRDETPAPLRRRKAHIRESNEAHLLACAEAVFAE
FT                   RGLAGASTAMIAERAGLPKANVHYYFPTKLALYRRVLDDLFEDWHRAAGSFEADDDPVE
FT                   AIGGYVRAKMTLSQRRPLGSKVWANEIIHGAEHMQDILSQRVKPWFDARVRVIEGWIAR
FT                   GLLAPIDPHALMYLIWATTQHYADFDAQIRALSGKRAFTKKAFDEKTEQVVQLVIRACG
FT                   AVSPNAKP"
FT   gene            409365..410645
FT                   /locus_tag="Bcen2424_6234"
FT   CDS_pept        409365..410645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6234"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: bcn:Bcen_1597 amidase,
FT                   hydantoinase/carbamoylase; TIGRFAM: amidase,
FT                   hydantoinase/carbamoylase family; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12966"
FT                   /protein_id="ABK12966.1"
FT                   /translation="MSAVSETVKRAAFDTSIRVDGKRLWDSLMEVAKIGATPKGGVCRL
FT                   ALTDLDKAGRDLIVGWAKAAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGG
FT                   RFDGIYGVLGGLEVIRSLNDHGIETEHPVEVVIWTNEEGSRFAPAMVASGVFAGVFPLE
FT                   YGLSRKDVDGKTIGEELARIGYAGDVPCGGRKLHAAFELHIEQGPILEAECKTIGVVTD
FT                   AQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPFGCATVGMMQ
FT                   VHPNSRNVIPGRVFFTVDFRHPDDAVLAKMDAALRDGVARIAADIGLETELEQIFYYKP
FT                   VAFDPECVAAVRGAADRFGYSHRDIVSGAGHDACYLAQVAPTSMVFVPCIDGISHNEIE
FT                   DATPAWIEAGANVLLHAMLSRACEPAS"
FT   gene            410773..412110
FT                   /locus_tag="Bcen2424_6235"
FT   CDS_pept        410773..412110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6235"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_1596 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12967"
FT                   /protein_id="ABK12967.1"
FT                   /translation="MTTQPTGDIAAHRLSSTQLSCEFADIAPLLDPTAAAAAASRCHYC
FT                   YDAPCVHACPTQIDIPSFIRKIGNGNLKGAATDILSANPLGGMCARVCPTEILCEGACV
FT                   RNHQDAQPVAIGALQRHATDWAMQTGAVQFRRAPETGRHVAVVGAGPAGLACAHRLALA
FT                   GHRVTLFDARPKAGGLNEYGIAAYKTVDDFAQREVEWLLSVGGITLETGVALGRDVTLD
FT                   TLREQHDAVFLAMGLGGVRALAIDGEQLRGVMNAVDFIEQVRQADTLANVPVGRRVVVI
FT                   GGGNTAIDAAVQSRKLGAERVTMVYRRGVDAMSATWAEREFAQKSGVTLVTNAKPVRIA
FT                   GTDGQVTGVEFEGASGERFTVDADMVLKAIGQTLVPDGVEAALLTADGTRIAVDADGRT
FT                   ALPDVWAGGDCAATGGIDLTVQAVQDGKRAAASIDATLAARDAKAA"
FT   gene            412166..413479
FT                   /locus_tag="Bcen2424_6236"
FT   CDS_pept        412166..413479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6236"
FT                   /product="dihydropyrimidine dehydrogenase (NADP+)"
FT                   /EC_number="1.3.1.2"
FT                   /note="KEGG: bcn:Bcen_1595 dihydroorotate dehydrogenase
FT                   family protein; TIGRFAM: dihydroorotate dehydrogenase
FT                   family protein; PFAM: dihydroorotate dehydrogenase; 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12968"
FT                   /protein_id="ABK12968.1"
FT                   /translation="MADLRCTIAGITSPNPFWLASAPPTDKAYNVNRAFEAGWGGVVWK
FT                   TLGLDPHVVNVSSRYGAVQWNGQRIAGLNNIELITDRPLDVNLREIAQVKRDWPDRALI
FT                   VSLMVPCNERDWKWILPLVEDTGADAVELNFGCPHGMSERGMGAAVGQVPEYVEMVTRW
FT                   VKEGTKLPCLVKLTPNISDIRMGSRAAYKGGADGVSLINTINSIVAVDLDQMAPMPTVD
FT                   GKGTHGGYCGPAVKPIALNMVAEIARDPETPNLPISGIGGISSWRDAAEFMVLGAGSVQ
FT                   VCTAAMHYGFRIVSDLADGLSNWMDEKGYATLDDIRGRAVPNVTDWKYLNLKYDIKARI
FT                   DQDRCIQCGLCHIACEDTSHQAITATKDGARHFEVVDSECVGCNLCMHVCPVEQCITME
FT                   RVDSGDYANWTTHPNNPASAEAGASGPAAAPEKHAKAA"
FT   gene            413580..415088
FT                   /locus_tag="Bcen2424_6237"
FT   CDS_pept        413580..415088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6237"
FT                   /product="NCS1 nucleoside transporter family"
FT                   /note="TIGRFAM: NCS1 nucleoside transporter family; PFAM:
FT                   permease for cytosine/purines, uracil, thiamine, allantoin;
FT                   KEGG: bcn:Bcen_1594 NCS1 nucleoside transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12969"
FT                   /protein_id="ABK12969.1"
FT                   /translation="MKPAAIPADPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWV
FT                   GMVMNIASYMLAAGLIQEGMSPWQAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVR
FT                   ASFGTQGAKLPALLRAIVACGWYGIQTWLGGSAIYTLLNILTGNALHGAALPVVGISFG
FT                   QLACFLVFWALQLYFIWHGTDSIRWLESWSAPIKVVMCVALVWWATSQAGGVGSMLSAP
FT                   SQFAAGGKKAGLFWATFWPGLTAMVGFWATLALNIPDFTRFAHSQRDQMIGQSIGLPLP
FT                   MALLSVVSVVVTSATVVIYGNAIWDPIDLTSRMTGIGVGIALVILTLDTMCCNLAANLV
FT                   GPAYDFSSLWPKAISYRAGGMITATIAIVMMPWKILATTDGYIFTWLVGYSALLGPVAG
FT                   ILMVDYFLIRGTQLDTRALFDERGDFSYARGWNPAALVALAVGVLPNLPGFLHTAFPAS
FT                   FPNVPAFFNTLYTYAWFVGLVLASGVYGTWMKWRAGQRAQIASA"
FT   gene            415157..416614
FT                   /locus_tag="Bcen2424_6238"
FT   CDS_pept        415157..416614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6238"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="TIGRFAM: dihydropyrimidinase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3; KEGG: bcn:Bcen_1593 D-hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12970"
FT                   /protein_id="ABK12970.1"
FT                   /translation="MAILIRGGTVVDADRSYRADVLCADPQDGGTILQIAEQIDAPAGA
FT                   TVVDAHDQYVMPGGIDPHTHMELPFMGTTASDDFYSGTAAGLSGGTTSIIDFVIPSPKQ
FT                   PLMDAFREWRGWAEKAASDYGFHVAVTWWDDSVHRDMGTLVREHGVSSFKHFMAYKNAI
FT                   MADDEVLVNSFTRSLELGALPTVHAENGELVFQLQKALLARGITGPEAHPLSRPPEVEG
FT                   EAANRAIRIAQVLGVPVYIVHVSAKDAVDVITRARSEGLRVFGEVLPGHLVIDEAVYRD
FT                   PDWTRAAAHVMSPPFRSAEHREALWRGLQSGQLHTTATDHCVFCASQKAMGREDFTKIP
FT                   NGCGGVEDRMSVLWHHGVNHGRITPNEFVRITSTNAAQIFNLYPRKGAVQVGADADLVV
FT                   WDPAATKTISVKTHHQQVDFNVFEGMTVQGVATHTLTRGALAWADGELRAVRGAGRYLK
FT                   RPPGAGYYEAARIANRLREPHPVERAG"
FT   gene            416863..418137
FT                   /locus_tag="Bcen2424_6239"
FT   CDS_pept        416863..418137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6239"
FT                   /product="Na+ dependent nucleoside transporter domain
FT                   protein"
FT                   /note="PFAM: Na+ dependent nucleoside transporter;
FT                   nucleoside recognition domain protein; Na+ dependent
FT                   nucleoside transporter domain protein; KEGG: bcn:Bcen_1592
FT                   Na+ dependent nucleoside transporter-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12971"
FT                   /protein_id="ABK12971.1"
FT                   /translation="MDILRSLLGMLFLLLVAYLLSNNRRAVSARTMIAALLTQFAIGAL
FT                   VLFVPSGRAALAGAANGVNRVLDMGNHGIAFVFGGLVDARMFQLFGDGGFVFGLRVLPM
FT                   IIFVTALISVLYYIGVMKWIVAILGAGLAKVLGVSRIEACSAVATIFLGQSEMPALVKP
FT                   FVRNMTSAEIFTVMASGMASVAGSVLVGYAGLGVKMEYLLAASFMAVPGGLLFGKLLFP
FT                   TVEPSRVVVDGLDFDDKRAANVIEAAASGASVGLRIAINVGAMLIAFVGLIALMNLIVG
FT                   GAAAFAGFPQVTLVGIIGHLFAPLAWIIGVPWHDATLAGNFIGEKLIFNEFVAYGDLSP
FT                   YLKGGAHAAAAGLQVLDPKTLAIVSFALCGFANFSSIAILAGGFSAVAPERRSDVARLG
FT                   LRALTAATLSNLMSAAIAGLFFSLH"
FT   sig_peptide     416863..416943
FT                   /locus_tag="Bcen2424_6239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.739 at
FT                   residue 27"
FT   gene            418173..419489
FT                   /locus_tag="Bcen2424_6240"
FT   CDS_pept        418173..419489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6240"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /note="KEGG: bcn:Bcen_1591 thymidine phosphorylase;
FT                   TIGRFAM: pyrimidine-nucleoside phosphorylase; thymidine
FT                   phosphorylase; PFAM: glycosyl transferase, family 3;
FT                   Pyrimidine nucleoside phosphorylase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12972"
FT                   /db_xref="GOA:A0KCQ9"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KCQ9"
FT                   /protein_id="ABK12972.1"
FT                   /translation="MFLPQEFIRRKRDGQPLDRDDMAAFVRGVTDGSVTEGQVAAFAMA
FT                   VYFNDLSTDERVALTLAQRDSGDVLDWRALDLGGPVIDKHSTGGVGDVVSLMLGPMVAA
FT                   CGGYVPMISGRGLGHTGGTLDKLSAIPGYDVMPDTDAFRRTVREVGVAIIGQTARLAPA
FT                   DKRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPTAEKSAELAR
FT                   SIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGKSRPARLHDVTMALSA
FT                   ELLVTGGLARDAAHAREKLQQALDSGAAAERFARMVAALGGPADLLDAPARHLARAAVI
FT                   VPVPAPVSGVVQRVDCRALGLAVVALGGGRTRAEDAIDVSVGLSALAEIGQRIEAGEPL
FT                   GFVHARDEAAAAHAVDAIRRGYVLGETGEAPPTLYQRVD"
FT   gene            419515..419904
FT                   /locus_tag="Bcen2424_6241"
FT   CDS_pept        419515..419904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6241"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="KEGG: bcn:Bcen_1590 cytidine deaminase,
FT                   homotetrameric; TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12973"
FT                   /protein_id="ABK12973.1"
FT                   /translation="MERDELIEQAKAARERAYAPYSRFKVGAALLARDGTVFHGCNVEN
FT                   ASYGLCNCAERTALFAAIAAGYRPGDFARLAVVGDTDGPIAPCGACRQVIIEIGKPDIE
FT                   VILTNLKGAVEITTARALLPGAFTL"
FT   gene            complement(419931..421046)
FT                   /locus_tag="Bcen2424_6242"
FT   CDS_pept        complement(419931..421046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6242"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bcn:Bcen_1589 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12974"
FT                   /protein_id="ABK12974.1"
FT                   /translation="MRAVPLPDSNTLEEPSTGAVVRDLRRVPIHPDHWYPLAWSRELKR
FT                   GKTLGVRFAGDPIVLVRTESGAVYALEDRCAHRQVPLHAGVVSGETLRCCYHGWTYACD
FT                   SGRCVDVPYLGRERLPNGVRAYPCREAHGLIFVFPGDATLAETRPFPALESADNPAYKT
FT                   RRFGREVKCHYSFMHENLMDMNHQFLHRKQMGQMRARSVGRRRGDDWVEVDYTFARMEG
FT                   KQPVGEALVFGASKKPADQSDKSVMTVRTGYPYQTLQIRSSEGTLVMDLWIVYVPLDAE
FT                   QRTNRTFGLLSIHKPGIPFALDLAWPLLVWFTERIFREDRWIVEREQEAHDAQGADWNH
FT                   EVFPVINELRDLLRQCGARTVIPIRDVRDSA"
FT   gene            complement(421282..422025)
FT                   /locus_tag="Bcen2424_6243"
FT   CDS_pept        complement(421282..422025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6243"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: bcn:Bcen_1588 peptide methionine sulfoxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12975"
FT                   /protein_id="ABK12975.1"
FT                   /translation="MIPIPTRDAAARRRAVMLRRIGAIAVAAAAVFGYQRIVNSAEPMR
FT                   TVPAATLDETPGASHDETAVLAGGCFWGVQGVFEHVKGVKQVTAGYAGGASETAHYALV
FT                   GSGLTGHAESVRIVYDPTQITYGRLLQVFFSVAHDPTQLNRQGPDEGSQYRSAIFPTTA
FT                   QQRAVATAYIAQLGSAHVFPAPVVTRVEAYKGFYPAEAYHQNYLELHPDAPYIAFNDLP
FT                   KVAGLKQYFPALYRTDPVLWREARS"
FT   gene            complement(422086..423945)
FT                   /locus_tag="Bcen2424_6244"
FT   CDS_pept        complement(422086..423945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6244"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; Redoxin domain protein; KEGG: bcn:Bcen_1587
FT                   cytochrome c biogenesis protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12976"
FT                   /protein_id="ABK12976.1"
FT                   /translation="MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLAG
FT                   MALTFAVVATLAAVGGGWVAQANQAGRWIAIVLLAVFGLTLLMPRFAEHLTRPLVAAGN
FT                   RLTGFAQRDGRAAGPASSLLLGVATGLLWAPCAGPILGLVLTGAALRGASVGTTLLLVA
FT                   YAAGAATSLGVALVIGGKVFAAMKRSLGAGEWIRRGIGAALLAGVGAIALGLDTGALAQ
FT                   LSTVTTGGLETKLVDRLGGRSNGAPAATAAPGATDNAAGGAMMAAAADGAQAGEGAMAG
FT                   SAMMRAVGATPSALPVEGTLPSLDGAVQWLNSPPLTAAGLRGKVVLVDFWTYSCINCLR
FT                   TLPYTTAWARKYAPYGLVVIGVHAPEFAFERDIGNVKKAVHDLGIDYPVAIDNGYSIWR
FT                   AFNNEYWPAHYFIDAQGRVRHHHFGEGEYVQSERAIQSLLAEAGHPDALNVPLGLAGAP
FT                   AKGALAAADSADVRSPETYVGYARAESFASPGGVVRDAAHRYDAPAQPDLNGWGLAGTW
FT                   SVGAERAALAAPDGRIVYRFHARDLHLVLGPGANGRPVRFRVTLDGTAPGAAHGADVDA
FT                   QGYGTVTGQRLYQLVRQPGAIADRTFAIEFLDPGVDAYAFTFG"
FT   gene            complement(423981..424511)
FT                   /locus_tag="Bcen2424_6245"
FT   CDS_pept        complement(423981..424511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6245"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: bcn:Bcen_1586 protein-methionine-S-oxide
FT                   reductase; TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12977"
FT                   /protein_id="ABK12977.1"
FT                   /translation="MPTRRHLLFAGATGLAALAALSSAGRRALVGRAFAAPPAGSSKAA
FT                   PFEITLSDAEWHRRLTPAQYTVLREAGTERPFTSPLNDEHRHGTFACAGCDLALFSSAT
FT                   KFDSHTGWPSFWKPLDHAVGTDTDASFGMVRTEVHCRRCGGHLGHVFDDGPAPTGLRYC
FT                   MNGLALAFHPAVA"
FT   sig_peptide     complement(424404..424511)
FT                   /locus_tag="Bcen2424_6245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.376 at
FT                   residue 36"
FT   gene            complement(424719..425651)
FT                   /locus_tag="Bcen2424_6246"
FT   CDS_pept        complement(424719..425651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6246"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1585 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12978"
FT                   /protein_id="ABK12978.1"
FT                   /translation="MLDDMMRVTHQSRNVDFFSFTVFLAVAARRSFRGAATELEITPSA
FT                   VSHSVKALERRLGVRLLNRTTRSTSLTEAGERLAAKLRPAVSIIDEAMREVDDLRSAPS
FT                   GTVRINASEGAIRLILRPVLARFLKSYPEVHLDIVSDGRLTDIVAAGFDAGIRLAEAVP
FT                   QDMVAIPLMGNVRFAAVASPAYFAAHGRPATPHDLYRHDCIRFRFESGSIYQWEFERRG
FT                   VSETIDVSGSLTLTDQPLMVDAAMDGIGIAFVPDHLVIEPLRDGRLERVLDDWCAPFPG
FT                   LCLYYPGHRHVSQALRALIAFIKSEQPRS"
FT   gene            425720..426496
FT                   /locus_tag="Bcen2424_6247"
FT   CDS_pept        425720..426496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6247"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcn:Bcen_1584 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12979"
FT                   /protein_id="ABK12979.1"
FT                   /translation="MSRKILITGASSGFGRGAAIELARLGHQVVATAETWPQVRGLRAD
FT                   AAEAGVVLEVIKLNLLDAIDIAHAGSFDPDVLVLNAGVMEGGSIVDIPMQRVRESFEIN
FT                   VFGHLQLVQAIVPKMVGRRSGKVVWTSSMGGILVVPFVGAYCATKHAIEAIAGSMKAEL
FT                   EPLGVKVATVNPGVFGTGFNDTGAESYVQWYDADSAVVPMPDFGDSLMNQADPKEMIDA
FT                   MVEIIPADTHLYRTMRPFATIDAAKQWQETEWTQNA"
FT   sig_peptide     425720..425779
FT                   /locus_tag="Bcen2424_6247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.378 at
FT                   residue 20"
FT   gene            426489..426887
FT                   /locus_tag="Bcen2424_6248"
FT   CDS_pept        426489..426887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6248"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   bcn:Bcen_1583 protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12980"
FT                   /protein_id="ABK12980.1"
FT                   /translation="MPELTLERADRIVARGRAAARDAGLDAVFAILDTGAHLVAFSRMD
FT                   GAWLASNELAIAKARTSVMFRMPSEALDVPLQVGQPYPRFDHIHAGGLLLMGGGVPLFN
FT                   GDGQLIGALGVSGGTPEQDAVLARAAIA"
FT   gene            complement(427031..427309)
FT                   /locus_tag="Bcen2424_6249"
FT   CDS_pept        complement(427031..427309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12981"
FT                   /protein_id="ABK12981.1"
FT                   /translation="MLSPHEFATLMLVCQAPDQLDMNRAELDALLERQLVMLEHGAPGR
FT                   RRAHLTKKGRSILHALGADIASHRRHGSTAERGSQCAAPVALSDEAG"
FT   gene            428071..428388
FT                   /locus_tag="Bcen2424_6250"
FT   CDS_pept        428071..428388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6250"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: bcn:Bcen_1581
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12982"
FT                   /protein_id="ABK12982.1"
FT                   /translation="MQIRPLYDRVIVKRIEQQRTTASGIVIPDSAAERPEQGEVIAVGS
FT                   GRLLQDGSQRPLQLQVGDQVLFGKYAGQTVKANGEELLVMREEDVMGVLEPESPAARKA
FT                   A"
FT   gene            428469..430091
FT                   /locus_tag="Bcen2424_6251"
FT   CDS_pept        428469..430091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6251"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: bcn:Bcen_1580 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12983"
FT                   /db_xref="GOA:A0KCS0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KCS0"
FT                   /protein_id="ABK12983.1"
FT                   /translation="MTAKDVKFRDGARQQIVKGVNVLADAVKVTLGPKGRNVVIERGFG
FT                   APVITKDGVSVAKEIELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGM
FT                   KHVAAGMNPMDLKRGIDKAVGAVLDELRKLSRPISTHKEIAQVGAISANSDEAIGKIIA
FT                   DAMEKVGKDGVITVEDGKSLENELDVVEGMQFDRGYVSPYFINDPAKQAAYLDDALILL
FT                   HDKKISSVRDLLPILEAASKAGKPLLIVAEDVEAEALATLVVNSMRGILKVAAVKAPGF
FT                   GDRRKAMLEDLAILTGATVISEETGKQLDKATLEDLGSAKRVEVRKDDTIIIDGAGDAA
FT                   RIEARVKSIRVQIDEATSDYDREKLQERVAKLAGGVAVIKVGAVTEVEMKEKKDRVDDA
FT                   LHATRAAVEEGIVPGGGVALLRARAALSDIRGANADQDAGIRIVLRALEAPLRVIAANA
FT                   GDEPSVVISKVLEGKGNFGYNAATGEYGDLVDAGVVDPTKVTRTALQNAASIASLVLTT
FT                   DATVAQAPKEESAESAPAPELGY"
FT   gene            430190..430495
FT                   /locus_tag="Bcen2424_6252"
FT   CDS_pept        430190..430495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12984"
FT                   /protein_id="ABK12984.1"
FT                   /translation="MFARPTMKLELSIDSRPLHVELDDVIAGLLAARLGLPPDGDHRGA
FT                   IGRYLGDAAGPWTLDDDHMRKRVMRRLILDIADPTLVIQYLMADQTDPAGPGEAGA"
FT   gene            complement(430695..431609)
FT                   /locus_tag="Bcen2424_6253"
FT   CDS_pept        complement(430695..431609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6253"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: manganese containing catalase; KEGG:
FT                   bcn:Bcen_1578 catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12985"
FT                   /protein_id="ABK12985.1"
FT                   /translation="MFIHNTRLQYTVRVGAPNPGLANLLLEQFGGPQGELAAAMRYFTQ
FT                   AITEEDPGRKDMLLDIATEELSHLEVIGSMAAMLNRGAKGELAEAVDEQAELYRKLHGA
FT                   GNDSHVTQVLYGAGAPLTNSGGVPWSAAYIDTIGEPTADLRSNIAAEARAKIIYERLIN
FT                   VSDDPDIRDALGFLMTREVSHQMSFEKALYAITANFPPGKLPPKTPYDHVYFRMQPDAA
FT                   PLVGPWNHGGELEIRPAEPAVDGGTGIPEGMLDAQQADAIEAMAQRLASDPNSDPVTGA
FT                   ELGAGPPAPQGRKPGKPDKPDGA"
FT   gene            431795..432019
FT                   /locus_tag="Bcen2424_6254"
FT   CDS_pept        431795..432019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6254"
FT                   /product="manganese/iron transporter, NRAMP family"
FT                   /note="KEGG: bcn:Bcen_1577 manganese/iron transporter,
FT                   NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12986"
FT                   /protein_id="ABK12986.1"
FT                   /translation="MRPDFQAVAFVGTMAGQMIRWGFMGCRSLAWAHGLVTMTLAFVVV
FT                   GLGGDSIQARVIDQGVLSIVLPVSMLAPS"
FT   gene            complement(432161..432442)
FT                   /locus_tag="Bcen2424_6255"
FT   CDS_pept        complement(432161..432442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12987"
FT                   /protein_id="ABK12987.1"
FT                   /translation="MTPFSQDVSIKQTAAVSKAATPSPVFWKAGPLVEAAPPEPKSTTP
FT                   DLRDFFAAAALQGLLSRDAGRNVSTIADYESKRAISAYRLADEMLKAR"
FT   gene            432769..433254
FT                   /locus_tag="Bcen2424_6256"
FT   CDS_pept        432769..433254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12988"
FT                   /protein_id="ABK12988.1"
FT                   /translation="MSRALHRTRIASLQSGALARLPASYTVYGSTGGSIASGIVGRPDE
FT                   RDDPLSLGVRYTMSHNTLRREVNGTASAYAQGAASIARDVEEPSVVSGSGHWCVGGRYD
FT                   GVADLFESAPTNMDMAFVVVHLAPKQVSHMDAVLQRTTGMPVHQVTSTVSIEKNTST"
FT   gene            complement(433544..434836)
FT                   /locus_tag="Bcen2424_6257"
FT   CDS_pept        complement(433544..434836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6257"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein; KEGG: bcn:Bcen_1574 natural resistance-associated
FT                   macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12989"
FT                   /protein_id="ABK12989.1"
FT                   /translation="MNDNDFLQPEPTEPAPNAVTWVRRLGPGLITGAADDDPSGIGTYS
FT                   QAGAQFGFELLWSLLLTYPLMTAIQLVSARIGRVTGKGLASNMRKHYPPWLLYGTVVLL
FT                   ITANVINIAADLSAMGAAVNLLLPGPQQLYIVCLGGVSVALQVFVPYDRYSRLLKWTAL
FT                   TLLAYVAVALIVPVSWGEVGRAIVQPHAQLSAAYLTTLVAVLGTTISPYLFFWQASQEV
FT                   EELRAVPDARPLRRMPRQAPAQLRRISFDTWFGMGVSNVIAFFIVLTAAATLNAHHIDV
FT                   KTSADAARALEPLAGHFAYVLFALGIVGTGLLALPVLAGSAAYAAAGTFRWRNSLALQW
FT                   GVAPEFYAVIVLAIVGGIAFTFMHFDPIRALYWSAVINGVSAVPIMVVMMLMARSKRVM
FT                   GEFAVRGALAWGGWIATLAMAIAAMGVFVPG"
FT   gene            complement(434919..435434)
FT                   /locus_tag="Bcen2424_6258"
FT   CDS_pept        complement(434919..435434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12990"
FT                   /protein_id="ABK12990.1"
FT                   /translation="MQERMRLIGFVLGAAIACAGCKSVNVSRYEIQHRDRNGLTIVAYT
FT                   TEDLASLDKTPWADHVYLRYAVTPVTILERFDVGATDLDDYPFSARRIDIHAHCPVPTS
FT                   DFCSSWFIPFHDRVGLHGLDYVSGLDASEPARLKLRIGGASMAGTRLVSKEHAINVDAG
FT                   DVAKPGGP"
FT   gene            complement(435496..436098)
FT                   /locus_tag="Bcen2424_6259"
FT   CDS_pept        complement(435496..436098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6259"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_1572
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12991"
FT                   /protein_id="ABK12991.1"
FT                   /translation="MRANKRQLVVDKATELFSRHGFHPVGVDWIIDDSGVARMTLYRHF
FT                   ASKDELIREVLVQRYDLIVGSIDAQLQHVVDPVERVKTIFDWYEAWFRTPEFAGCLFER
FT                   ALAEFGTAYAPISDVAIRYRRKMVEWIAELIEALVPPETANRLATVFMMLLDGATVDAR
FT                   AFNDSAAAARAWQAAHALLEQAMHATVSPADGAANPT"
FT   gene            436522..437109
FT                   /locus_tag="Bcen2424_6260"
FT   CDS_pept        436522..437109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6260"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bcn:Bcen_1571 Sel1-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12992"
FT                   /protein_id="ABK12992.1"
FT                   /translation="MYRRLLVPGLLLLLAACAQDPSVTASTVRICDDTGCSDRPKDQVS
FT                   YQKRDDAEERDDPRIAALKQTAKTQPKAAYDLGLRYFRGDGVRQDSYQALKWMREAAER
FT                   GDLNAQKALGSFYLFGLEEMGSDAREAEKWLSIAAARGDKESKKLLDLARKAKKEDEED
FT                   WKWRTQWRDTYYGYWYSGYPYYGVWQQTYWYY"
FT   sig_peptide     436522..436578
FT                   /locus_tag="Bcen2424_6260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.949 at
FT                   residue 19"
FT   gene            437231..438058
FT                   /locus_tag="Bcen2424_6261"
FT   CDS_pept        437231..438058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_4796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12993"
FT                   /protein_id="ABK12993.1"
FT                   /translation="MKTNLSQRLTQGALVAALGASVAGCGGVVTPGGQNAGVTGAAAGG
FT                   ASAGADSQLQRCTSPLGTIAVDDGRNADWWGQFGSATKVTSIDPLLRLAVQQSNCFVIT
FT                   SIGNQKSDARLSRITQLQRNSGEYRAGSKQQKGQRVAADYYMEPQIVINDSPIGGIGSM
FT                   IGGLIGNSAVAAVAGHLQTKASVVTLTLFDVRSAVQIAASEGSSTATNYGAALGGFGGG
FT                   VGGALAGFSSTPEGKATVVAFIDAYNKMVVALRSYKAQDVKGGLGRGGQLQVN"
FT   sig_peptide     437231..437341
FT                   /locus_tag="Bcen2424_6261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.586 at
FT                   residue 37"
FT   gene            438428..439006
FT                   /locus_tag="Bcen2424_6262"
FT   CDS_pept        438428..439006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12994"
FT                   /protein_id="ABK12994.1"
FT                   /translation="MQLHMYTQATSQSASVDNGVYTRTYAPATFDGVALTQQAETTTGS
FT                   PIQTNHYYLVGNGVRTYYGSEVYSGGTLALRDVNSPPYVETIGLAGSETVNYVDTPVVP
FT                   SGGAQTSVSIQRTYVARETVSLRNGKVYANACHYQTTETTANQAVTTKTSADDWLAPGV
FT                   GLVKSVANVGGTQIITRELEAATVGGKSY"
FT   gene            complement(439142..440086)
FT                   /locus_tag="Bcen2424_6263"
FT   CDS_pept        complement(439142..440086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6263"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1567 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12995"
FT                   /protein_id="ABK12995.1"
FT                   /translation="MDYAAWKLFIDAAELGSLSKTAIAYGTSQPHISRQIVELEQYCGG
FT                   RLFQRTGRGVVLTELGARIAPRVRTWLASTEQLSNDIRSAAGEPIGVVRLGILPSTAHP
FT                   LVSTLYHRLRERYPLVQLQVREGQGALLETWLENGSVDLAILFRNSPTPRNGDEYLVEA
FT                   ATYLVGAEGDPLTSQPTIAFSRLDGIPLVSFCRPNSWRERLEQIAGEHQVSLNFAAEAD
FT                   SLSLQGHIVADGGIHALLGPYAIANLERECRLQASMVVDPSVPRFIALAMSPHGELTLA
FT                   CRTVMQLTKEIARSRNLSSDLRLGVSAAFLRSI"
FT   gene            440268..441191
FT                   /locus_tag="Bcen2424_6264"
FT   CDS_pept        440268..441191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6264"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bcn:Bcen_1566 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12996"
FT                   /protein_id="ABK12996.1"
FT                   /translation="MKAIDLRGLVPAPVTPFTREGAVDHAAIQRLGAWLGGIEGVKGLT
FT                   VLGHAGEGTFLSQKEQAQVIESFVKSVDGKIPVIAGITLEGTEVAVEEAKRAVEAGASA
FT                   GLVYPSHGWLRFGYQKGAPQDRYRAIHEGSGLPLILFQYPDATKATYNLETQLEIAAQP
FT                   GVFAMKNGVRNMRRWDVEIPIIRRERPELQILTCHDEYLLHTMFDVDGALVGYGGLAPE
FT                   PLIELIKAGKAKDYPAARAIHDRLLPVTRNVYHRGSHMEGTVALKHGLVARGILEHATV
FT                   RSPLLPLAQGADVEIADALRSAGLVD"
FT   gene            441425..442867
FT                   /locus_tag="Bcen2424_6265"
FT   CDS_pept        441425..442867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6265"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_1565 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12997"
FT                   /protein_id="ABK12997.1"
FT                   /translation="MNTPSTACGVDLGRSASETRPMSEQLRAANLLFRIENVPFCKWHT
FT                   QARIVMGSATLFDAFDALSLAFVLPVLVGLWHLSAGQIGVLIAAGYLGQVVGALVFGWL
FT                   AERLGRVPSATVAVGVMSAMSVVCAFTGSFHMLFLMRFLQGIGVGGEVPVAATYINELS
FT                   QAHGRGRFFILYELIFPLGLLAAAQLGAFVVPRFGWETMFLIGGIPGMVVAILIARLPE
FT                   SPRWLVARGRFDKAERIIERLEASTTKRNLDIQVQRAEVDARVASLLVGRQSKRKGTWK
FT                   ELFSPFYRGRTVVVWLLWASAYFVANGINNWLPSLYRTVYHLPLQTSLQMASISNVLST
FT                   CGVLACALLIDRVGRRRWAMACFIISAALLAVLGIHGAGSAWSVMLLGSSAYAVMATTT
FT                   VLLYLYTPEIYPTRMRAIGTGLATSWLRAASAAAPAIVGVVLTGKGIAAVFVMFAAVSA
FT                   VGFFVAARMVETTNRSLEEISP"
FT   gene            443054..444127
FT                   /locus_tag="Bcen2424_6266"
FT   CDS_pept        443054..444127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6266"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_1564
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12998"
FT                   /protein_id="ABK12998.1"
FT                   /translation="MKKTRQVVVRVAARRVVGTVGVTAIFSAGLVLHSVGAYADSGSQV
FT                   QLYGLLGTYVGSIKRSDTPQAAVQMGSGGLTTSFWGIRGKEDLGGGVGAIFVLESFFQP
FT                   ANGALGRSAADPFWSRNAYVGFQGDFGQVTFGRQRNPAYTAESLVNPFGSSTVFSPLVL
FT                   QTFVTNYGGTIIGDTVWNNTVKYTTPDFKGFAATVIYGLGGVAGSPGVGNLGVHLNYRG
FT                   HGLTAVLSGQRVRYTAAGPVGAQYAYLAGAAYDFKLVTLYGAWAMTSDASTPTGSHTYE
FT                   AGLSIPLSPADFLLAEWARTKRSGATRAASGLRNTASVGYNHLLSKRTDLYAIYAYDKL
FT                   SAHPIGNSFAVGIRHTF"
FT   sig_peptide     443054..443173
FT                   /locus_tag="Bcen2424_6266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.956 at
FT                   residue 40"
FT   gene            444362..446443
FT                   /locus_tag="Bcen2424_6267"
FT   CDS_pept        444362..446443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6267"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; MHYT domain
FT                   protein; KEGG: rso:RSc0510 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK12999"
FT                   /protein_id="ABK12999.1"
FT                   /translation="MLPTSYNALLVLLSLLIAILASYTVLDMAGRIKSAQGHAARWWLV
FT                   GGACVMGTGIWSMHFVGMLAFALPIPLGYDPAITLLSLLIAIVCSTCALWLVCRDTLKW
FT                   RRLCGGAMLMGAGVAGMHYTGMASMRMSPGIQYDPLLVCLSVAIAVVASGAVLWIVFIR
FT                   RANSSRVRLLNLGSAVLMGAAIAGMHYTGMAAARFPLGSLCGAAGSRMDAGWLALVIIV
FT                   ATLAILAIALIVSILDLRLEARTAVLATSLAEANQELTYLALHDNLTKLPNRVLLEDRI
FT                   DQAIQAADREHGSFALMFMDLDGFKAVNDAYGHHVGDLLLVDVARRIGANLRSQDTIAR
FT                   LGGDEFVLAVAVDEPADAADVADKILAVIRKPFRVSEHELRVSASIGIALYPGNGSDFR
FT                   DLMTNADAAMYHAKALGRNAYCFFEASMNANVREHLKIVQELRLALERRELVLHYQPKF
FT                   DVPHGPIIGVEALLRWMHPTRGLISPDQFISIAEKTGLIVPIGEWVLDEACRQMRVWCD
FT                   AGRTDWTMAVNLSPLQFGHASLIRVVEATLQRHALEPHCLTLEITESTAMRDADASLRI
FT                   LQQLHDMGVRISIDDFGTGYSSLLYLKRLPASELKIDRGFIRDLEHDTEDAAIISAIVA
FT                   LGRALDLKIVAEGVETAAQQQFLTRLGCNSLQGFLLGRPMPADHFVEMTTQGTAIKPV"
FT   sig_peptide     444362..444442
FT                   /locus_tag="Bcen2424_6267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.268 at
FT                   residue 27"
FT   gene            446614..447333
FT                   /locus_tag="Bcen2424_6268"
FT   CDS_pept        446614..447333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6268"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcn:Bcen_1561 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13000"
FT                   /protein_id="ABK13000.1"
FT                   /translation="MDQPKRILIVEDDADIADVLSLHLRDERYEVVHSADGAEGLRLLE
FT                   QGNWDALILDLMLPGVDGLEICRRARAMTRYTPIIITSARSSEVHRILGLELGADDYLA
FT                   KPFSVLELVARVKALLRRVDALARDSRIDAGTLDVAGLAIDPIAREASVDGARLDLTPR
FT                   EFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAEPVRIL
FT                   TVWGRGYKLAAPGQRDA"
FT   gene            447333..448847
FT                   /locus_tag="Bcen2424_6269"
FT   CDS_pept        447333..448847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6269"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: bcn:Bcen_1560 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13001"
FT                   /protein_id="ABK13001.1"
FT                   /translation="MKLTLTRRLSLVFSILLIACSGASAWLQIRANDMREKEVVQALSR
FT                   DLATNIANSAPLMDANGLRPDAVRTLFGQLMGVNPSVEVYLLDNAGRIKGDDAPPGHVK
FT                   RDRVDLAPVQRFIAGQPLPILGDDPRSPDARKVFSAAPLQRAGQPPSGYIYVVLLGEAH
FT                   DRLAARVDAGNVLRTTLWSMAIVALLGLLAGLVAFSFITRPLRRLTAAMRAFDANGAPG
FT                   APGTPDTQPPPVLRLPPGQRGDDIAVLESAFAQMADRIGDQWRALTRQDQQRRELITNI
FT                   SHDLRTPLTSLHGYLETLSLKADTLAEPERRRYLSIALAQSAKVGRLAQALFELARLES
FT                   GGVQAEREPFSLVDLVQDVFQKFELAAQSRGVALHARIPPRVPVVSADLGMIERVLTNL
FT                   LDNALRHTPSHGEVEIALEPRGERVIVTVSDTGEGIPAARREGLFQRPQRPMGGGTVTS
FT                   GGLGLLIVHRMLALNGSGIRLVDRPGRGAVFEFALPVASPAAGDAR"
FT   sig_peptide     447333..447410
FT                   /locus_tag="Bcen2424_6269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.925 at
FT                   residue 26"
FT   gene            complement(448863..449972)
FT                   /locus_tag="Bcen2424_6270"
FT   CDS_pept        complement(448863..449972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6270"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1559 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13002"
FT                   /protein_id="ABK13002.1"
FT                   /translation="MPRSALLKPTDARPGRPARLPDAAPAHALREQRFTPAKLAVLVDV
FT                   AAQAGLDPATVLAGTGLAPADVADPFALTSPLQFLTAARNAVGRYDGTDLGVRVGRRLH
FT                   ASSYGMYGYAMLCSESLAHAFDSAVKYHRLANGMLPIRWVEQGDTASWLFPDRHEVALP
FT                   DLDAPLYRFLIDMQFALHVTIIKDVMGGWCVPARAQFAQPRPPHGALLADALECPIAFD
FT                   QPHHVLSYPAAWLTRAPQLANPITAAQVSSHCAQLLDELRSQSGITRRVYEELTRTPGQ
FT                   FPDIDAIAEILCMTSRTLRRKLEAEGTSYSELLTSVRKALAIDYLSTTTLSTEDIALTL
FT                   GFSDAVGFRHAFKRWTGTTPSDVRRKRGG"
FT   gene            complement(450157..450948)
FT                   /locus_tag="Bcen2424_6271"
FT   CDS_pept        complement(450157..450948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6271"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   KEGG: bcn:Bcen_1558 HAD-superfamily hydrolase subfamily
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13003"
FT                   /protein_id="ABK13003.1"
FT                   /translation="MQPLALAPADTFSSVRFLLTDMDETLTHRGRLAAQTYAALERLQT
FT                   RGIRVIPVTAAPAGWCDQMARMWPVDGVIAENGGLFIRRGPDGHGAERRYWHADDALDG
FT                   ARDALRRIAQHVGKAVPAARHADDQDFRLTSLAYARSGGDQDQRILDALIEAGADATIN
FT                   NLWVIGWVGGYDKLSMSLRVLADTFGVDAGAAAGCVAYSGDSTNDAPMFGYFAHTAGMS
FT                   TVVEYLPQLPALPRWITQGPGGSGFVEFADAILRAQPGDRG"
FT   gene            451250..452884
FT                   /locus_tag="Bcen2424_6272"
FT   CDS_pept        451250..452884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6272"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_1557 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13004"
FT                   /protein_id="ABK13004.1"
FT                   /translation="MTKRHWTGSYGSIPAEIDADRHPSVSALLDDAMRRFADRPAFHAF
FT                   GRTLTYADVERLSTALAAYLQQVVGVRKGDRVAVMLPNVLAFPVVFVAVAKIGAIQVNV
FT                   NPHYTARELEHQLNDAGVEVAVVCGGSMGTFADVVGGTRVRTVLSVGREDLGVVDAPAG
FT                   TCDALPPGSTALAQAIAAGESLACEPVALSGADLLLLQYTGGTTGLSKGAALSHRNLVA
FT                   NIAQFAAIVPDARRPGEEVVVTAIPLYHIFALTVNFLSYFAIGAQNWLVANPRDMDGFI
FT                   DVLKAARPTVFVGVNTLYAGLAGHPRLKEVDWSRLKLSAGGGAAVIDVISSRWKAVTGN
FT                   FIREGYGLSETSPVVSFNPQSIDRFTGTTGLPLPSTDVKLLDEQDREVAIGEAGEICVK
FT                   GPQVMSGYWQKPDANAAAFTADGYFRTGDVGVFDAAGFLRIVDRKKDMIIVSGFNVYPN
FT                   EVEAVATALPGVAECACIGVPDPRTGEAVKLFVVLAPDADVTEAQLVAHCRASLAAYKV
FT                   PKLVRFVDRLPKSTVGKILRRELSRTD"
FT   gene            452998..454044
FT                   /locus_tag="Bcen2424_6273"
FT   CDS_pept        452998..454044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6273"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1556 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13005"
FT                   /protein_id="ABK13005.1"
FT                   /translation="MTGSDSLSARPGRALPSPSATVPISLVNGFLASAGVQRDVVERYL
FT                   RGAGIPIELLGEPHARVTEEQFSTLYRTLAIDLDDEMPGIFSRPLRGGTLKYLCLSLLD
FT                   ARNLETALHRFGQFFHILLDDFFVESKRDDLVAQVLLRPNDAIGPIGALGQELMLKLVH
FT                   GVCSWLIGQKIPLLQIEFACPRPRHAVDHLYFFTGAVQFDCARTLMRFSADYLDAPIRQ
FT                   SKRNLSKFLARAPGDWIFESFSEQLVCHRVRQYLSAALPDLPVIDQAAEHLHCSVRTLS
FT                   RHLAAEGTTFQVLKDELRRDIAIQRLTDTPDTIAAIGADIGFDDPSAFHRAFRHWTGST
FT                   PGTYRRRA"
FT   gene            454448..456238
FT                   /locus_tag="Bcen2424_6274"
FT   CDS_pept        454448..456238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6274"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bcn:Bcen_1555 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13006"
FT                   /protein_id="ABK13006.1"
FT                   /translation="MSYNAPVKDMLFVLKELAGIDAVAQLPGFEDAGYDTAQAVLDESA
FT                   KFCGEVLAPLNVEGDRNPSSWKDGVVTATPGFGEAFRQFVEGGWQGLQHPAEYDGQGLP
FT                   KLIATPCIEMLNASNLSFALCPLLTDGAIEALLTAGTDEQKQRYVPKLISGEWTGTMNL
FT                   TEPQAGSDLALVRSRAEPQGDGTYKVFGTKIFITWGEHDMADNIVHLVLARTPNAPEGV
FT                   KGISLFIVPKFMVNDDGSLGARNDVHCVSIEHKLGIKASPTAVLQYGDHGGAIGYLVGE
FT                   ENRGLEYMFIMMNAARFGVGMQGIGVADRAYQKAAEFAKERVQSRPVDGSAKQSVTIIH
FT                   HPDVRRMLGTMRALTEGARALAYVAAAHSDIAHRHPDEATRARHQAIYEYLVPVVKGWS
FT                   TEMVNDVASLGVQVHGGMGFIEETGAAQYYRDARILAIYEGTTAIQANDLVGRKTLRDG
FT                   GAVAKALIAEIGETVAALGKLDGAAAASMKAHLEKGARSLSSVVDYVLANAKQDPNAVF
FT                   AGSVPYLKLAGVVLCGWQMARALLAAHANRASDVAFFDAKIAIAQCYAEHVLVQAGALE
FT                   ASIVGAKGNESVLALTEDQF"
FT   gene            456275..457948
FT                   /locus_tag="Bcen2424_6275"
FT   CDS_pept        456275..457948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6275"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   bcn:Bcen_1554 electron-transferring-flavoprotein
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13007"
FT                   /protein_id="ABK13007.1"
FT                   /translation="MTTQDLLAQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGT
FT                   EIGVCVLEKGSEIGAHILSGAVMDPRAITELFPDWKERGAPLDVEVTEDRFLFLSEKSA
FT                   VTTPNWALPDNFKNHGNYVISLGNVTRWLGAQAEALGVEIFPGFPAAEILYNDDGSVKG
FT                   VATGNMGVGKDGEPTENFQLGMELHAKYTLFAEGCRGHLGRQLISKFKLDANADPQAYG
FT                   IGIKELWEIDPAKHKPGLVIHTAGWPLKSDTYGGSFLYHMDNNQVVVGFVVGLGYTNPY
FT                   LSPFEEFQRYKTHPSIRAFLEGGKRVSYGARAITAGGLLSLPKTVFPGGALIGDDAGFL
FT                   NASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQSWLYTELYRARNFKQ
FT                   WMAKGLYLGTLMVGLEQKVMGGNVPWTLHHQHADHEMLKPAAQCEPIAYPKPDGKLTFD
FT                   RLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPAAVYEFVKNDDGGE
FT                   RLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM"
FT   gene            457996..459189
FT                   /locus_tag="Bcen2424_6276"
FT   CDS_pept        457996..459189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6276"
FT                   /product="3-ketoacyl-CoA thiolase / acetyl-CoA
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: bcn:Bcen_1553 acetyl-CoA C-acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13008"
FT                   /protein_id="ABK13008.1"
FT                   /translation="MSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTDLGAKVVAEVLSRA
FT                   NVPGDAVGHVVFGHVVNTEPKDMYLARVAAINGGVAQHTPALTVNRLCGSGLQAIVSAA
FT                   QTIMLGDADVAIGGGSESMSRAPYTVPAARFGQRMGDGKLVDMMLGALHDPFQTIHMGV
FT                   TAENVAKKYDISRDAQDALALESHRRAARAIAEGRFKDQILPISIRTKKGEVAFDTDEH
FT                   VRHDASADDFTKLKPVFAKENGTVTAGNASGINDAAAAVLMMSADAARAQGVKPLARLV
FT                   AYAHAGVDPAYMGIGPVPATQKALERAGLKISDLDVIEANEAFAAQACAVTQELGLDPA
FT                   KVNPNGSGISLGHPIGATGALITVKALYELKRIGGRYALVTMCIGGGQGIAAIFENI"
FT   gene            459228..460082
FT                   /locus_tag="Bcen2424_6277"
FT   CDS_pept        459228..460082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6277"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   KEGG: bcn:Bcen_1552 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13009"
FT                   /protein_id="ABK13009.1"
FT                   /translation="MAIETVGVVGAGTMGNGIAQTAAVAGLNVVMIDVSDAALDKGLAT
FT                   LKGSLERLVSKDKLAADARDAALARITTSTDYAKLAAVDIVIEAATENVELKGRILKQI
FT                   EAVARPDAIIATNTSSISITALAAPLADPSRFLGMHFFNPVPLMPLVEIIRGLQTSDAT
FT                   ASAVRALTERFDKSPIGVRNSPGFVVNRILVPMINEAFFVLAEGIASAEEIDAGMKLGA
FT                   NHPIGPLALADLVGLDVCLAVMDVFVKDFGDPKYRACPLLREMVSAGRLGRKTGRGVYD
FT                   YSK"
FT   gene            complement(460140..460805)
FT                   /locus_tag="Bcen2424_6278"
FT   CDS_pept        complement(460140..460805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6278"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_1551
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13010"
FT                   /protein_id="ABK13010.1"
FT                   /translation="MGRQKSGQNDEPDAAAADAPARARLVPTQQRSRERFERILACASD
FT                   VMIEKGCDAFRMSDIVERTGISFGSLYQYFPDKAAVIGTLAERYNAVGHDCVRRDLAGM
FT                   KTIDDLHATLARITDSYYRMFVDEPLVRDIWRATQADRALQALDRADGEFLAGLFADAL
FT                   AEVAPDTTRAQRSAFAELMMIQIAAAVRHAITLPPKAARQLLTMFKRMLPRDLSVLDA"
FT   gene            460875..461699
FT                   /locus_tag="Bcen2424_6279"
FT   CDS_pept        460875..461699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6279"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: bcn:Bcen_1550
FT                   NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13011"
FT                   /protein_id="ABK13011.1"
FT                   /translation="MSALPILIVGGSGKTGARVDARLRARGLATRPVSRTSAVRFDWTA
FT                   PETWPAALDGVSAAYVTYQPDLAVEGAVEAIAGFARLARGSGVERVVLLSGRGEPRAQA
FT                   AEAALQASGVGWGVVRASWFNQNFSEGYLLDGVLAGEVALPAGAVREPFVDADDIADVA
FT                   AAALTDARFASRVIEVTGPRALTFAEAVGEIARAAGRPIAYREIPHDAFVAGLSEVGVP
FT                   EPVVALLDDLFDGVLDGRNSAVTHGVEATLGRPARDFADYARAVAATGVWSA"
FT   gene            461702..462187
FT                   /locus_tag="Bcen2424_6280"
FT   CDS_pept        461702..462187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6280"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: bcn:Bcen_1549 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13012"
FT                   /protein_id="ABK13012.1"
FT                   /translation="MIAFVTSALLWGSAIGCGLMAGVYFAFSTFVMTSLGRLAPQAGAA
FT                   AMNAINVDIVRSPFMPLFLGTTLMALALVVIALFDRDSPGAMAALAGGVLYVFGMFAVT
FT                   MAVNVPLNDALAAADPATAQGAALWTRYLHDWTRWNHVRTVASAAACACFIAAIAAR"
FT   sig_peptide     461702..461782
FT                   /locus_tag="Bcen2424_6280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.616 at
FT                   residue 27"
FT   gene            complement(462208..463008)
FT                   /locus_tag="Bcen2424_6281"
FT   CDS_pept        complement(462208..463008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6281"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1548 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13013"
FT                   /protein_id="ABK13013.1"
FT                   /translation="MSRLVANRTRESTPPFAHLRYESTPMPVSAMAATYVHGTSIAPHR
FT                   HRRAQLLYAIEGVMHVESEGASWIVPPTRGVWLEAGLDHTVQMSGDVQMRTVFVEPGAV
FT                   EHLPSRSCVVEVHPLLRELILAAVDVPLDYAPGSRHDHLMRLLLAEVTVAPLLPLYLPW
FT                   PHDARLRTICDTLVATPDDLRTIAEWADLLGLSVRTLHRAFRRETGLSFRRWREQARLL
FT                   LALKRLAHGEKVLTVAMDHGYSSQSAFSAMFKRHFGMSPSAFYA"
FT   gene            463099..464007
FT                   /locus_tag="Bcen2424_6282"
FT   CDS_pept        463099..464007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6282"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bcn:Bcen_1547 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13014"
FT                   /protein_id="ABK13014.1"
FT                   /translation="MNKSPFLLPFCAIALWAGNVVVSKLSASTIDPSAITFYRLLLAVA
FT                   LMSVFTLRPAWRNRAVLVAHLPKLATLGFLAMALFQSLSYEAAKTTSATNMAIITALVP
FT                   LMTMLLSSLLLGDPPGAGMIGGGVLSLAGVVYLIAEGHPTAIAARGVHPGDLLMLAASA
FT                   AYALYGVLLKRWRIGALSAWQSTYVQALAALGFLVPMLLRLPAQAAWPTRASVPLILYA
FT                   GVLASVVLPYLWMQGVRLLGPSRCAMFMNLLPVMTAAGAIVLLGESLRLYHLIGGSVAL
FT                   LGVAIAQRFPFQAGGAQGIRQ"
FT   sig_peptide     463099..463167
FT                   /locus_tag="Bcen2424_6282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.395 at
FT                   residue 23"
FT   gene            464004..464975
FT                   /locus_tag="Bcen2424_6283"
FT   CDS_pept        464004..464975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6283"
FT                   /product="protein of unknown function DUF815"
FT                   /note="PFAM: protein of unknown function DUF815; KEGG:
FT                   bcn:Bcen_1546 protein of unknown function DUF815"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13015"
FT                   /protein_id="ABK13015.1"
FT                   /translation="MSAHPDMQDLVAALPDGRASVAAPALARQLERIATALEALAGTRP
FT                   PAAVDFDAAIAFRWRGFGAGHQTAPLEPIAAPALVAFDALRNVGRQAAIVERNTRQFVH
FT                   GFAANHVLLTGARGTGKSSIVKACLHAFAAHGLRLIEVSKEGLNDLPAIVELVRARPER
FT                   YLVFCDDLSFEAGETGYKGLKTVLDGSVASDLSNVLVYATSNRRHLMPEQASDNANVTR
FT                   AENGELHPGDAVEERISLSERFGIWVTFYGFTQDEYLAVVESRLGAAGFDDAQIRAARE
FT                   PALQWALERGARSGRIAVQFARDYAGRLADESGEGAPVRPAA"
FT   gene            complement(464984..465850)
FT                   /locus_tag="Bcen2424_6284"
FT   CDS_pept        complement(464984..465850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13016"
FT                   /protein_id="ABK13016.1"
FT                   /translation="MPAMRYDNAFVYPSTGLAGRIANRIVASGPLLRARRAVLSRLPFL
FT                   QLASDVEQVVYCTWIVDVAAVAHLVPRGVTLASRGGRTPFTTLTYRHRHFGPRLAGPLR
FT                   RVFPSPLQSNWRLYVDTLPHGAPAGRTVLFVKNVFDHPLYALGSRLFSDALPSHLARPF
FT                   THAARDGRYDTRLAGSGGSAPDFRCTAEASHDRTLPDAFAPFFDDWRAAVAALSLQHAA
FT                   VAHVEDCDRLAHASIDLPIDVDAVRPLKMVGPTGGGDFLARIGATGEPLCFVVPDVAFR
FT                   VLSERLL"
FT   gene            complement(465960..466871)
FT                   /locus_tag="Bcen2424_6285"
FT   CDS_pept        complement(465960..466871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6285"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: bcn:Bcen_1544
FT                   phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13017"
FT                   /protein_id="ABK13017.1"
FT                   /translation="MQANLRSRFHHDGFAVIDRLIDPSEIEDLREIGHRLLGSRTGYAE
FT                   GLMFDFYPETNGRDAGPQLLQLHWASYFERRLSALRIRRTAFEIAQALLGPEVRFAGDS
FT                   FFLKQPRTGTVTPWHQDDAFTDARIEHREVNFWIPLQAVSVDNGCMQFIPGSHLYDVLP
FT                   HGPLGGDVTAHGLECVGGFDPAHAVACPLMPGDCTVHAGRTLHAAGANLSDQPRYAYAL
FT                   NFRLPRRRSSVATNFPWHNTWRPSRIERARASRSLRGYWPYLRRELYTFDFRNPFEWRL
FT                   AGGKIARWLNVPRRQLREPGPE"
FT   gene            complement(467112..467792)
FT                   /locus_tag="Bcen2424_6286"
FT   CDS_pept        complement(467112..467792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6286"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: bcn:Bcen_1543 deoxyribose-phosphate aldolase;
FT                   TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13018"
FT                   /db_xref="GOA:A0KCV5"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KCV5"
FT                   /protein_id="ABK13018.1"
FT                   /translation="MPLSNAQLAQTIDHTLLAPDASDAQIRELCRQAAEHRFYSVCVNS
FT                   ANVPLAARELAETGVLVCAVVGFPLGAGLSAAKAFEATAAIAAGAGEIDMVINLGALKS
FT                   GRADDVKADIDAVHRACGTVPLKVILETGLLTDDEKVRVCEMCRDLGVAFVKTSTGFGH
FT                   GGATLADVALMRRTVGPTLGVKASGGVRDRAAALAMLEAGATRLGTSSGVAIVTDQGGG
FT                   AAGY"
FT   gene            467939..468709
FT                   /locus_tag="Bcen2424_6287"
FT   CDS_pept        467939..468709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6287"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; KEGG: bcn:Bcen_1542
FT                   transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13019"
FT                   /protein_id="ABK13019.1"
FT                   /translation="METKKGERIKTLMNVLQGQNAIHLREVAELFGVSEMTIRRDLADN
FT                   PHGLSLIGGYVTRHFAAQRSDIGEYLISAENNRQTEEKRRIGKLAAQFVTTGDTIFVDC
FT                   GSTTPFIVDFIPDDLEFTAVCNSLNVFAKLQQKPHCNVILCGGAYHRQNMVFESVAETG
FT                   ILDSVRVSKAFISAAGVSERCGVTCFNFHEVDAKKKVMARAQNRFLLVDHTKFDEVRAA
FT                   YFAELTDFNYVISDGQLSRRYETTIREHGIALVT"
FT   gene            complement(468768..469820)
FT                   /locus_tag="Bcen2424_6288"
FT   CDS_pept        complement(468768..469820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13020"
FT                   /protein_id="ABK13020.1"
FT                   /translation="MRGEIELRRDDFREAPRTLYRTDGLTVTAFAYPSGVEALKLENRR
FT                   GHLVVLPYLGQMIWAAEFDGRDLTMKHMFRQPKRATSIIDTYGCFMFHSGLLRNGCPGP
FT                   DDTHALHGEMPCAPMDRASLVVGTDARGATVEVTGEYEYVQGFGSHYVARPSVRLAEHD
FT                   ARMTIAMEVTNLGGTPMDLMYMAHLNYAYVPGGRFVQSLPAGGMRLRDSVPAHVKPTAA
FT                   WRDYTATLAREPARLATLDAPALYDPEIVFFMNDVETDADGIAHFRLAHPDGGAFHTAY
FT                   RPAQFPHATRWVLHNADHQVAAFALPSTCEPEGYEAERRKGHVAALAPRASRRFDVVTG
FT                   YLSAAEARDA"
FT   gene            complement(469823..471196)
FT                   /locus_tag="Bcen2424_6289"
FT   CDS_pept        complement(469823..471196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6289"
FT                   /product="L-fucose transporter"
FT                   /note="TIGRFAM: L-fucose transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_1540 L-fucose
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13021"
FT                   /protein_id="ABK13021.1"
FT                   /translation="MSRTRIEHAPDGYYLNRTPLFAFTLLCCLFALWGTAANLNDVLIA
FT                   QFKKSFFLSDFESAFVQSAFYLGYFFLAIPAATVVKKFSYKTTILVGLLLYTTGCLLFF
FT                   PAASMAKYGMFLVALFVIAAGLSFLETASNSYSTLMGPRDTSTRRLNISQTFYPFGAMA
FT                   GVYMGSFLIFKEGDASHAQLAAMSAADAHTHQLAMIQATLEPYKWLIVVLVAVFIVFAL
FT                   TPYPACKGNAASTVMHRIDARGTLARLFGNRRFVAGVIAQFLYVGAQVGVWSFTIRLAM
FT                   QIGGLTERGASRYLLATFFAFFVGKLIATLVMKRVGPAKVLIVYGILCIALLAYTISVH
FT                   NITAVYAAVCVSIFLGPCWPTIYGLTIDGLGKDTEYGGSILVMSIVGGAVVPLIQGLIS
FT                   DHTGGNMQLAFVVPLLCFVVIVYYGFYCLRHLPAATPDAAADGHASTRYAATRNTSGA"
FT   gene            complement(471237..472199)
FT                   /locus_tag="Bcen2424_6290"
FT   CDS_pept        complement(471237..472199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6290"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   KEGG: bcn:Bcen_1539 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13022"
FT                   /protein_id="ABK13022.1"
FT                   /translation="MRAAPHTKEETQMETIAVIGSNMVDLVTYVARMPARGETLEAPNF
FT                   ELGCGGKGANQAVAAARLGARVVMVTKVGDDVFADNTIRNFEREGIDTTHVRKVAGVPS
FT                   GVAPIFVEPDSSNSILIVKGANRHLQPADIDAAAPMLAECALIVLQLEIELDTVYHAIE
FT                   FGARHGIPVLLNPAPAVADLDFERIRSVEFFVPNETELAIVSGLPVDSRESATRAAEAL
FT                   VARGLKHVLVTLGSNGSLLVSRDGVHHVPGVPVDARDTTGAGDAYIGCFARCYAASRDA
FT                   VDAMRYASAYAAHSVTGLGTQKSYADAATFERFLRDAGF"
FT   gene            472266..472562
FT                   /locus_tag="Bcen2424_6291"
FT   CDS_pept        472266..472562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13023"
FT                   /protein_id="ABK13023.1"
FT                   /translation="MLEGSLSGGWSEDGEAAKPGFAPLRELPAAGAFTVDPVWLLLHAN
FT                   FGLFRYCSHSISATAAHVGETEPSAHSRLLREQKNDRFDHIRVFIDCYRHETG"
FT   gene            472770..473666
FT                   /locus_tag="Bcen2424_6292"
FT   CDS_pept        472770..473666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6292"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="KEGG: bcn:Bcen_1537 dihydrodipicolinate synthase;
FT                   TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13024"
FT                   /protein_id="ABK13024.1"
FT                   /translation="MSIAFKGIVPALITPMTANENVDEDGLRALVERLIEAGVHGLFVL
FT                   GTNGEFIALNEEEKLRIARIAVSQARSRVPVIAGTGAYATRDVIDLNRKMADAGVDAVS
FT                   VITPYFNGATQPELYAHYKQIADATPLPVMLYTIPAKAGITLTVDTVRRLAEIPNIRGI
FT                   KDSGGDFDRLLQLIDLRRDDFAVFTGTDSMILWTLIAGGDGAVAATTNAVPHVVMSIWN
FT                   KFHAGDIAGARTAQESLRALRDAFALGTMPVVLKTAAQMLGMPAGPARSPAQPLDAQAR
FT                   ERLAQALSVYRDAARGH"
FT   gene            473680..474846
FT                   /locus_tag="Bcen2424_6293"
FT   CDS_pept        473680..474846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6293"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bcn:Bcen_1536 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13025"
FT                   /protein_id="ABK13025.1"
FT                   /translation="MTTYHFQTVRHIVHGAGSLATLPDKLALLDTPVKRIALITQPSME
FT                   ALGIVDRVIESLDAKDVDVRIIRGVEPEPTIGNVETVFNEQIAPFAPQAILSIGGGSVL
FT                   DAAKLFAVRLTNDEPLRNWLGIDLIKHPGVPMILVPTTAGTGSEVTPNAIVTLPDESLK
FT                   VGIVSRHLLPQIVILDPELTLGLPKPITAATGMDAFVHALESYISTKANPISDMYAMES
FT                   MRLIGANIVDAYENGQSLKAREAMMLGSMYGGLALTAAGTAAVHALAYPLGGMFNVTHG
FT                   VANAMLLPHVMAFNLDAIEDRLANVARALDLASKADTDADAARKLIDKMEAWTAAVDIP
FT                   QDLRKFGVSEAHLDALAVAASKVKRLLGNNPKALTLDDMKSIYRRLLP"
FT   gene            474843..476120
FT                   /locus_tag="Bcen2424_6294"
FT   CDS_pept        474843..476120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6294"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   bcn:Bcen_1535 type III effector Hrp-dependent outers"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13026"
FT                   /protein_id="ABK13026.1"
FT                   /translation="MNALAPHAARLLIVADDLSGAADCAVAGLRHGLTAMVVLDAAHAA
FT                   AAPHGVDILSIDVDSRRLPKDVAARRTVDAVASLSNAGTRLYKKVDSTLRGNFAAEVAA
FT                   LTSRAGMAIVCPAYPASGRTTIDGRQWVRGVPVEASEYWRNEHIPGTADLVALLSAEDL
FT                   RVAYTAIGTVRDNANALTAHLRELQSDRVQAVVCDAESDDDLQRIARASAALDGVFWVG
FT                   SAGLAPGVIEALGPPHGASGPTAGGPHSKGPVLTVVGSMSSISHAQLDCLKANAGTHLV
FT                   ALEVSVCALDDTRSDVTTVASDALRGGRHVVVSLSQARRGDVNDGLLFSTRLAALLAPA
FT                   VRHAGAIIATGGETARALLTAAGASALRVVDEIEDGMPLLECRLHGNALPVVTKAGGFG
FT                   QPESIYHAWRRLANTGEPADTAQPNQ"
FT   gene            476132..477157
FT                   /locus_tag="Bcen2424_6295"
FT   CDS_pept        476132..477157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6295"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: bcn:Bcen_1534 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13027"
FT                   /protein_id="ABK13027.1"
FT                   /translation="MDNRPIIGITMGDAAGVGPEIIMKSLAHASVYEECRPVVVGDAAR
FT                   LRDAGRRAGVDLEVSAIGRPSEGAFRVGVVDCIDLALIPADLPYGKLSAIAGDAAYQYI
FT                   ARTVELTSKGELDAICTAPLNKEALHAGGHIFPGHTEMLAHLTGIDEVSMMLVAPNLRV
FT                   IHVTTHIGLLDAIRKIEPGLVQRTIERGHDTLVRAGIANPRIGVCGINPHAGENGLFGY
FT                   GEEEEKIVPAVEVLQARGWDVEGPLPADTLFFRAGRGDFDVVVAMYHDQGHGPVKVMGL
FT                   EAGVNVTVGLPVIRTSVDHGTAFDIAGKGIADERSLLEAFRQAVDLATRRNESSPVASA
FT                   A"
FT   gene            477269..478687
FT                   /locus_tag="Bcen2424_6296"
FT   CDS_pept        477269..478687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6296"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bcn:Bcen_1533
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13028"
FT                   /protein_id="ABK13028.1"
FT                   /translation="MATFSYWDTATIIGMVVAYIVVTSVVSIRLRSRNSEQFMVAGRSM
FT                   PALVVAILLMSEFIGAKSTVGTSQEAFSAGIAASWSVLAAAIGFLLFGLFMARRLYASG
FT                   EFTISGFIAQRYGHGAKLAVSAIMIYALFVVNVGNYVSGAAAISTVMRINLPTAAVITA
FT                   IVSTIYFVWGGLKSVAYLTVVHSAVKLLGIAILVGVAWKLSGGIAPMARSLPAHYFTWS
FT                   GALSGGTIGAWIIGTAGAIFSTQFIIQAISATRSPEGARASSLIAAFLCVPIALALGFI
FT                   GVAAKYLYPGVKSLYALPVFLQHMNPILAGIVTTSLVASIFVSVCTVALAIASLIVKDF
FT                   YVPRFNPTPDVELRMTRWISLIVGFLPLIFVLFVPQILALSFFSRALRLSVSVVALIGI
FT                   YLPFFSGKRGAVSALVVATLATTFWYLLGNPFGIDNMYVALVTPAIVLVIGKLLFHGDG
FT                   ANLRDKPLTHRESH"
FT   gene            478711..479898
FT                   /locus_tag="Bcen2424_6297"
FT   CDS_pept        478711..479898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6297"
FT                   /product="glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /note="PFAM: glycosyl hydrolase, BNR repeat-containing
FT                   protein; KEGG: bcn:Bcen_1532 glycosyl hydrolase, BNR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13029"
FT                   /protein_id="ABK13029.1"
FT                   /translation="MSTNLVEAASAASDHCVRTAYADAERQEAFLPAACVQNHAANLHC
FT                   LDNGDLLCVWFGGTQEGIPDVSIYLSRLAAGTDEWSAPRKLSDDPTRSEQNPVLFTAPD
FT                   GRLWLIYTAQLSGHQNTAIVRRRVSTDGGLTWGPVDTLFDRPGTFVRQPIVALDDGTWI
FT                   CPIFLCRTEPGERWVGNDDVSAVMVSDDQGRTWTPHEVPDSVGCVHMNVHVLHDGSLLA
FT                   LYRSRWADFVHASRSTDGRTWSAPERTDLPNNNSSIQFTVLQNGHLALVFNESDASHGK
FT                   ERRASLYDDIDDSEDSGELRDQQASVRGTAFWGAPRAPMSLAISEDGGRTWPRRRNLEI
FT                   GDGYCMTNNSADQRNREYSYPSIVQSRDGALHIAFTWFRQKIKYVRVDETWVRGR"
FT   gene            480003..480809
FT                   /locus_tag="Bcen2424_6298"
FT   CDS_pept        480003..480809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6298"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; KEGG: bcn:Bcen_1531
FT                   transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13030"
FT                   /protein_id="ABK13030.1"
FT                   /translation="MKVTRRREAMLQAVLGGMTDVATLCEHFGMSEATVRRDLRALASD
FT                   RRILRTYGGAAAVGGHEPEPSLEERRISSQEQKEAIAHAASSFVEDGDTVFLDGGTTTA
FT                   ALARLLAGRTDVHVVTNNLLVVSPLVSSGVHVTVIGGDVRSSSMSTLGPLAQIALSRLS
FT                   VDKAFLGADGVVAELGLCEASSEQSYLKECVMRQAAEVFVLVTADKLGRASQQHWTPLE
FT                   RDWTLVTDDGALHEQLEPFHAQARVTVQAVSTKATAASGGPLQVQT"
FT   gene            480821..481525
FT                   /locus_tag="Bcen2424_6299"
FT   CDS_pept        480821..481525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6299"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: bcn:Bcen_1530 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13031"
FT                   /protein_id="ABK13031.1"
FT                   /translation="MAQREQPGLDSRHAVVTGASSGIGRAIVERLLANGWRVTGLCRSH
FT                   VETAHDSLKIVPVDVTDFAALAPVCDALGVVDALVHAAGFMRTAPLGQLSHDDGAAMWR
FT                   LHVESATFLADRLVPRMPPGGRIVLLGSRTANGAATRSQYAATKCALVGLARSWAAELA
FT                   PHGITVNVVAPGATDTPFLRDPARAATPPRLPPIGRFITPDEVAALTAFLLSANAGAIT
FT                   GQQIVMCGGASL"
FT   gene            481914..483335
FT                   /locus_tag="Bcen2424_6300"
FT   CDS_pept        481914..483335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6300"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bcn:Bcen_1529 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13032"
FT                   /protein_id="ABK13032.1"
FT                   /translation="MDTHISRGSGSQAAISSAGFAGANPSEQTAGISESSLKLSRELSV
FT                   LDLIVYGMVYMLPIAPFALYGIISNVSGGMVPLVYIVSVVAMMFTARSYQILSKEFPAA
FT                   GSAYTYAQNGIGDLAGFLAGWLVFLDYIIAPGLLAVVSAVAMNSLVPEIPRSVWVIGFV
FT                   GLGTILNLVGISVTAKVNQAFLVIMLVILAAFVGVGLFALYSGMGHGRLTFGSLFNVHT
FT                   FTWAGLGTGILIGSTNFLGFDAITTLGEEVRSEKRHLASFAGMASLVIIAILFVLQTWI
FT                   AADLASGAKVLSPDSAFYDISGYAGGHWLFAMTSISTALAFGVPCTIVCQMAIARIIFA
FT                   MGRDRQLPKVFSRLSRRSKQPYVANIFVASISLIIALVFQDRLDDLALFQNFGAFSAFI
FT                   LVNLSVIGYFRIKKQSKDTWNHVVLPAIGFLVIVALMVAMRAATLKMGIIWLVIGLVYY
FT                   FVMRHVFGRSAALKI"
FT   sig_peptide     481914..481985
FT                   /locus_tag="Bcen2424_6300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.620) with cleavage site probability 0.531 at
FT                   residue 24"
FT   gene            483477..484640
FT                   /locus_tag="Bcen2424_6301"
FT   CDS_pept        483477..484640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6301"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_1528 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13033"
FT                   /protein_id="ABK13033.1"
FT                   /translation="MSTFAVDGQSRGGVWARLSTRAGFYSFGFILSAWAPLAPLAKSRI
FT                   GLSDGDFGLALLWFGVGSLVAMPIGSAAVARVGCRRIILLAGPITCACLFGLASTDRAD
FT                   ILSVCLFLFGFGIGATESAMNLQAAVVQRMHDEPLMSGFHAWCSIGTIAGSAGVSTLLS
FT                   VQISPVGAIACVFAVMVALWCVVGRHFIARTGTAQTHRFARPTLYIVWIGILCFVAFLA
FT                   EGAVLDWSGVFLVTEKAFPQSSAGYGYAAFALAMTIARLTGDRLARVSGARSILVAGSV
FT                   GTAAALVALVFARHWMILIALFAAVGFGLANIVPLFFLHVSRQRRMRVELAMPVVATLG
FT                   YAGMLAGPAVLGAIGELAGLSASLLTIAAMLLPIALSAHTIVSRDVG"
FT   gene            485019..486122
FT                   /locus_tag="Bcen2424_6302"
FT   CDS_pept        485019..486122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6302"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bcn:Bcen_5596 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13034"
FT                   /protein_id="ABK13034.1"
FT                   /translation="MRGMDEMQEPLFTTVKLEDFVPADHPLRPLRLLVNQALKRLNGLF
FT                   GTIYADSGRASIAPEKLLRALLLQVLYSVRSERMLMEQMRYNLLFRWFVGLAIEDAVWD
FT                   HSVFSKNRDRLLEHEVVEAFFTEVMSLADKQGLLSREHFSVDGTLIQAWASHKSFRPKD
FT                   GSDDPPAGGGRNVDTDWKGKRRSNDTHESSTDPDARLFRKGRQSGAILCYQGHILMENR
FT                   SGLVVGAVVSHADGFGERASALRLLDRVPGRHAKTLGADKGYDMRDFVRDCRARKVTPH
FT                   VARNDAHQGGSAIDGRTSRHAGYGISQVIRKRIEEHFGWGKTVGRIRQTAYRGIKRVDQ
FT                   HFKLTMLASNLTRMARILAAVPQGAAR"
FT   gene            complement(486357..487325)
FT                   /locus_tag="Bcen2424_6303"
FT   CDS_pept        complement(486357..487325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13035"
FT                   /protein_id="ABK13035.1"
FT                   /translation="MRSMRRFPSVSIRKIPHGNRRIAARDRPLHAGSPFIAGPFDHFFR
FT                   NDMDRQHDLSNLASNLSLLVASFDSIADFCRKLNINRQQFNKYLAGHHVPSQKVLLKIA
FT                   KFFLMEPADLFRAPPEFRSFYEGLEYELPFDLKSAPSFLRFLPLIKSSSAALQDFLGVY
FT                   YRYHNSSIYKGRILRSVTCLYERDSVVQYVTVERFPLLDQDGKVGYSFKYHGFCFLMGD
FT                   RIFMIDFEGRQKNEMTFSVLTPQHRRPIRFLYGVVTGVASSSFRQPFSTRIALNFADRG
FT                   HMQRKHLRNATVLLPTDRSLPAEIRDYMTGDQSTVLWGGEG"
FT   gene            487577..488536
FT                   /locus_tag="Bcen2424_6304"
FT   CDS_pept        487577..488536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6304"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_1525
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13036"
FT                   /protein_id="ABK13036.1"
FT                   /translation="MKAETTRRFEMSFSPGGGIHAGAPGQRRRWLRASPAALTLAPSVV
FT                   VLLIAVYVFIGWSIVISFTSSKFAPNYDFVGLAQYARLWDSDRWNVAVTNLGLFSIAFM
FT                   LISLVLGLLLAIFLDQKVRGEGAFRMIYLYPMAVSLIVTGTAWKWILNPGLGLEKLLQD
FT                   LGITGIHVNWLIDPQMAVYTLVVAAVWQTAGFVMAIFLAGLRGIDGEIIKAARMEGAGT
FT                   LRIYLTIIIPMLRASVFSVVVILIYQAVRSFDLVVALTNGGPGFSSDLPTTFMYNLTFS
FT                   RGQLAQGAASSVMILLVVVALTVPYLYSEFKREHNDSL"
FT   gene            488514..489431
FT                   /locus_tag="Bcen2424_6305"
FT   CDS_pept        488514..489431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6305"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_1524
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13037"
FT                   /protein_id="ABK13037.1"
FT                   /translation="MNTTTVSDTARHVRRVSRPSSTTLRVVARAVLYAILVGSAAFFVM
FT                   PLVVMVFASFKDMAEIRSTSILSFPLAPTVQPWIDAWQNACVGIDCVGLNGFYVRTVLI
FT                   VVPAVVLSTLLGALNGYALTKFNFRGSKFVYGVILFGTFTPYQSVLIPLAKTLGVLGLS
FT                   GSLAGLVLVHTVYGLPFTTMFFRNYFMTVPQDLVKAARVDGAGFWTTFAYIILPLSVPM
FT                   IVVTVIWQFTSIWNDFLFGVSFTSGQNTPIMVALNNMVSASAGERPYNVHMAGALLAAL
FT                   PTLVIYFLAGKYFVRGLMAGAVKG"
FT   gene            489434..490525
FT                   /locus_tag="Bcen2424_6306"
FT   CDS_pept        489434..490525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6306"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: rru:Rru_A0095
FT                   ABC transporter component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13038"
FT                   /protein_id="ABK13038.1"
FT                   /translation="MASLHIRDVRKNYGSVACLKAINIDADDGEFLVLLGPSGCGKSTL
FT                   LNAIAGLEPVNDGEIVIDGSVVNDVESAKRDIAMVFQSYALYPTMTVRNNLTFGMRVRG
FT                   ASRSEQEEAVKRVAAILQLDQLLDRKPSQLSGGQRQRVAMGRAMVREPKIFLFDEPLSN
FT                   LDAKLRTEMRAEIKKLHQRVGTTTVYVTHDQIEAMTLATKIVVMRGGEVQQIGTPEDVY
FT                   DRPANLFVARFIGSPAMNCLTGVLRGRDTHAVFIGGDGSGHTVEIALGALSDAQRGYLD
FT                   RDVVLGVRPEWLAPGVGATSFQATVDVVEPTGADNFVLLSVAGESIMARFAPGVGRVGD
FT                   VMQLVVNADKALIFDPATEQRVV"
FT   gene            490578..491414
FT                   /locus_tag="Bcen2424_6307"
FT   CDS_pept        490578..491414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6307"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: bcn:Bcen_1522
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13039"
FT                   /protein_id="ABK13039.1"
FT                   /translation="MNVEWNDEPSMAGPMSGIDEQYYRDTVIELCDLARTLCGAVAHDT
FT                   LAITRKGDTSPVTELDKRIELALRSRIQARHPLDSSVGEEFGVVDGLAHGVSNRRWVID
FT                   PLDGTRAFVTGSPLWGTLVGVLCDGVPWLGAIDMPALGQRMIASSTDAATHVESAAGTA
FT                   VPLSAARMCTTTPDKFTPDQHAVYARLVARVAVHRYGGDCFNYAALASGRCDLVVESGL
FT                   APHDFLPIVPIVEAAGGRMTDWRGRRLTERSAGDVVAASSGALHASVMALLAGSNA"
FT   gene            491411..492577
FT                   /locus_tag="Bcen2424_6308"
FT   CDS_pept        491411..492577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6308"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: bcn:Bcen_1521
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13040"
FT                   /protein_id="ABK13040.1"
FT                   /translation="MKGSACIPVKCGIASPQADAFPSMKRAVSMKDVALAAGVSQPAVS
FT                   YAYNKPSEISEAQREHIFAVAKKLGYPGPNVRGRSLRSGRVGAVGLMIMDELPYAFADP
FT                   ATTCLLRGIGEISELANVALALFPLQKDLANHAGDAANGSLAVRGFVDGLIAYSLPDHY
FT                   PVIEVARRQGIPVVIVDAPIIDKVPFVGIDDLQSAIVQMRHLVELGHRRIGIVADRLRP
FT                   DGVRGIVSRQRFQEATENVVRARIDGYLRAAEAVGLGFDDLLIVEAGGFDRASGIWAAE
FT                   QMLQHTGLTAVAATSDVMALALVQAARERGVAVPDRLSVAGFDDIPEAAGAGLTTIRQP
FT                   LIEKGRQAAQLLSELLSGPAARKPRVPRVLLPTELVVRSTTQAPAAAR"
FT   gene            complement(492617..494221)
FT                   /locus_tag="Bcen2424_6309"
FT   CDS_pept        complement(492617..494221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6309"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bcn:Bcen_1520
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13041"
FT                   /protein_id="ABK13041.1"
FT                   /translation="MSDATFVHRPASGLSSFAPVLRREIPTVVPGSDGIITCDVVIVGS
FT                   GMGGSSFAQGIAGHGLDVLIVERGDFLPREIQNWQAEAVFRDGRYRNAESWDDDAGKPF
FT                   SPGVFYYVGGNTKVFGAMLPRFREADFGAIQHAEGISPAWPITYADMEPYYAAAERLYN
FT                   VHGAGGQDPTDPWRSGDYPFPALEHDPALRPLAAAMRAQGLRPFVMPAAVNYGRERPCV
FT                   LCSTCDGYPCLVDAKGDAEVSVLRPLVGSGGAQLMVRTRIDRLVMSADGTRIEEALGVR
FT                   DGQPVRIRAKRFVLACGAVNSAALLLRSADHAHPEGIGNRSGMLGRNYMVHNSTFMLAV
FT                   DPRRANDVLFQKTLAVNDWYLRSPQNAFPLGNVQMLGKIREPMVTGMYPWLPKAVSRYM
FT                   TDHSVDLYLTSEDLPDPENRVTVDPQSGRIRIRWRANNLRAHRALVKKTVAMMRRAGYP
FT                   LVLNKRMGIATNSHQCGTAVMGNDPGTSVLDTNCRLHDVENAWIVDSSWFPSSAAVNPA
FT                   LTIAANALRVARQFVGR"
FT   gene            complement(494234..496021)
FT                   /locus_tag="Bcen2424_6310"
FT   CDS_pept        complement(494234..496021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6310"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: bcn:Bcen_1519 thiamine pyrophosphate enzyme-like
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13042"
FT                   /protein_id="ABK13042.1"
FT                   /translation="MAKLTGSQIVAQTLKNYGVEYVAGIPGHGIWTLTDAFLEKDSEIR
FT                   FIQVFHEQSAVHLADGYYRVSGKPMAAVTSIGAGASNTVIGMATAFTDSTSVMLITGGP
FT                   PTHMRGHGLLQELERYVDNDFPKIAEAVSKRHWVAQRVEELPFIMHRAFSSMLTGRPGP
FT                   VHVEIPMDTQAEAAEVTLHQLEERVPLGKVYPDPIAVEKAADVLRQARRPVMVIGGGVI
FT                   TGEAAAEVLALAEKWQIPVVTTWNGKSGFPEDHALFAGSVGQTGTMCGNKVASSADVII
FT                   AVGCRFTDWSSSSYAKGVTFSIPPGKLIHIDIDPHEIGKNYPVAVGIVADAKYALAHIV
FT                   EALEGDAAERGEYLAEVAAHKAEWEAKLATRRDSDRFPFTSQRPLGALRKIFPRDTIVV
FT                   VGSGNTQGAVKQTFPVYTPRTHLTSGGFSSMGWAVPAAIGAKLAKPDSPVVCILGDGDF
FT                   LMTSQEIAICVTNNLPVIFIVQNNAGYMSIRGGQRKQTSRHIGTEFNYPDGRPYSPDFE
FT                   AVGKAFGLKSWRVNSNDELEPILQQALDSNAPCLIEIPTDRDAAGPWVPGWWDFPIPAY
FT                   IDDERQEEYAQFRNSEQHL"
FT   gene            complement(496097..496759)
FT                   /locus_tag="Bcen2424_6311"
FT   CDS_pept        complement(496097..496759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13043"
FT                   /protein_id="ABK13043.1"
FT                   /translation="MRVLHLYGGWPGHYPYEVAAWTRGLFDELGWEVEGSTDIFTLDRD
FT                   LSAFDLIVIGWNNAVTTETLTASQEKHLLDAIENGTGLAAWHGAAAAFRASLRYHMVLG
FT                   GSFIEHPAGEGYPHPYMVNVIDRDHPVTRGVEDFEVRSEQYYMQVDPNNHVLAETTFDG
FT                   KPFPWLAGNRSPVAWVRQWGRGRVFYHSIGHDVGNLSDINVRRLTMQGLQWAARPAA"
FT   gene            497109..498395
FT                   /locus_tag="Bcen2424_6312"
FT   CDS_pept        497109..498395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6312"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: bcn:Bcen_1517
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13044"
FT                   /protein_id="ABK13044.1"
FT                   /translation="MIQHLKKSKPMEAQLEIAKQVRDTVEQIIADVAANGDAAVREYSM
FT                   RFDKWNPASFRLTDAEISACVATLSERELDDIKFAQQQVRRFALAQKDALRDVEVETLP
FT                   GVVLGHRNIPVNSVGCYIPGGKYPLLASAHMSVLTAKVAGVKRVVAVAPPFDGKPHPAI
FT                   VTAMHLAGADEIYCVGGVQAIAALALGTDQFEPVDMIVGPGNAYVAEAKRQLFGKIGID
FT                   LIAGPTETLVIADDSSDVEIVAADLLGQAEHGVNSPVVFLTNSARLADGLPAEIERQLA
FT                   VLPTAAVASVAWRDYGEIILCDTVDEMVEEADRIASEHVQVMTRDPLYFLEHMTNYGAL
FT                   FLGDRTNVSYGDKVIGTNHTLPTTKAARYTGGLWVGKFIKTCTYQRVLTDEASAMLGEY
FT                   CSRLCAMEGFAGHKEQADIRVRRFGKRAD"
FT   gene            498837..499967
FT                   /locus_tag="Bcen2424_6313"
FT   CDS_pept        498837..499967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6313"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_1516
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13045"
FT                   /protein_id="ABK13045.1"
FT                   /translation="MKRKVISAISLSITAYAAGAHAQSSVTLYGIVDTGIAYIHNSGGQ
FT                   ASQWKMSAGNLSGNEWGLKGTEDLGGGLSASFQLENGFDLGSGQLQNDGRMFGRQAFVG
FT                   LGSTRFGTVTLGRQYDPVTDLVQPITADSYSGLFAPPGDIDNYDDSARFNSAVKWTSPS
FT                   WGGVTVETMYAFGGVAGSTGSGQSWSAAAAYSGGALSVAGGFLHVDNGNARTSARGTSS
FT                   ADSFFNSAVNAAYATARGIDIGRIGAQYVVGPVTAGAAYSYTRYTSDGASTFAGSQHFQ
FT                   NGSVFASWMATPTLQVIGGYNYTRSGGHSSATYQQVNLGVDYLLSKRTDVYAMAGYQHA
FT                   SGDNGQGSAQAVIGSYDVNSGANSQIVAIVGLRHKF"
FT   sig_peptide     498837..498905
FT                   /locus_tag="Bcen2424_6313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(500035..501312)
FT                   /locus_tag="Bcen2424_6314"
FT   CDS_pept        complement(500035..501312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6314"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bcn:Bcen_1515 extracellular solute-binding
FT                   protein, family 1; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13046"
FT                   /protein_id="ABK13046.1"
FT                   /translation="MKAKTRLRHISARAVVSTVASLSMVGMAGAQAQTVEVVHQWTSSS
FT                   EAYALQALKDALQKKGIGWKDSAIAGNDGANQQQALQARLAAGSAPAAAQAQPQLLFSY
FT                   AEQNELTNLDSLAKAGNWDKLIAPELIPYVKYKNDWYGVPVNEHRENMFWINAKILQKY
FT                   GGKAPTTWDEFNALAERMKKDGIIPVALGGEDWQEAEIFSDLVIGIGGPAFYKKAIIDH
FT                   DPATIQGPTMLKVFDQLRKIIGFTDPNRAGRDWNVATQMVIDGKAAMQIHADWAKGEFL
FT                   RAGKKPGIDFVCAATPGSGHAFVWVVDTMTFFKQKNPAAAANQATLANLAMSADVQANF
FT                   NLRKGSIPARLDVPQAKFDDCAKLNFADRAAAAQSGAVVPSFIENAALERDVRASFVDV
FT                   ITQFVNTPSMTSATAVKKLAAAAKNN"
FT   sig_peptide     complement(501214..501312)
FT                   /locus_tag="Bcen2424_6314"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.904 at
FT                   residue 33"
FT   gene            501746..502786
FT                   /locus_tag="Bcen2424_6315"
FT   CDS_pept        501746..502786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6315"
FT                   /product="glycoside hydrolase, family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: bcn:Bcen_1514 glycoside hydrolase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13047"
FT                   /protein_id="ABK13047.1"
FT                   /translation="MNDYDRDAYAVLLPAFAGLTLSDDVCRYLDRGGVSVLLGETRDEY
FT                   VGRAMSAQRRTEEAAAHFRDVVESTRRRAGSGVLVAVDQELGGIQRLHALVPALPSLDD
FT                   ALHAGTETIVERSAAVAAAARELGVNLFLSPIADVVVGANPWLDGRHLGADAADVLRIA
FT                   RAFVQGVQSAGVAATAKHFPGHPVTALDPALDEAVVGGGLAELAPTLDVFRALIAGGVK
FT                   AVMAGPALVPAIDVEHPSSTSRDTLSMLRHEFSFHGLIISDDLDAPGILRGRSIEATAV
FT                   AALDAGADLLLLSSEAGLDRIAGTIVEAVRSGALDASRLAQAANRVRALARELDGVQVA
FT                   GRNERA"
FT   gene            502796..503809
FT                   /locus_tag="Bcen2424_6316"
FT   CDS_pept        502796..503809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6316"
FT                   /product="glycoside hydrolase, family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: bcn:Bcen_1513 glycoside hydrolase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13048"
FT                   /protein_id="ABK13048.1"
FT                   /translation="MSELLRQAHAVLFPVLVTLELDDHIGRFLDNGGKSLLFGETGEEY
FT                   VSGQMNAERRRRETLDAWHGTVEQATARAGHVLLAADADIAAVHRLQWLTPPLPSRDDA
FT                   QRMPPRELEDVCFEMAKGVAQAGINLVLSPTADVVTGRNLWLNGRTLADDPVLAAAMVR
FT                   AYVRGVRRAGLQTTLKHFPGHPDLVGHPATSDATVPLSLAELRSLWAPFEAGIDEGVDA
FT                   VMMGPARFHAVQPAVAASLSRELISALRVELGFSGLVMTCDLDHRATQGDRALGDVAVA
FT                   ALAAGADLLLLSPNAVPRIGEVAEAIVRAVADGRLDASRLQAACDSVSAAAGRRPA"
FT   gene            503922..505079
FT                   /locus_tag="Bcen2424_6317"
FT   CDS_pept        503922..505079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6317"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_1512 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13049"
FT                   /protein_id="ABK13049.1"
FT                   /translation="MTSYRPAARVATRIAFFVAGFGAACWASLVPFVKQRAAIDEATLG
FT                   ALLLCVGAGSVIGMMLTGTLGTRFGSKPIVFGGGVGLAVILPLLAIAHDAATLGIALFG
FT                   FGAALGSLDVAMNINAVEVERMEGRPLMSGFHAQYSMGGFGGSALATFLLAARTGVFAS
FT                   MLLCSALMFAGILIARRHLIETPRRRGGPLLAVPRGIVLLLAGLVAISFLLDGVLLSWG
FT                   ALFISGKGLVPATQGGLGYMLFSIAMMAGRLSGDTLTTRIGDRSMMFWGGAVATAGMVV
FT                   LLVAPIAPVALAGFLLIGLGASNVVPIMFRRAGAQRAMSPSLAVVAITMTGYAGNLVGP
FT                   ASIGIIADQAGLSTAFWLLAGLVCLIPCCAGFVTHPRAARVRPAA"
FT   sig_peptide     503922..504005
FT                   /locus_tag="Bcen2424_6317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.699 at
FT                   residue 28"
FT   gene            complement(505150..505458)
FT                   /locus_tag="Bcen2424_6318"
FT   CDS_pept        complement(505150..505458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13050"
FT                   /protein_id="ABK13050.1"
FT                   /translation="MLFAIKLDYIRPTQEVHAHLEAHKAWLVKHVQAGSILFAGPLQGE
FT                   AAGFLLAYADHRRDIEQMIAEDPFDILGLATFDIQCCEPALRANAFPAHWAGGARPV"
FT   gene            complement(505470..506168)
FT                   /locus_tag="Bcen2424_6319"
FT   CDS_pept        complement(505470..506168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6319"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: bcn:Bcen_1510
FT                   (acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13051"
FT                   /protein_id="ABK13051.1"
FT                   /translation="MTPFGFRSNLSFPHCETEMKLLHLDSSILDGNSITRTLSAAVVAD
FT                   LRARHPSAEVTYRDLVRDEIAHLTGPIAAGFRDVATDAFDDDAIREHRVSDTLVTEFLA
FT                   SDVIVIGAPMYNFSVPSQLKSWLDRIAQAGRTFRYTERGPVGLASGKCVIVASARGGFY
FT                   AEGPLAGMDFQENYLNRFFGFLGVTDVRFVRAEGASKGQRVRDEGIALARAAIADVLAG
FT                   VPAPDARPVK"
FT   gene            complement(506165..506995)
FT                   /locus_tag="Bcen2424_6320"
FT   CDS_pept        complement(506165..506995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6320"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: bcn:Bcen_1509 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13052"
FT                   /protein_id="ABK13052.1"
FT                   /translation="MPFPPRPGRPHFLPTRQGRCPVSRFGRLLAAVAFMVTFASGHTIA
FT                   AAAPAVRNIVLVHGPFVDGSSWQPVITRLQHMGYHVTAVQNPLTSLDDDVAATENVLRR
FT                   QTGDVLLVGHSWAGAVITQAGNAANVKGLVYLSALAPDDGESVDDLLRSVGAPMTGLSP
FT                   DARGLIWLDDARQFQRVMAGDLPFERVNALTSTQQPIAAACFAGKVRHAAWHDKPRWYL
FT                   RTTDDNALEATVQQAIAQRIGATVTTIRSSHLSMLSHPDDVARLIDRAARTVHP"
FT   sig_peptide     complement(506852..506995)
FT                   /locus_tag="Bcen2424_6320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.419 at
FT                   residue 48"
FT   gene            complement(507243..508130)
FT                   /locus_tag="Bcen2424_6321"
FT   CDS_pept        complement(507243..508130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6321"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bcn:Bcen_1508 xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13053"
FT                   /protein_id="ABK13053.1"
FT                   /translation="MAAHGKANALIFHTTVSKFSNLVTDLDTIAAIGFDGIELGADKLE
FT                   AYLASGYGADDLKALLEDVYVPGMGFLTDIERQGRQASEMYARADALFELATLSGAQGV
FT                   QVLTGPVDVRSVVEWTQTGRTDRYAGVLGLPHARQIAVTAKNLARLADMAAERGLVLYL
FT                   EALSWAPVSGIDKSIQLIDAAGRDNVKIVIDYWHCHTSGVTPDDIAKLDARIIHGVHVC
FT                   DSLPFPGGIPDEQVLRDVPTGEGVIDLQQWTDAVKATGYRGWWSCELFCRKQQQQNAAT
FT                   VAAQLKRLLARLVA"
FT   gene            complement(508181..509851)
FT                   /locus_tag="Bcen2424_6322"
FT   CDS_pept        complement(508181..509851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6322"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bcn:Bcen_1507
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13054"
FT                   /protein_id="ABK13054.1"
FT                   /translation="MTHRDTKSVDYIVVGGGSTGCVIAGRLSEDERSSVALLEEGPRDR
FT                   SPYIHIPGAYYKTAQGPLLKRIPWHPAQGHARPAMPTMVQASVLGGGSSVNAMIYIRGV
FT                   PSDYDQWRDSGATGWGFDDVLPYFKRSEDNERFCNDVHGTGGPLRVSDIPHIHPLTKAW
FT                   LKACQQSGLPYNEDFNSGHPAGCGLYQITARDGRRSSAAVAYIHPALNRPNLTVRTGVR
FT                   VTRILIEKGRAVGVEFRRNGRIEQMRANREVIVSAGALSTPKLLMLSGIGPSAALQRHG
FT                   IAVEQDLPGVGRNLQDHIEISLVYQLNGPYSYDKYKKPHWKALAGLNYLLFRNGPAASN
FT                   LIEGGAFWWGDKEALTPDIQYFLVVGAGIEEGVDSVPGGNGCTINLGQIRPRSRGFVEL
FT                   SSPDPMDVPRVFPEYFSDPYDLEAVVDGCEKAIDIMGQPAIGKYIAQRIVPGKQAASRD
FT                   ELRKFVQQEAHAALHPCGTCRMGTDSDSVVDPSLRVHGIDGLRAADASIMPNIISGNLN
FT                   AVCIMIGEKAADLILGKAPLTRIGHASVPIDSEASRVTS"
FT   gene            510173..511210
FT                   /locus_tag="Bcen2424_6323"
FT   CDS_pept        510173..511210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6323"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bcn:Bcen_1506
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13055"
FT                   /protein_id="ABK13055.1"
FT                   /translation="MRIGIVAVEGSLLSPITGLADLFWMTAQALRAPPGGGAHGQPVVA
FT                   GFETVIASADGRALRDPQGRLIPVDTTFDELTQCDVALVTGMALGPDRLPPVSASTTQA
FT                   AAWLRARHRDGALVGAACAGTFVLGEAGLLNGRRCTTTWWLHHAFRQRFPKARPVWGTA
FT                   VEEQDRIVTTGGPLSWVDLALHVIRREAGADVARLAADISVADTTPLPQLVYAPRGYVN
FT                   ATDPLLLQAEQIVRHASPGMTAEALAGALGLSERTLHRRLKGLTSESPKGFITRVRIEM
FT                   ACVLLETPGASIKQVALQCGYGDETSFRRAFGQLIGMTPADYRRWSSRRNTRSTIDRDR
FT                   EVGDD"
FT   gene            511495..512172
FT                   /locus_tag="Bcen2424_6324"
FT   CDS_pept        511495..512172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6324"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bcn:Bcen_1505 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13056"
FT                   /protein_id="ABK13056.1"
FT                   /translation="MRILIVEDEPKTGAYLKKGLEESGFSVDLAKDGGEGLTLAQEERY
FT                   DVIVLDVMLPVLDGWAVLKRLRDTHTTPVLFLTARDDVQDRVHGLELGADDYLVKPFAF
FT                   VELLARIRTLARRGPPRETEHLAVGDLEIDVVRRRVKRGATRIDLTPREFSLLQLLARR
FT                   QGEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRAKIDDAFPVKLIHTVRGVGYVLEPK
FT                   DDA"
FT   gene            512169..513629
FT                   /locus_tag="Bcen2424_6325"
FT   CDS_pept        512169..513629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6325"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: bcn:Bcen_1504
FT                   heavy metal sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13057"
FT                   /protein_id="ABK13057.1"
FT                   /translation="MTRPRSLAATLALAFAATTLAAFALVGAYVYAGLERQVNTQDDLD
FT                   IVLAARHTRRLAGELESLDAARAHAERLTSQVLGNEALSMAVVDAGGDVLARHNVRLAA
FT                   LDEAPAAASTPLADAQLFAPHAVPVPANDRITADRLVTWTADGGTPMRGVVIEAALGDR
FT                   TPIRIAIARNMRDRADLLDGYRDRLKLAGGLGALFALLLGYWLIRKALAPLREIVDDTG
FT                   RITVDKLDTRLDASRAPPELRALVDAQNAMLGRLQQAFAHLSQFSADLAHDLRTPLNNM
FT                   RGATEVALARPRSVDEYQTLLESNLEEYDRLARMIENVLFLARAEHPSFVTRRRAFDVR
FT                   EELERIAEYFEGLADEAGSTLRVDGHGQLTADVELFRRAVGNLLANALRYTPAGGVITL
FT                   AVDETPDAVRVVVENPGEPIDPALLPRIFDRFVRGDPARSGGVPGGTAGLGLAIVRSVM
FT                   ELHGGTAQVESDARGTRFVLTFNRPPVA"
FT   sig_peptide     512169..512243
FT                   /locus_tag="Bcen2424_6325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.813 at
FT                   residue 25"
FT   gene            complement(513607..515151)
FT                   /locus_tag="Bcen2424_6326"
FT   CDS_pept        complement(513607..515151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6326"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_1503 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13058"
FT                   /protein_id="ABK13058.1"
FT                   /translation="MRLPHPLPFARRIVALGAVAALTACSTLPPYSPPAVAVPAHYAGA
FT                   PAVPAAQAGWHVAMPADAAARGAWWTVFGDADLNALEARVDVSNQTVKKAVADLQQARA
FT                   MVDYQHAGFLPTITAGAAQSRARVSQNRLGSSLAGKTTPDYQAGVAASWEPDLFGRVRD
FT                   AVTGAQANAAASAADLQAVKLSVTAELATDYFALRSLDTQKQLLDDSVRAYADALTLLE
FT                   QQLAAGAIDASAVAQAETQLESTRTQDTDIDASRAQLQHAIATLVGESASTFALPPRVQ
FT                   AFHVPAIPAGVPSQLLERRPDIAAAERRVAAANAQIGEARAAFFPDLVLSASAGLESSF
FT                   FAPWLAAPSLFWSLGPQLAGTLFDGGRRSASLRGAHAQYDGAVADYRQTVLVAFQQVED
FT                   QLSALDALASEAGSQQRATDAADLSLRLTTNRFNAGAVSYLDVVTAQTIALTNRRTADQ
FT                   IDARRIEAEVALLKALGGGWQASASAGADAESNTGKKDAAATARPQPAAVKQQAAG"
FT   sig_peptide     complement(515038..515151)
FT                   /locus_tag="Bcen2424_6326"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 38"
FT   gene            complement(515183..516619)
FT                   /locus_tag="Bcen2424_6327"
FT   CDS_pept        complement(515183..516619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6327"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_1502 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13059"
FT                   /protein_id="ABK13059.1"
FT                   /translation="MNDSIEPVAPPPAAEAATVATAVPAAARGAASDTPPPRRGRTLAV
FT                   PLAAVALAAALLALGIVPRIDARAAQRAQVAAQQALPVSVIVPGAAPADQTLTLPGSVA
FT                   PYADASIYARTSGYIAHWSVDLGTHVKAGQTLAQISAPDLDAQLRQARADEASAQANYD
FT                   YAKSTAQRWQDMLKTQSVSQQDTDTKVADMNAKRAMLASAQANVAHLAELVSYESVTAP
FT                   FDGVITARNVDVGTLVTAGGTPGSPGLSGELFHLEQTDTLRVFVDVPQDSATGVSAGTS
FT                   VYLTTPQYPGRRFAAQVARSAGAIDPVTRTLRVEIDVDNRDGALMPGAYAQAHLVLPSA
FT                   APALELPVSALLFRPNGVTVATVGANGQTALKTVQIGRDFGTRVEIVAGLAATDRVIDN
FT                   PGDAITAGEAVKIVSTSHDAAPVAASSASSASSASSASSAQAAQAAQPASATGMRNVPP
FT                   LRAAGVAPAASTPTPAPARG"
FT   gene            complement(516672..519920)
FT                   /locus_tag="Bcen2424_6328"
FT   CDS_pept        complement(516672..519920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6328"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bcn:Bcen_1501 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13060"
FT                   /protein_id="ABK13060.1"
FT                   /translation="MWIVRLALRRPYTFVVLALLIFIAGPLALLRTPTDIFPSIDIPVV
FT                   SIVWSYNGFSAEDMAKRITSNYERALTSDVDDIEHIESQSLNGVSVVKIFFHPGADINR
FT                   AIAEAASNAASILRILPPGTLPPNIITYNASTVPILQLGLSSDTLAEQQLYDLGNSFIR
FT                   TQLATVQGAAVPLPFGGKIRQIVVDLDTRALQAKGLAPIDVVNAINAQNLILPGGTAKI
FT                   GTHEYNVQMNGSTQTVAALNDLPVKTIGGNVVYVRDVAHVRDGYAPQTNIVRVDGKRAA
FT                   LLTVEKTGSASTLTIIDQVKAMLPKIAAGLPKALHIAPLDDQSVFVKAAVQGVVREALI
FT                   AACLTALMILLFLGSWRATLIIAITIPLAVLTSLLALSALGQTINIMTLGGLALAVGIL
FT                   VDDATVAIENITHHLELGAPLEEAILTGSGEIAVPTFVSTLSICIVFVPMFLLTGVARY
FT                   LFVPLAEAVIFAMIASYFFSRTLVPTLAMALMRAKGSGRPPRGVFAPLVHVARFQAAFE
FT                   HRFEAVRLRYRALLSAAIARRRRFAAAFLLACIASTGLYAFAGQDFFPSVDTGEIRLHL
FT                   RAPTGTRIEETARLTDEVEAKIRGVIPANQLAGVLDNIGVPVSGINLTYDSSDPIGTED
FT                   ADVLVTLKPDHASTAAYVAKLRNVLAQSFPGVTFAFLPADIVSQILNFGLPAPIDIQIV
FT                   GNKLDQNRAVANALLAKLRGVRGLVDARIQQPGDEPAINVNVDRTKAIQAGLEQRDVAQ
FT                   NLLIALSGSSQTTPNFWLDPRNGVSYPVLVQTPQYTVNSLQSLANVPLPAGTARSPQTP
FT                   AGGPAAGAPAQNLLGALGSFSRATQQAVVSHYNVQPVLDIFASVQGRDLGGVTGDVTKL
FT                   VDAARAQLPPGASIVLRGQVQAMHESFTGLLGGLALAISLVYLLMVVNFQSWLDPLVIV
FT                   GGLPASLAGIAWMLFVTRTTLSVPALTGTILCIGIATANSILVVNAARELLAGGEPPWQ
FT                   AALDAGFARFRPVVMTALAMLIGMLPMALGLGDGGEQNAPLGRAVIGGLAFGTVSTLLF
FT                   VPVLFGFVHAWLARRRDAAAARRAQAVPDTPALR"
FT   sig_peptide     complement(519828..519920)
FT                   /locus_tag="Bcen2424_6328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.819) with cleavage site probability 0.602 at
FT                   residue 31"
FT   gene            520219..520524
FT                   /locus_tag="Bcen2424_6329"
FT   CDS_pept        520219..520524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13061"
FT                   /protein_id="ABK13061.1"
FT                   /translation="MNNLIRAVLLSCALSAPIVAFAQTTDHAVTRAEVRADLVRVEKAG
FT                   YRPIGSDPYYPEDIQAAEAKVVAQQAQSAAAQPTDAARTATSSLASLDTQPLYEHH"
FT   sig_peptide     520219..520287
FT                   /locus_tag="Bcen2424_6329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(520596..522086)
FT                   /locus_tag="Bcen2424_6330"
FT   CDS_pept        complement(520596..522086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6330"
FT                   /product="asparagine:proton symporter, AAT family"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bcn:Bcen_1499 amino acid permease-associated region; TC
FT                   2.A.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13062"
FT                   /protein_id="ABK13062.1"
FT                   /translation="MASIPEPSTTGETDKRSWLESHEAGYHKTLGNRQVQMIAIGGAIG
FT                   TGLFLGAGARLQAAGPALAIVYLVCGAFSFLILRALGELVMHRPSSGSFVSYAREFLGE
FT                   KASFVAGWMYFLNWAMTGIVDITAVALYMHYWAPFAAVPQWIFALVALCIVATMNLIGV
FT                   KWFAEMEFWFALIKVAAIVLFLVIGTAILGTGMPVAGHGTGMHLITDNGGFFPHGLMPA
FT                   LVLVQGVVFAFAGVELVGTAAGECKDARKVLPRAINNVIWRIAIFYVASVVLLVCLLPW
FT                   SAYKAGQSPFVTFFGALGVPGIGSVMNLVVLTAALSSLNSGLYSTGRVLRSLSMGGSAP
FT                   AFLARMSGQSVPYAGILVTVAIYVVGVLLNYLVPSSVFEIVLNIASLGIISTWGFIVVC
FT                   QMKFRAAVRRGEVEDVSFRMPGAPVTSWLTLLFLLGVLVLMAFDYPNGTWTIASIPLVA
FT                   LLLVAGWKWLSRRARRALLKPTIPSIALTQNVLEKGEN"
FT   gene            522559..523365
FT                   /locus_tag="Bcen2424_6331"
FT   CDS_pept        522559..523365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6331"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_1498 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13063"
FT                   /protein_id="ABK13063.1"
FT                   /translation="MSPTTRPFPRRTWLAALFAAPVIALFAAAPAHADALDTIAKNGTL
FT                   RVAVPEDYPPFGSVGTDMQPQGYDIDMAGLLAKSLGVKLKLVPVNSANRIPYLTTNKVD
FT                   MVISSLGKTPEREKVIDFSSAYAPYFQGVFGPSDVKVSTPADLTGKTVGATRGALEEIA
FT                   LSQLAPNATIKRFEDNNATIQAFLSGQVQLIAAGNIVAAAILAKNPPRRPEVKFVIKNS
FT                   PCFVGVNKNEPRLLAKIDDAIAHAKQDGSLGEMSRKWLGQPLPAGL"
FT   sig_peptide     522559..522660
FT                   /locus_tag="Bcen2424_6331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            523455..524141
FT                   /locus_tag="Bcen2424_6332"
FT   CDS_pept        523455..524141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6332"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_1497 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13064"
FT                   /protein_id="ABK13064.1"
FT                   /translation="MSYQLQFGELSEYVGVFASGAAITLALTAVATVLGVAVGVLGAAA
FT                   YSADARAAVRLRPLIGAYVEAIRNTPFVVQLFFIFFGLPALGVHIDEYTAAILAMTLNL
FT                   GAYSVEIVRAGVAAVPKGHLEAASALAMSRAQMLRHVVLPQALAKVFPALSSQIVITML
FT                   GSAVVSQISVADLTYAASYIQSRNFRAFETYFVITLAYLAMALLLRATLGAMGRRLFTR
FT                   RVRGAR"
FT   gene            524138..524788
FT                   /locus_tag="Bcen2424_6333"
FT   CDS_pept        524138..524788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6333"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_1496 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13065"
FT                   /protein_id="ABK13065.1"
FT                   /translation="MTDFTLGQILANLLLAARWTIVLSIVSFVTGGLVGLGLLVMRVSG
FT                   STVLRGIAKLYIEVFQGTPLLMQLFIVFFGLPLVGLDVPPWVAATAGLTFFTSAYLAEI
FT                   WRGCVEAVPKGQWEASASLAMSYVEQLRHVILPQAARIAIAPTVGFGVQAVKDTALVSI
FT                   IGFTELTKVGIAISNATFRPFVVYGLVALIYFALCYPLTRYARTLQRRWHAAR"
FT   gene            524775..525524
FT                   /locus_tag="Bcen2424_6334"
FT   CDS_pept        524775..525524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6334"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_1495 ABC transporter related; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13066"
FT                   /protein_id="ABK13066.1"
FT                   /translation="MPLVETRGLEKNFGTHHVLKGIDFSVERGQVVSIIGRSGSGKSTL
FT                   LRTLNGLESIDAGTISVDGERVDARHADLRALRLKVGMVFQQYNLFPHLSAGQNVMLAQ
FT                   SVVKKAHRQQARAIAELMLERVGLGDKFDAFPEQLSGGQQQRVAIARALAMKPSVLLCD
FT                   EITSALDPELVGEVLGAVEQLAREDMTLIMVTHEMNFARAVSDRIVFMHQGRVWESGTA
FT                   DEIFERPQTVELTRFLGSVRNTETVTR"
FT   gene            525698..525979
FT                   /locus_tag="Bcen2424_6335"
FT   CDS_pept        525698..525979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13067"
FT                   /protein_id="ABK13067.1"
FT                   /translation="MNKLIRAVLLSCALSAPIVAFAQSADHPVTRADVRADLIQAERDG
FT                   TLPTSNWDYPPSTQTIARNRELYAIAHGDRPTAMAATSSATVSTASAQ"
FT   sig_peptide     525698..525766
FT                   /locus_tag="Bcen2424_6335"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 23"
FT   gene            complement(526173..527315)
FT                   /locus_tag="Bcen2424_6336"
FT   CDS_pept        complement(526173..527315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6336"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG:
FT                   bcn:Bcen_1493 monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13068"
FT                   /protein_id="ABK13068.1"
FT                   /translation="MEHGAGRKAVIAGGSVGGLFAATALRAAGWDVRVFEQSPHALDSR
FT                   GGGIVLQPPIERAFAFGGVALPRETGVDSIDRIYVDAHDRIVQRFAMPQTQTGWNVIYT
FT                   ALKRALPAGVIHAGDAFERFEQDGERIVAHFASGRAETADLLIGADGGRSTVRAQLLPD
FT                   VRPTYAGYVAWRGLVDEHALPEQVLVLLRERFTFQQGDRHLFLTYLVPGADGTIEPGKR
FT                   RVNWVWYRRLASDRMPSLFVARDGTQRDGSLPPGAMRDDHRAELVDAADRMLAPMLAAL
FT                   VDATAAPFAQAILDLAVERMAVGRAVLLGDAACMVRPHTAAGVAKAADDAVGLAEAVRD
FT                   VARGAAFDAALVGWDARQRAASAAIAARGIALGARLMGAA"
FT   sig_peptide     complement(527232..527315)
FT                   /locus_tag="Bcen2424_6336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.761 at
FT                   residue 28"
FT   gene            complement(527357..528232)
FT                   /locus_tag="Bcen2424_6337"
FT   CDS_pept        complement(527357..528232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6337"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_1492
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13069"
FT                   /protein_id="ABK13069.1"
FT                   /translation="MTTDTLALTHHTVTANGIRQHVIDAGAGPVVVLLHGFPETSFAWR
FT                   FQIPALARHYRVIVPDLRGYGETDKPAAGYDKRNMARDLAALLDALGIERIALVGHDRG
FT                   ARVATRFAKDFPERVERLVVMDNVPTRIVAQNMTAQTARAYWFFLFHQVPDLPEALIAG
FT                   KEAEWLSYFFADWCYNPHAISGDAFDTYVRAYRRPGAVRGALADYRANAEDVQQDLVDA
FT                   DVRIACPTMAIWGEDFYAVGKMFDMKAVWEGMATHLRAEPIAQCGHLPHEEQPERVNAL
FT                   LVDFLRGWAG"
FT   gene            528536..528772
FT                   /locus_tag="Bcen2424_6338"
FT   CDS_pept        528536..528772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13070"
FT                   /protein_id="ABK13070.1"
FT                   /translation="MSYLISPGAGVAVGLLHPLVRVQSPAPPLIALARLFGIVVREHAI
FT                   PLVPAPFRALAAQARDADTIDTTAEATTCSPRK"
FT   gene            528754..529491
FT                   /locus_tag="Bcen2424_6339"
FT   CDS_pept        528754..529491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6339"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bcn:Bcen_1490 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13071"
FT                   /protein_id="ABK13071.1"
FT                   /translation="MQPAQVTAAGAAAPDRVRGEDVFLASIAGYVDTLGFVALFGLFTA
FT                   HVTGNFILIGSGLAGVGQGLMIKWLAFPAFIAGIVAARVLDHRMRVRGHGVRARSLYAL
FT                   QTILLAGFMLAGVAASPIGSADAPATIVCGLLGAAAMGVQNAHGRLTARTVVANTVMTG
FT                   NVTQAVIDAFDWLVPIAAPAEREAACARLRRTLPPVVGFALGAGAGASAYVYAGFWTLV
FT                   LPLAALGFLTWRSGRTGEPSASR"
FT   gene            complement(529647..530555)
FT                   /locus_tag="Bcen2424_6340"
FT   CDS_pept        complement(529647..530555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6340"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1489 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13072"
FT                   /protein_id="ABK13072.1"
FT                   /translation="MKLSFEALEALDAIDRTGTFADAAELVHRVPSALTYLVQKLESDL
FT                   DVALFDRSGRRAKLTRAGRVVVEEGRRLLHAAEQLERKAQRAQQGWETEVRVCIAEILP
FT                   FDMMWPYVHAFYALEMDTRLRLSTEVLGGTWDALISRRADLIVGAAGEPPELPDIVAQP
FT                   IGTLRHVFAVAPTHPLAALPEPLSMASIVEYRGAVISDTSRELQPQSVATDAGQPYLAV
FT                   PTLAAKLAAQCEGLAVGTLPDCIAAPAIAQGRLVAREVTGMRDTTHCYIAWRTDEAGRA
FT                   LRWWVEQLGHHDLVDRFTALV"
FT   gene            complement(530714..530992)
FT                   /locus_tag="Bcen2424_6341"
FT   CDS_pept        complement(530714..530992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6341"
FT                   /product="protein of unknown function DUF1427"
FT                   /note="PFAM: protein of unknown function DUF1427; KEGG:
FT                   bcn:Bcen_1488 protein of unknown function DUF1427"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13073"
FT                   /protein_id="ABK13073.1"
FT                   /translation="MKPYIASLLAGILAGVVYALIGVQSPAPPAIALVGLLGILAGEQI
FT                   LPVVRRMFDGIRLGTAWRDAKCSQHMFGALPGAHADASAKHRESTPT"
FT   sig_peptide     complement(530933..530992)
FT                   /locus_tag="Bcen2424_6341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.983 at
FT                   residue 20"
FT   gene            531299..531985
FT                   /locus_tag="Bcen2424_6342"
FT   CDS_pept        531299..531985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6342"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bcn:Bcen_1487
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13074"
FT                   /protein_id="ABK13074.1"
FT                   /translation="MSNPKLEVLTPHNSQLIFIDQQPQMAFGVQSIDRQTLKNNVVGLA
FT                   KAAKVFNIPTTITTVESESFSGHTYPELLDVFPNQKTLERTSMNSWDDQKVRDALAANG
FT                   RKKVVVSGLWTEVCNTTFALCAMLEGDYEIYMVSDASGGTTQAAHDIAMQRMVQAGVVP
FT                   VTWQQVLLEWQRDWARRETYDAVMAIAKEHSGAYGMGVDYAYTMLHKAPQRTATPHESI
FT                   APVPAK"
FT   gene            532153..532320
FT                   /locus_tag="Bcen2424_6343"
FT   CDS_pept        532153..532320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6343"
FT                   /product="protein of unknown function DUF1427"
FT                   /note="PFAM: protein of unknown function DUF1427; KEGG:
FT                   bcn:Bcen_1486 protein of unknown function DUF1427"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13075"
FT                   /protein_id="ABK13075.1"
FT                   /translation="MEPYLVSLGAGVLIGVIYSAIKVRSPAPPLIALVGLLGMLIGVQA
FT                   LPPVKQLFGF"
FT   gene            532340..534229
FT                   /locus_tag="Bcen2424_6344"
FT   CDS_pept        532340..534229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6344"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bcn:Bcen_1485
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13076"
FT                   /protein_id="ABK13076.1"
FT                   /translation="MTATVTQPDLILHNGRFTTLDRANPVATAVAIAAGRFVAVGSEAD
FT                   VMPLAGRATKVVDLGGRGVLPGLIDNHCHVIRGGLNYNMELRWDGVPSLALAMEMLKQQ
FT                   VAITPAPQWVRVVGGFTEHQFVEKRLPTIEELNAVAPDTPVFILHLYDRALLNAAALRV
FT                   VGYTKDTPEPPGGTILRDAAGNPTGLLLANPNATILYATLAKGPKLPFEYQYNSTRHFM
FT                   RELNRLGVTGVIDAGGGSQNYPDDYEVIRKLHDAGEMTIRIAYNLFTQKPNAEKEDFVN
FT                   WTKSVKYHDGTDYFRNNGAGEMLAFSAADFEDFRVARPDLPAQMEDDLEGVVRVLAENR
FT                   WPWRMHATYDETISRALDVFEKVNEDIPLEGLNWFFDHAETITEQSMDRIAALGGGIAV
FT                   QHRMAYQGEYFVERYGAQAAEATPPVAKMLAKGLKVSAGTDATRVASYNPWVSLAWLVT
FT                   GKTVGGLRMYPQRNLLDRETALRMWTEYVTWFSNEEGKKGRIAVGQLADLIVPDRDFFG
FT                   CAEDDIAGTTALLTVVDGKIVWGAGPFASHDAPIPPAMPDWSPVREFGGYGGWGATQRN
FT                   GAPLQRAAAAAMCACANECNVHQHAHAGAWGRTLPTSDAKGFWGAFGCSCWAV"
FT   gene            534402..535355
FT                   /locus_tag="Bcen2424_6345"
FT   CDS_pept        534402..535355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13077"
FT                   /protein_id="ABK13077.1"
FT                   /translation="MSSFNLRNLLRITAAASAVLAALLAGTPALADETHLDDIASPAAA
FT                   ARSPAIAVGPQYDTTHVCVAPEDFDRFTDSFVATFGGKKSKQGVFQVTPTPSQTMSQLV
FT                   LTPVGTISVFGFKTPIPYPFCEERTGYLVTDMDVAVKSARAHGADIVVSTFPDPIGRDA
FT                   IVRWPGGVNMQLYWHTQAPNYDALQTVPENRVYVSPESASKLARNFAAFSHGKIVSDVR
FT                   HAPGIEIGRPNDTYRRIRIESGFGKMTVLATDGHLPYPFGREMTGYEVADLAATLKQAE
FT                   AAGVTVLVPPFKSDGRDAALVQFPGGYVAEIHARSK"
FT   sig_peptide     534402..534497
FT                   /locus_tag="Bcen2424_6345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            535370..536836
FT                   /locus_tag="Bcen2424_6346"
FT   CDS_pept        535370..536836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13078"
FT                   /protein_id="ABK13078.1"
FT                   /translation="MKRSWRGALPCVVLAGGAALHAGSAVGAEADAGVTAAGAAASPAA
FT                   AAASCTAKRPTVSFNRWQEDWSVLANPCVPRKPFDALKYIRLGDDPSTYLSLGANLRER
FT                   FELNNAPLFGLGAAHDDNYVIQRANVHADLRYRGHFQAFVQFVDARPFGKDTVGPVDKD
FT                   QLDLEQAFVAYVDQLGPGTFKTRIGRQEMAFDLQRFVSVRDGPNVRQAYDGLWTDYEIG
FT                   KWRLIGYVTRPVQYRNAAVFDDVSNRHLRFDGVRVERTGTGPGDLSAYWSRYTRDNARY
FT                   PDASGTERRDVFDMRYAGKTDGFDWDVEAMLQTGHVGQDTLGAWAFGALGGYTFAKTAG
FT                   TPRIGIQVDGASGDAHPGDGRVGTFNPMFPNGYYFTLAGYTGYSNLIHVKPSLTFKPAS
FT                   SVTVLTAVGFQWRQTTADAIYGQGMSAVPGTAGKGGAWTGMYAQARVDWLVNANVALAL
FT                   EAVHFQLGSSIRALGARNADYVGMEAKFGW"
FT   sig_peptide     535370..535453
FT                   /locus_tag="Bcen2424_6346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.885 at
FT                   residue 28"
FT   gene            complement(536865..537770)
FT                   /locus_tag="Bcen2424_6347"
FT   CDS_pept        complement(536865..537770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6347"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1482 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13079"
FT                   /protein_id="ABK13079.1"
FT                   /translation="MDKFSALRAFVEVAEAGGFSSAGRRLDLAASSVVRAVDALEASLG
FT                   TVLLNRTTRQVTLSDAGAVYYARAKRVLGELADADALVADRGDAPSGPLRVSVPVAYGL
FT                   RRLAPHVAAFVARHPKLDLDLQLTDERVDLVSARIDVAIRLGDAAPTAEVVARPLGTFR
FT                   RYVVASRAYLDAHGTPATPGELVDHACLRFHFGVDQQTWTFVGAQRTTQVVVTGRLKSN
FT                   HSEVLREAALDGAGIALLPDWLVDTDLEAGRLQRLFDQYDVTPGSARAVITALYLPNQR
FT                   GSKRVTAFIDFVESLARAQP"
FT   gene            537987..539033
FT                   /locus_tag="Bcen2424_6348"
FT   CDS_pept        537987..539033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6348"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcn:Bcen_1481 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13080"
FT                   /protein_id="ABK13080.1"
FT                   /translation="MKTLFQHACVAQAARLLIVAGCAGLLAPAAFAQAGMQPDAHANAQ
FT                   PETQSTTPAAAAGRRPPGFYRQKIGDFTVIALSDGTHPFPVDTVFRDISKDEIRRDLDR
FT                   AFLEPPVQGSINAFLVDTGSKRILVDAGAGTLYGDCCGKLLDDLRAAGYAPAQIDEVLL
FT                   THLHKDHVGGIASNGVMTFPNAVVRVNAVEAAYWLDPANKAHAPAFLASFFDAAAAAVA
FT                   PYVAAGRFKTFRGDATLAPGIRAVPMPGHTPGHTAYLIESGHAGLLAWGDIVHVAAIQL
FT                   RDVDATVQYDSDAGTARRTRRDTLKRVAARRYLVGAAHIAFPGLGHLRRDGAQYDWVPV
FT                   NYDATPVR"
FT   sig_peptide     537987..538091
FT                   /locus_tag="Bcen2424_6348"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.522 at
FT                   residue 35"
FT   gene            complement(539058..539978)
FT                   /locus_tag="Bcen2424_6349"
FT   CDS_pept        complement(539058..539978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6349"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1480 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13081"
FT                   /protein_id="ABK13081.1"
FT                   /translation="MSDTVIAAPVAAPSRRPKDTLGCVSSLLAKDVETTSGGLKLHRKC
FT                   MREAHVERIEMPACDRGFLVGVSLTGGHRRTLYGRAGASERRFQHHSIYIRDFSRHFHA
FT                   DLYGNFDFVLVELPHAYLARIGPEHGGSPVDGLTCRVDARDPVLGHLAHAVADSLDTPG
FT                   PLNALFIEQVGLAMGAHLVRRYGNARTRELEHKGMLSPAKVARAQELLMEKADLGVSIE
FT                   EVANECDLSRGYFIRAFSRTTGRTPHQWLLEQRVMRARELIETSDMTLADIAVACGFAD
FT                   QSHLNRLFARIVGHPPGAWRRARSR"
FT   gene            540377..543298
FT                   /locus_tag="Bcen2424_6350"
FT   CDS_pept        540377..543298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6350"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   Tetratricopeptide TPR_4; KEGG: bcn:Bcen_1478
FT                   tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13082"
FT                   /protein_id="ABK13082.1"
FT                   /translation="MIQIGTLSVDFEQRDIRRHGASLRIGARALDILEVLHRASGSVVS
FT                   KDDIMDAVWPGLIVEENRLQVHVATLRKALGASRDLIKTVPGRGYLLVASASPGPDLVP
FT                   AAEAPAVAVPPAVAALPDACTSSLLAPLVGRDAEIAQIVDMLERTPVITLVGAGGIGKT
FT                   SLAVRVAHGMRSRAHERVLFVELARASTRDDMLIALAAELGLDTPGVPAIDRIGDAFAT
FT                   SRCLLVLDNAEHIVDLVASLVETLTSSAGSLRVLVTSREPLHISAEAVLRMSPLAVPDG
FT                   NASAAEIVRCSAVELFLERVRAAAPDCAVDEAGVRLIGDICRRLDGLPLAIELAAARVA
FT                   TLGLAVVASRLDDRLNLLTGGLRSALPRHQTLRATFDWSYVLLDRAARALFRRMGCFIG
FT                   PFSFDAARAVATEPGTSAADMIAVLGELVAKSLVTVEFDGAYARYRLTESTRAYALEKL
FT                   HNEGEFERIVARHAAYERERAGAPPAAPVLLADVPPADAPAPAVDEPVDAAEAGGVPEP
FT                   DRLARALLEPSRMRACTARARQVLDGLDTDATGPVDAAREMRLRAACASALLHTDGDAL
FT                   AAAAMWDRTLGLAAHIGDDAFDARALVGLWNTMLTLSDIHESLRYATRFERAAERRGDR
FT                   SQRLLANTMVATSLHYFGEHAQARERLEAATAELADAGEPPCAQAALGVDMATLGRTML
FT                   IRLLWMQGEPEHAMRVAAQAVEHARRDPSPLPLCVVLGAAAVPIALRYGDHDITSDYLA
FT                   TLRATADAHGFDIWRSHAECLTGQFDIQAGHPGAGLARLEPALRRVEASGFRRVLAPLT
FT                   VAYAEGLVRTGRADEACTRLDATLARCRAHGEHLFVPELLRVRGVAMLEQARIVGADLA
FT                   AAYEADGHRHLQMAIQTANAQGAAMWALRSSLDLADHLIERGHTAQASALVAGVARHFD
FT                   PHSRAHDVRRLLRVQNFVRQGAPLAPCLTRARRDTADAAQQAA"
FT   gene            543347..545332
FT                   /locus_tag="Bcen2424_6351"
FT   CDS_pept        543347..545332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6351"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bcn:Bcen_1477
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13083"
FT                   /protein_id="ABK13083.1"
FT                   /translation="MPMRAVRPLSPVRRPAGRPAPRRAQARTGGPTVLRATEPARSADL
FT                   VVFNGKIATQDEQRSFVRALAVKDGTIVATGDDRDVLRHAHDDTACIDLHGRTVIPGLI
FT                   DAHLQAIRGGMNFNLEVRWDGVPSLADALELLGRQVRRTPAPHWARVAGGWTALQFAEK
FT                   RGPTTAELNAIAPDTPVFVQHLADSAWLNAAALRALGYGRDTPDPPGGELRRDRHGRPT
FT                   GLLLARQDPAVLDAVLARAPTLDAADRVNSTRQFMHALNRVGVTSAIDAGGDGLAYPDD
FT                   YAAVATLARRGELTTRIAYALGARHAGRELDDFAKWIALTAPGDGDAFLRASGAGERLL
FT                   FSAVDLGNFLEPRIELPASVEVELAAVVRLLVHHRWPFRLQATYDESIGRFLDVFEAVD
FT                   RDTPFDGLRWCFDCCETISDANIARVAALGGGITVQPRMAFQGEAFIARHGAAAATRAP
FT                   PLRAMLAAGLPVGAGSGATGAASYNPFVALYWMVSGRSVGGTALYPARNRLGRMEALRR
FT                   YTAGSAWFSADEHRKGALVPGRYADFAVLSDDYFTIDVRRIPTLSSVLTVVDGRVVHAE
FT                   QEFSPLAPPPPPVSPAWSPVAADGAVGADVRDRSHASASGDACGVPGVDACRARGDGRR
FT                   FARPRYPTASAAAERCEAFGRCCVAF"
FT   gene            545426..546100
FT                   /locus_tag="Bcen2424_6352"
FT   CDS_pept        545426..546100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6352"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /note="KEGG: bcn:Bcen_1476 metal-dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13084"
FT                   /protein_id="ABK13084.1"
FT                   /translation="MNAAHPRASATGDEVAGVRIPRTPVTVEAADAARASLPAALAAHA
FT                   ARVFVFASLAARRAGDACDADALYVAAMYANMGLSPAYCRSTERYELDGADAAHALLLR
FT                   HRRSRRMRDDVWHAVALHTTPGVAARASPLARALACAVSTDLMATDFDAYTADERAALL
FT                   AAYPRGSGFREAYLDMVARGVEHRPQSTFGTWSADVLERADPDFHRPNFCGRVLGARWN
FT                   DT"
FT   gene            complement(546174..547286)
FT                   /locus_tag="Bcen2424_6353"
FT   CDS_pept        complement(546174..547286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6353"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bcn:Bcen_1475 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13085"
FT                   /protein_id="ABK13085.1"
FT                   /translation="MSSLLSAYDLRGLALPNRVVMGPMTRSRAPSRGLPTELMAEYYAQ
FT                   RASAGLIVTEATNVSRASAAFELTPGLVDDAQAAAWKIVTDVVHANGGRIFAQLWHGGR
FT                   VSSLTLLGGAAPLSPSGVNDDLEQLQVWAQLQNGYYTKIHATPSRAMTTDEVVATVDEF
FT                   RQAAARAMAAGFDGVEIHAANGYLPHQFLSSTLNRRDDRYGGSVANRARFLEEIVDAVG
FT                   GVMPLSRVGVRISPYAKYNNVRDADPDATLAYVGRMLNAAGVAYLHAADTNGWSGEPDL
FT                   PRIVEHARRSFHGTLIVNGGISPEAASALIDAGDADLVAFARAYIANPDLVERIAARAP
FT                   LAQPKSIGWYGGERAGYVDYARHDAAQSPA"
FT   gene            complement(547365..548582)
FT                   /locus_tag="Bcen2424_6354"
FT   CDS_pept        complement(547365..548582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6354"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_1474 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13086"
FT                   /protein_id="ABK13086.1"
FT                   /translation="MSTDSTPLAPPAHGVKLTQGLILLFAFSCGAIVANLYYAQPITEL
FT                   IAPGLHMSGNTASLIVSLTQIGYALGLFFIVPLGDLLENRKLMIVTAVVSIASLAAAAL
FT                   VRTPGLFLAISLLIGFSSVAVQILVPLAAHLAPDHSRGRVVGTIMSGLLLGILLARPLS
FT                   SVVADAFGWRFVFAAAAVLMTLVTAVLALTIPSRQPDHRATYFELIGSLLHLVRTMPVL
FT                   RHRAFYQGLMFASFSLFWTAVPVELTRHYGLSQSAIGLFALVGAIGATSAPVAGRLADA
FT                   GHTVRATLIALVAGALAYAVGFVHGTGLYGLVVTGIVLDFAVQMNMVLGQREIYALHAA
FT                   SRNRLNALYMTSIFVGGAVGSALASPLYEHGGWPLVAAVAGAFPIVALAHYLLVGRPHA
FT                   QRHAAG"
FT   gene            complement(548764..549681)
FT                   /locus_tag="Bcen2424_6355"
FT   CDS_pept        complement(548764..549681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6355"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1473 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13087"
FT                   /protein_id="ABK13087.1"
FT                   /translation="MDTLLSMRVFTRIVETGSFTRASDTTGLTTPRVSALLSALEQHLG
FT                   CRLLNRTTRRISLTEDGQAYYERSVAVLREIDDMEASVSQARNVPRGRLKVNLPPAMAK
FT                   QVVVPALPAFLDAHPDIMLELGVTDRQIDLVGEGVDCVVRIGALDDSGMIAKRIGSLTT
FT                   CTCGSPAYFARCGEPRTVDDLAQHVAVSHISADTGRPRPWDYVVDGEPRIVQMCGTVAV
FT                   NDADNYIECGVAGIGLIKTSLYLVEPYLKSGRLREVLTDFNAPARPISVLYPPNRHIPV
FT                   KLKVFVDWLAGLFEQIPTLQGKRG"
FT   gene            complement(549785..552046)
FT                   /locus_tag="Bcen2424_6356"
FT   CDS_pept        complement(549785..552046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6356"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding; KEGG: bcn:Bcen_1472 aldehyde oxidase
FT                   and xanthine dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13088"
FT                   /protein_id="ABK13088.1"
FT                   /translation="MNSHDDIDEGRRHFIVSGALFVTFSLAPASRAAAQLVIADEGAAV
FT                   HVAKATQALAGSLKTNPLLDAWVKIAPDGKVTVFTGKVELGTGVRTALLQVAAEELDMK
FT                   PSLITFLTADTGASPDEGLTAGSHTMADSGSALLNATAQVRALLVEGAAKRFGVDPGVL
FT                   TTADAVIKAPDGRTMTYGDAIRTVDLHRNAAPTSPLKNPATFAVIGTSLPRVDIPNKVT
FT                   GGVSYVQDMQLPGMLHARVVMPPVYDATLLSFDEAAILKLPGVVRIVRNGSMLAVVAQG
FT                   EWQAVVAQRALAAGCRWSPGRKLPERGTVHADLKRISTQRIEIANTHAATAPAVKTLNA
FT                   TFLKNYLLHGSIGPSCSVAHLENGMMTVWTHSQGVYPLRDALAEMLSMPKASVRCIHTE
FT                   GSGCYGHNAADDAAAHAALIAAAMPGKPIRVQWMREQEHTWDHFTPAMVTEVSASLDAG
FT                   GRIVDWNYALWSSSHNERIVNAGRLLPARMLEPPFVPAPSTPMLQPEGGGDRNAIPLYA
FT                   LPNQHIVNNFSPTMPLQTSAMRSLGAHTNIWAIESFMDELARAAGVDPVEFRLRHMEDH
FT                   RARQVIQLAAKHFGWPRPPRARNRGVGFAFGKYKNLMAYVAIAVEVSVVPETGQVTLEH
FT                   AEAAVDAGQIVSPDGIRNQIEGGIVQAASWTLYEALKYDTERIRSFDWSSYPILRFSAV
FT                   PQNVKVHLVNRPGAPFLGAAEASMGPTAGALANAIFDATGQRMREMPFAGDALRKRIDA
FT                   "
FT   sig_peptide     complement(551948..552046)
FT                   /locus_tag="Bcen2424_6356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.370 at
FT                   residue 33"
FT   gene            complement(552046..552546)
FT                   /locus_tag="Bcen2424_6357"
FT   CDS_pept        complement(552046..552546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6357"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bcn:Bcen_1471 (2Fe-2S)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13089"
FT                   /protein_id="ABK13089.1"
FT                   /translation="MITLTVNGVRHTLDIDPSTPLLYALRNDLHLHGAKFGCGLGQCGA
FT                   CTVIVDGKPTFSCLMPVAAVGARSVRTIESLGTAEHPGPLQRAFIEHQAAQCGYCIAGM
FT                   IMRAQALLERNPKPTEQELRTHMEPNLCRCGTHMRILAAVRSVAGLPAPEPASAPVTIS
FT                   KGL"
FT   gene            complement(552543..553829)
FT                   /locus_tag="Bcen2424_6358"
FT   CDS_pept        complement(552543..553829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6358"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: bcn:Bcen_1470
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13090"
FT                   /protein_id="ABK13090.1"
FT                   /translation="MKHKRLWFGAAGIAVVGLAVAIGIMVRPSIAPIDPPAPASFDPQL
FT                   VRAGARVVALGDCIVCHTAKDGKPFAGGLPLATPFGTIYATNITPDAETGIGRWSRDAF
FT                   ARALRTGIGRNGQPLYPAFPYIHFTRMSDDDIAAAYAYLMTREPVHATAPANDLIFPLN
FT                   FRPLVAFWNVLFLREGAYQPDPAQSAQWNRGRMLVDGLGHCASCHSPLNAIGGEQRGRA
FT                   FDGGIVDGWEAPPLNALGQAARPWTQAQLVTYLRTGRASEHGAAAGPMLPVTRDLATVP
FT                   VEDVEAIAAYILSIQKPANARATAAAKPVERAATTPAAQRGATLFQASCAQCHGPAAPM
FT                   QSIGERPTLSFSTAVNADTPRNAIQMMFNGIGWHGEDTLNYMPSFIDQYDDAQIADLAA
FT                   YVRETYTDRPAWPGVDAMAAKLRKEDTAR"
FT   sig_peptide     complement(553764..553829)
FT                   /locus_tag="Bcen2424_6358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.756 at
FT                   residue 22"
FT   gene            554269..555939
FT                   /locus_tag="Bcen2424_6359"
FT   CDS_pept        554269..555939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6359"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bcn:Bcen_1469 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13091"
FT                   /protein_id="ABK13091.1"
FT                   /translation="MPARVAIRRRVAAADVPADQAHPQMHPAAARSDAFLTVVLVGVEH
FT                   ACFVEMRTGVGHLALRCRRGSDACDGPARGRKRDGYATLCGVAARPDLNCHEAARAARA
FT                   GGVQSRMRPAAAPPHRPDRIRHRHHREALMEQPQHVRIVGLPRSRDAYAIRDFLQRRMI
FT                   AYDWCELTSDADCAQVLGIAPLRDIRLPVVIFPDGSRLYQPTLAEIAARLGWVARPRFV
FT                   EYDVSIYGAGPAGLSAAVYAASEGLRAVVIERGAIGGQAGTSSLIENYMGFPDGIPGAE
FT                   LAERAREQAVKFGVELLTMREGVHATFVDGKIRVELADGSILIARANICATGIEYRSLG
FT                   LPEEPAFLNAGLFYGAGSSEAPMCAGEQVFIVGGGNSAGQAAMNFSRHARQVTMLVRGA
FT                   SLADTLSRYLIDRIERTPNIEVRYRSSVAALHGDGWLDAIELRSADGTRERLPATRLFV
FT                   CIGGAPNTDWARDTDIIRNPDGYLVTGGDLYDCPAFERVWPLERRPYHLETSVPGSFAA
FT                   GDVRSGSVKRVASAVGEGAMAVTFVHRFLGEDAHRLARA"
FT   gene            complement(555965..557401)
FT                   /locus_tag="Bcen2424_6360"
FT   CDS_pept        complement(555965..557401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6360"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_1468 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13092"
FT                   /protein_id="ABK13092.1"
FT                   /translation="MTRVFALLAASLLAACSIAPQPLAPVPVETDRFRHADPATDAHAP
FT                   SLAAWPAWFGDSQLGRLVDAALAHNLDIRAAAARVDQAQALLGVREAALAPTVRVDPSF
FT                   SRTRVSGTVDNALPKRTMHNWSVPVAASYEVDLWGRLRGDADVGEQNLLQAAADRDAVR
FT                   LRVATEVAVDYLTLRYVDDDLVTLVRAIGLRRTALDVIAARVRAGAASDLDGLRASADL
FT                   DTAHADLAESRRLRENLVDALAVLTGVSPTAFDVDTGAVPVQVPEVPAGLPSALLAQRP
FT                   DVFAAARRADAASLELGIARTAWLPTLTLTADGGFATRDLRSFLDRNSSLWSLGANVAL
FT                   TLFDGGKRDAAVAAARAGTNVADADYRATAIGALRDVQDALNDIAAQKERIVRYDSAAR
FT                   ATDAAARLSLSRYAHGYVSYLEVIDADRDALNARRQLIHSRQALAVATVSLVRALGGGW
FT                   TPPAHAGRGGLRDATQADAR"
FT   sig_peptide     complement(557348..557401)
FT                   /locus_tag="Bcen2424_6360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.448 at
FT                   residue 18"
FT   gene            complement(557398..558465)
FT                   /locus_tag="Bcen2424_6361"
FT   CDS_pept        complement(557398..558465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6361"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_1467 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13093"
FT                   /protein_id="ABK13093.1"
FT                   /translation="MRQILPVRWSLPIMTPPTPAPSPAAPARSRRLAVVAIAVIALLLV
FT                   ALLVYEFYARDRGTDDAYVTGHLHVISPRVAGTVEHVLVDDNQFVHAGDALVQIDRRDF
FT                   DVRVAAQRARVAQAHADASRARALIEQADAALVSAHADAEKAELDYARARELTRETPRG
FT                   LSKQEFDAADAARKSARARVAAADAQRRSALAAAQAAEAASSQNDAELRDALLQLGYTA
FT                   VVAPSDGYVGKKTVETGEHVAPGQALLTLVEPHPWIVANFRETQLRHVRAGDAVQLRFD
FT                   ALPERAFSGRIDSLSPATGAQFALLPPDNATGNFTKVTQRVPVKILLDGPAATEPRIRP
FT                   GLSVVVTLQPGSESR"
FT   gene            558510..560090
FT                   /locus_tag="Bcen2424_6362"
FT   CDS_pept        558510..560090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6362"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_1466 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13094"
FT                   /protein_id="ABK13094.1"
FT                   /translation="MNTTFATGSAVPAPAAGPASDIPTFRSIAAIAAVLLGAIIATLTS
FT                   RITSLGLADVRGALGIGFDEGAWINTAFTASQMFVGPLAIAAAFMFGTRRVLVAGAVVF
FT                   LGAETVLPLCTQFGAFIVCQAIAGLASGVFVPLTVGFVVRTLPPRLIPFGIAAYAMNLE
FT                   MSLNLSATLEGWYSEHLSWRWLFWQNAALTVPFIACLMLSLADEPIKRFASGIDARGML
FT                   LGAGGFACLCIALDQGERLFWLQSPLIVALLAAGILMIAAFLIHELASPRAGLDLGYLA
FT                   RPNIALLIVLVGLVRFTVLNTSFIPSLFLASTYGLRPLQIGDTLRWIAIPQLLFAPCVA
FT                   LLLQRVDPRRLIVAGFAMVAIAFALGSRLTPVWAEPDFIPSQLLQALGQTMALTSVIFF
FT                   FGKHVTAEHALTFGAVVQATRLLSGQLGTTSIAVIQRIREATHSNLVGLHVSLSDPETL
FT                   ERLRAGAASLVAHGATFATGNQAAYALVDRAVRVQATTLALADNFRVAMAFALAGALLG
FT                   ILLRPVRAP"
FT   gene            complement(560182..561162)
FT                   /locus_tag="Bcen2424_6363"
FT   CDS_pept        complement(560182..561162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6363"
FT                   /product="Chloride peroxidase"
FT                   /EC_number="1.11.1.10"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_1465
FT                   chloride peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13095"
FT                   /protein_id="ABK13095.1"
FT                   /translation="MHPEQTDAVSSARRRDMLLAGATAVAAAALPAMAAAAGTPSHSPS
FT                   SAHSGAHTMNTITTKDGTQIYFKDWGSGRPVVFSHGWPLCADAWDAQMLFLVQHGYRVI
FT                   AHDRRGHGRSGQPSRGNDMNTYADDLAALLDALDVREAALVGHSTGGGEVTRYIGRHGT
FT                   KRVAKAVLIGAVPPQMVKSPTNPGGLPMEVFDGIRKNVAENRSQFYKDLAVPFFGFNRP
FT                   NAKVSQGTIDAFWSQGMMGGIHGQYLCVKEFSEVDYTDDLKKIDVPTLVLHGDDDQIVP
FT                   IDDSARLSSKIVKHAVLKVIEGGSHGMCVVNADRINAELLAFLQA"
FT   sig_peptide     complement(561058..561162)
FT                   /locus_tag="Bcen2424_6363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.756 at
FT                   residue 35"
FT   gene            561530..561961
FT                   /locus_tag="Bcen2424_6364"
FT   CDS_pept        561530..561961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13096"
FT                   /protein_id="ABK13096.1"
FT                   /translation="MDAFNRWEHMITSLGPLSATGVRMPPLPRTREADGSRRPHRDDAP
FT                   VPSSGDVRRRSAIVAVERQTDSSMLVSWSDPTRCRYDEQRWISAKARRLARCALTGQPI
FT                   RVGDAIYKPQWRGEKRPANCREMVLATALEQFVARQSRA"
FT   gene            562026..562847
FT                   /locus_tag="Bcen2424_6365"
FT   CDS_pept        562026..562847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6365"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_1463
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13097"
FT                   /protein_id="ABK13097.1"
FT                   /translation="MSTFTTRDGVSIHYKDWGSGRPVVFIHGWPLNADMWDVQMHHLAS
FT                   HGLRGIAYDRRGFGRSDQPWSGYDYDTLADDLATLLETLDLHDVTLVGFSMGGGEVARY
FT                   IGRHGTRRIAKAVLIGSVTPLVARRDDHPEGVDVAVFDGIRAGIVADRAAFFDGFWPLF
FT                   TGSNRDGSTVSRAALGWTSVMALQGGLKGTLECVRAFSETDFRADLQRFDVPTRVIHGD
FT                   DDQTAPLALTGAATAKRVPNATLSVYEGGPHALYLTHAARLNDELLAFAQD"
FT   gene            563294..565099
FT                   /locus_tag="Bcen2424_6366"
FT   CDS_pept        563294..565099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6366"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: bcn:Bcen_1462 transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13098"
FT                   /protein_id="ABK13098.1"
FT                   /translation="MIRIGTLHVFLDRREIRSNGKLLRIGSRAFEILELLIRANGALVS
FT                   KDDIMQRVWPHTVVEENNLQVHIASLRKALAGDRNLIVTVPGRGYRLVAGQDDGDAPVR
FT                   PATWRPSAAPSTLFGREQTVADVLAALQGARVVTLVGAGGIGKTRVAIEAAARADARFP
FT                   EGTVFVSLATVACPRFVPDALAGAFGITQPTGSLTLEAVLASVARRRMLLVLDNCEHLL
FT                   DAAAQIASALTDADDGLCVLATSRESLRIHGERVCPVPPLDVPDEGAGDREAMNASAVQ
FT                   LFAARARAADPRFPLDARSLALMASVCRRLDGLPLAIELAAARAAVLGIDVLAAHLDDH
FT                   FRLLTGGFRTALPRHQTLQAMYDWSYRLLGDAERLLLRWLGVFRDGFSIEAVREVVGAN
FT                   GLAGADLLDTIAGLVSKSLVILETAHGVPRYRLLTTTRAYAQQQLDSHGEGAAAARAHA
FT                   TYFLALFRRAAHDGDAPGSGPEGATRLDAVRRELGNLRAALDWAFSAQGDAALGIALTA
FT                   VAVPCLFDLSLVDECRERARVALDAMRDADATGVSDDARVRVLAAYAAALAHTAGSTQV
FT                   VHDAWSEVHALGFDAAEAELPSRES"
FT   gene            565329..565748
FT                   /locus_tag="Bcen2424_6367"
FT   CDS_pept        565329..565748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6367"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bcn:Bcen_1461 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13099"
FT                   /protein_id="ABK13099.1"
FT                   /translation="MKPDQPDLSRHATDLGLLFLRVAASVLLLVVHGLPKIVHYTAEAA
FT                   AIEDPFHLGRTLSILFAIFAEVVCPVFMIVGLYPRLAALPVMIVTLVALVFVHPDWPLR
FT                   DAQFAWMLLILFGTIAIAGAGRYVLPLPGVMRRRA"
FT   gene            565860..567341
FT                   /locus_tag="Bcen2424_6368"
FT   CDS_pept        565860..567341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6368"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: cyclic nucleotide-binding; MscS
FT                   Mechanosensitive ion channel; KEGG: bcn:Bcen_1460 MscS
FT                   mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13100"
FT                   /protein_id="ABK13100.1"
FT                   /translation="MLNFSDTALYGAPIVLADLAAWRLVGRDRAVARAIRRCAAFAALT
FT                   AVLFATGVSPLAVPASLGGLDRIVVQAVCIAWWLQCAIVFSLLLNHLLLPHAWRNQRLF
FT                   HDIAEAIVFGAAAVAALGYVLGLPLSGLVATSGAVAVILGLALQNTLNDVFSGLVLNTT
FT                   QPFRLDDTVSIGELEGRIVESNWRATKLIDNLGNLVVVPNSTAARATIVNLSEPAALHG
FT                   VTLALDLDPAVRPAVAVGALERAAASSLDVLARPAPIAVVKAFRANAIQYELVCYVDAL
FT                   QKKITVRNALYDLAHRHLAAAGVAWRPLAGSAPASVSTSPGQPVSRRLLLLRAVELFAR
FT                   VDDDDLAVLADALVARSFGKGDVIYASNAESRVLTIVESGVAAVFVPGASGDVEVRRMA
FT                   PGDAIGQSVVLAGTRLHATVHAVTAMTVHQLRSEDLSALIARKPALGRLMCESLTDHIA
FT                   TEERMMIPPVEKAHAGFSLIGWLEKEMKRLHDSLG"
FT   gene            complement(567390..568298)
FT                   /locus_tag="Bcen2424_6369"
FT   CDS_pept        complement(567390..568298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6369"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1459 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13101"
FT                   /protein_id="ABK13101.1"
FT                   /translation="MKLSFEALEALDAIDRTGTFAEAAELLHRVPSALTYLVQKLESDL
FT                   GVALFDRSGRRAKLTHAGRIVVEEGRRLLRAAEQLEMKALRAQQGWETEVRVCIDEILP
FT                   FDALWPYVHRFYALGMDTRLRLSTEVLGGAWDALISRRADLVVGAAGEPPELPGIVARP
FT                   IGSLKHVFAVAPSHPLAALPEPLAMASVVQYRGAVISDTSRELQPQSVAIDAGQPYLAV
FT                   PTLAAKLEAQCEGLAVGTLPECIAARAIADGKLVARQVTGMRDTTHCYLAWRGDEAGRA
FT                   LHWWVEQLDQPDLVDRFTTPD"
FT   gene            568421..569326
FT                   /locus_tag="Bcen2424_6370"
FT   CDS_pept        568421..569326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6370"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1458 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13102"
FT                   /protein_id="ABK13102.1"
FT                   /translation="MSAPQPDTASSDFIPADVRQTVVTQALPNGQIGIVRLKTLRRNMG
FT                   LTAPYELENTDLIVLQLHPFGEQDLWLDGRPAPFVPYDAGTVSIYDLDRRWVADLQGAF
FT                   DCLHFHLPRHTLEETVDDLGGRQRPQLYLPPHLSTHDSVIHALGHALLPALARPAEASQ
FT                   IFIDHVGLAFQAHVAHRYGGVGERRERSDGKLTPSQARRAKELLLAHLDGNIGLADVAS
FT                   ACGLSRGHFVKAFHRTTGLPPHRWLIVQRVERAKEWMRDPNMPLSMIAVACGFADQSHF
FT                   SRTFTRLTGVTPRRWRADHT"
FT   gene            569428..570591
FT                   /locus_tag="Bcen2424_6371"
FT   CDS_pept        569428..570591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6371"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: bcn:Bcen_1457 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13103"
FT                   /protein_id="ABK13103.1"
FT                   /translation="MKRRWPRQPMLVMGVFATFGLHAAVASAAPEVSISRADYGTTATG
FT                   QAVSQYTLANRRGVTLKVITYGGIVTALDVPDRTGHAADIVLGFDSLRDYEAHNGNIHF
FT                   GALIGRYANRIAGGRFALDGKTWKLPVNDGPNTLHGGPDSFDAKVWTVTGTHSDATGSS
FT                   VTLRYVSPDGENGFPGTLTTDVTYTLTGDNQIRIDYRATTDKNTVVNLTNHSYFNLAGQ
FT                   AGGSVERQLIEIAASRFTPTDDTSIPTGQLASVAGTPMDLRQPTPIGAHLRDAYPQLAI
FT                   AHGYDQNWVLDQGGQPAPAFAARAYDPASGRFLELYTTQPGLQFYTANGLNGSVAGKGG
FT                   TVYRQTDAFALEAEHFPDSPNHPAFPSTALKPGETLHEVTVWRVGAR"
FT   sig_peptide     569428..569514
FT                   /locus_tag="Bcen2424_6371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 29"
FT   gene            complement(570619..571479)
FT                   /locus_tag="Bcen2424_6372"
FT   CDS_pept        complement(570619..571479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6372"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   bcn:Bcen_1456 phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13104"
FT                   /protein_id="ABK13104.1"
FT                   /translation="MTQYTFRLLNVFAESTFGGNPLCVFDDARGMDDATMQALAVQFNL
FT                   SETTFVLPSDRAHARVRIFTPGYEMAFAGHPTLGTAHVVRERLNAGDALSLEFKAGVVD
FT                   VTARDDVWTFIAPHAGMPNTAPCTLPDAQVAALLGLTEDDLLAPPLWVNTGADQLLVAL
FT                   KDPAAVRRARPDGARVDIWPPSSLGRRTAYVFAFDDARPGTVVSRYFFVKQGGGVSEDP
FT                   GTGSACANLGGWLLAASHDLPAALRVEQGEAVGRPCLLHLSVDAAGKIGVGGRVIELGR
FT                   GVINV"
FT   gene            complement(571496..572314)
FT                   /locus_tag="Bcen2424_6373"
FT   CDS_pept        complement(571496..572314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6373"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   bcn:Bcen_1455 transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13105"
FT                   /protein_id="ABK13105.1"
FT                   /translation="MNENAELITSLIRLGFTQYEAQAYAALVGQAALTGAEVGRRAGMP
FT                   PSKVYETLGRLEARGAVLVNRSEPVRYAAVPHRSLLEELRTRFNADLELAAGALDRLPV
FT                   RQEPGLVWSLSGREAIVSAFVRVIDQAKTEIFAGVWDEEIDDLGPLLEAAAARGVDTHV
FT                   AIYGTRTLNGPRHYDMAKCGASARLRLSGRRLAVAVADDTEAVVAEFGDQSPDQATLTT
FT                   NPVIALLAVEYIKADVSGRVLIDAMGPAEYRKVLKHPDMQAMLAPPDKRG"
FT   gene            572449..572814
FT                   /locus_tag="Bcen2424_6374"
FT   CDS_pept        572449..572814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6374"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bcn:Bcen_1454
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13106"
FT                   /protein_id="ABK13106.1"
FT                   /translation="MRQRISTGSPWEPKVGYSRAVVVDNTIYVSGTAGKGDDVYAQTRD
FT                   ALATLGKVLADSGFALSDVVQSRLVVADFDHWEDAARAHGEIYGEIRPAFSLVHALPFV
FT                   DPEIRVEVEAIAVRPVA"
FT   gene            572811..574016
FT                   /locus_tag="Bcen2424_6375"
FT   CDS_pept        572811..574016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6375"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_1453 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13107"
FT                   /protein_id="ABK13107.1"
FT                   /translation="MTVAGPHAYLSRTAIAMLALAAGVAIANGYALQPSLSAIAGDFGV
FT                   PAARMATLASVTMLGYLAGLALLVPLVDRFGPRTLIPAQMGVLAALLACASLSSTPFAL
FT                   DACFLLVGAATTVAAQCSAVVGKHAEPQRRGGAMGMVSAGISAGILLSRFVGGALSQWC
FT                   GWRGALLALAGCVALAAVGSGVLLPGGRPERRSGHAATIGAIPRLLRDSAALRRRTCAG
FT                   MLWFFAFNLVWVGLAIRLAAPPYNLGAAEIGAYSLAGVLGLGVTRVAGKLTDRFGDRAV
FT                   IGGGLAVAALSTLLLGVALGHPGWLGVGLALFDAGCFAAQVANQARVVAIQPVRAGALN
FT                   AAYLTLYYAAGAGGAVAAGMLVERLGWGAMMLVAAGAVTVAAWVGASRATVGAAGEPMS
FT                   AG"
FT   sig_peptide     572811..572894
FT                   /locus_tag="Bcen2424_6375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.767 at
FT                   residue 28"
FT   gene            complement(574237..575208)
FT                   /locus_tag="Bcen2424_6376"
FT   CDS_pept        complement(574237..575208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6376"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: bcn:Bcen_1452 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13108"
FT                   /protein_id="ABK13108.1"
FT                   /translation="MSTTPRSTRASLLSPRDRKRLMTLLRALAPDEGYNLTALPSVRIL
FT                   RSNRALSRTPVLYDPGIVIVCQGSKRGYFGGERYLYDEHHYLAVSVPVPFSMETDATPE
FT                   RPLLALYLHLDFTLAAELAAQIDRAGVAEAVQAPKSMMSTPMDDAMHASVLRFVEAMQR
FT                   PLDAAVLGPALLRELYFRVLTGAQGNAMRNALAMRGQFGRIGRSLRMIHTDYARPLDVS
FT                   QLADEAGMSVPSFHSHFKAITQVSPMQYLKSTRLHQARLLMVRQDLTAEAAGYAVGYTS
FT                   PSQFSREFKRLFGLTPAKETQRMRASFAIPQAFDDAVFVSSH"
FT   gene            575303..576136
FT                   /locus_tag="Bcen2424_6377"
FT   CDS_pept        575303..576136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6377"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcn:Bcen_1451 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13109"
FT                   /protein_id="ABK13109.1"
FT                   /translation="MASGNIMLITGVSSGFGRALAQEALAAGHTVVGTVRGAQAARDFE
FT                   ALSPQAAVARVLDVTDFERIDGVVADIEANVGPVDVLVNNAGYGHEGIMEEAPLDEMRR
FT                   QFDVNVFGAVAMMKAVVPFMRERRRGRILNITSMGGHITMPGIAYYCGSKFALEGISET
FT                   LGKELEPFGIAVTAVAPGSFRTDWAGRSMARTPRSIADYDALFDPIRRAREEKSGKQPG
FT                   DPAKAARAMLAVIAADHPPAHLLLGSDALRLVRNKLAALDEEIRAWEAVTVSTDG"
FT   sig_peptide     575303..575368
FT                   /locus_tag="Bcen2424_6377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            576280..577116
FT                   /locus_tag="Bcen2424_6378"
FT   CDS_pept        576280..577116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6378"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_1450
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13110"
FT                   /protein_id="ABK13110.1"
FT                   /translation="MPYATTKDNVEIFYKDWGPKDAQPVMFHHGWPLSSDDWDAQLLFF
FT                   VQHGYRVIAHDRRGHGRSAQVWDGHDMDHYAADAFAVVEALDLRNAVHIGHSTGGGEVA
FT                   RYVAKHGEPAGRVAKAVLVSAVPPLMVKTDSNPEGLPLEVFDGFRKALADNRAQFFLDV
FT                   PSGPFYGFNREGATVHQGVIRNWWRQGMEGSAKAHYDGIKAFSETDQTEDLKSISVPTL
FT                   VLHGEDDQIVPIADAALKSIKLLKNGTLKTYPGYSHGMLTVNADVLNADLLAFVRG"
FT   gene            complement(577213..578133)
FT                   /locus_tag="Bcen2424_6379"
FT   CDS_pept        complement(577213..578133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6379"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1449 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13111"
FT                   /protein_id="ABK13111.1"
FT                   /translation="MKAKPLPPVYALRAFESAARNGSFTLAAEELSLTQSAVSKHVKTL
FT                   EAYFGRKLFVRHGPKMTVTAEAHIFAAGLRRGFRQVEEACMLFRTQRDVLRLKAPSTLT
FT                   MRWLLDALAAFRGTRPAFEVQIASVWMDVDTVDFFSESYDCAILLGAGKFGESTHCVKL
FT                   FDEWLIPVCSRATAAVARANPAACELIHPSPDRRDWRRWLNGSGHDLNVDITRGQVFDM
FT                   LEQGIAAAIAGHGMSIGDLALCATAIDEKQLVLPFKTAVSTGDAYYLVWPEDSAKAAQV
FT                   RELHAFLAGRMPRLAHPGVRFVDLG"
FT   gene            578300..578950
FT                   /locus_tag="Bcen2424_6380"
FT   CDS_pept        578300..578950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6380"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bcn:Bcen_1448 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13112"
FT                   /protein_id="ABK13112.1"
FT                   /translation="MTLHYPLLFAYLAAIVLLIATPGPVVMLVTGTVARRGFRQGVLTA
FT                   VGANAASLVLIAGAMLMVFGVVMVSARLLAGLHVAGCLFIAVLAIRTLVGEWRAGRGRS
FT                   GDGTAAGEPASRPRGLPGVVRGFLVGIANPKDVLFFVAFFPQFVGITPDSRVSLAILAA
FT                   LWIAVDFTIMTGYMAAINHPAIHRKQRWISASSALALLAIALAGLGGTIASVA"
FT   sig_peptide     578300..578386
FT                   /locus_tag="Bcen2424_6380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.659) with cleavage site probability 0.518 at
FT                   residue 29"
FT   gene            complement(578988..579694)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_6381"
FT   gene            complement(579702..581870)
FT                   /locus_tag="Bcen2424_6382"
FT   CDS_pept        complement(579702..581870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13113"
FT                   /protein_id="ABK13113.1"
FT                   /translation="MRRNPTLNRNLFAALAASLLWTPAAHASGDDGCYVPNTLRQTSYS
FT                   CGNVPMLTPANDTRINAMLMMVDSAKVAQVFPDPKTIPAKDRINQIVVPFPMDFSGWIY
FT                   IGQKEPDKSGGAAEADASSNRYADGEGSICRSMSAGADAFNAALGGAGGLPADEAARLR
FT                   AARADIAQKTCAAGGASAAWTKPPVKSPLGQQFAAYLDGTNAFYRADFLTATRAFANAS
FT                   HSADPWLKETGLYMAGRAQLNAAQANVFDNDSPTPTRARVMKVSLDAANTVFRTYLKVY
FT                   PKGRYAVSASGLLRRVAWLGGNVTQQADLYGRALARWSPATSNVPLMQLANELDSKLLF
FT                   GSEFDASQIQSPTVLATVDLLRMRASDSSDASRKPMTLDELQAQKPRFANAPALYDYLL
FT                   ATWYVQIGHKPDAALDLLPQTPAAPLDYFGLSQQALRGFALEDSGQNDKARQLWRDLIP
FT                   LATFRFQREMLELALAINLEQAGLVNDAFADDSLVRNVAIRAVLLQRAANAELLRAQAQ
FT                   NQATSGALRDTALYTLLYKELTRSHYADFIADTALVPGAPADPLKPFVAAAAKNEDGYT
FT                   CLSARDIAATLQQNPADPKGLNCLADFVRLHPPAYGLETEPVPSWVRNASSTAATRVPP
FT                   TLGAAPSQFAGKPYERMSSYVTVMADTQANPNDRAYAFYRAIKCYAPGGSNECGGKEVP
FT                   KSTRKRWFDTLKTAYPGSPWAQKLRYYW"
FT   sig_peptide     complement(581787..581870)
FT                   /locus_tag="Bcen2424_6382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            582320..583843
FT                   /locus_tag="Bcen2424_6383"
FT   CDS_pept        582320..583843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13114"
FT                   /protein_id="ABK13114.1"
FT                   /translation="MKPITWMVMAAALALTACGGDDVAPNGGASSSSSTPTNPGSPSGS
FT                   TSPGGGTSGGSNGSPTGGGATQPQAGWSTAAAVDGKGPEGAPSVTIDASGNALATWMTN
FT                   GPTGANGNEMWGARYAAGSGWGTATRLDTGDGSHSMNTTSSSPSRVVGNASGQAVAFWT
FT                   EWMPGPNTYALWARPYSPAGGWGAAFEVAPDVTGSTYSAGIDGQGNALVAWTQSISLLD
FT                   TRIAWTRYTQSGQWSPTALIQMPVQTGPGAVTGDTDNVGPMISVLSSGRAVLAWRQTNH
FT                   THSALWTATYDAANGWTDVNQAVSNTSLFTTIISPVAGMDAKGNITLLWGQLDVTGGHI
FT                   TTTTMSQRYVSGTGWQPSQPVAPAIVEPTGFIATPMLAVNENGVAAAMWAEGGAALQVS
FT                   VSDASGNWGPLQRLTEHLNGAALQYPPLVVDAGGNVTAAWQDTGLPGASAVIVASYRKG
FT                   AWSASTVAPQSASWPALAVNATGAMALLWQSYVATIGSQIQASFYTPGT"
FT   sig_peptide     582320..582379
FT                   /locus_tag="Bcen2424_6383"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.822 at
FT                   residue 20"
FT   gene            583877..584203
FT                   /locus_tag="Bcen2424_6384"
FT   CDS_pept        583877..584203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13115"
FT                   /protein_id="ABK13115.1"
FT                   /translation="MKQTLYCTARTALAVTVAGLVLAACGSTQMNMVDVQTSTAKTLGL
FT                   ASSDEITIANVQYGKKDGLGGQKVSYDATTGKGRRFGCTVFMIPGLTPIDRPTYNNWEC
FT                   HPQR"
FT   sig_peptide     583877..583957
FT                   /locus_tag="Bcen2424_6384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.395 at
FT                   residue 27"
FT   gene            584352..585404
FT                   /locus_tag="Bcen2424_6385"
FT   CDS_pept        584352..585404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6385"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1443 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13116"
FT                   /protein_id="ABK13116.1"
FT                   /translation="MDQAAFVPVFRFRTTDYPEPDRFHVWVKDMLCDYRLDDDGGHGPC
FT                   DAEATGAALGPLILSGRHWHSRAPTYTVRRTPRRIRLDGQDSIRFTLLLGGRLASHTGG
FT                   PELIKGAGDLFVYDVAQINDCKVEAGDVISLVVPRYLLPAHAAQAHGQTLTSGVGRLVA
FT                   DQMLSLFRNLPNLRMQDVPSIVQSMLLLLAAAVSPSAQALNDARGPIDHALVDRVRRYI
FT                   DLHLLEPDLTPERICRDIGVSRARLYQLFKEEGGVMRQITRRRLRHAYHVLGDPQRRHQ
FT                   RIAEIAWAHGFPDEKYFHRLFKAEFGHTPKETLECAAAPILLPCGATDARWGDGGRLAG
FT                   WTLPFGVLTN"
FT   gene            complement(585449..586861)
FT                   /locus_tag="Bcen2424_6386"
FT   CDS_pept        complement(585449..586861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13117"
FT                   /protein_id="ABK13117.1"
FT                   /translation="MSLTPLPALLDTTLRTVARRYRLPPLERASSLTDATHPATALAIV
FT                   IEEARRMRADGHAPGADLRQRFIDALARMIRDAMDPSSGDPSFQASVLRHDAPNVREYA
FT                   SLSAHAEQDRRALYSAVNAIAHPAKLERSALAWQRDGLARLHAAATAATWGKLHAALAH
FT                   LLALPEMATDAAFEQDIVRLKDSPALERMLRLDALAADTDVRRYRALWVRQGPLVGSTV
FT                   AVAQGAASQQRGAAVEALAAQALDALARKLDAVDDERTYRVVTSMRVPSSIPGRHDRAK
FT                   TEWDAILLERARGSDPAAAWNVRFLVEAKASADAATTDLPRLRRGLNLLAQAAPDTVYA
FT                   FETHQGTVHVHGASLHALTTDEGALPREVLYCCDASADTTPRLLGAASRMQLLSAQASL
FT                   EYASALAQRPDADPDGLGVIWHALLTLPQWQAVLHQYPSLRQVRELMVAIDDLRAVLDE
FT                   MDDGGIASSVCA"
FT   gene            complement(586893..587654)
FT                   /locus_tag="Bcen2424_6387"
FT   CDS_pept        complement(586893..587654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6387"
FT                   /product="2-keto-4-pentenoate hydratase-like protein"
FT                   /note="KEGG: bcn:Bcen_1441 2-keto-4-pentenoate
FT                   hydratase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13118"
FT                   /protein_id="ABK13118.1"
FT                   /translation="MTTTTERVDGAAQHLVAARHAGSPGPLLPDALRPDDIETALAIQQ
FT                   RVADLLGEPVGGWKCALPPPDRVILAPIFASTIREADAPYRVVGGPIVRIEPEIAFVLD
FT                   RDLPAREQPYDEGDVRAAIREVRIVLEVLGCRYAEPARASKFELLADGQFNQGLCVGPV
FT                   VPDGLNVPLETLALSFEGALNRTIDGRHPDGDPLKPLVWLVNFLASRGDAVRAGQIVTT
FT                   GSYAGAIEVPLGDVLTVRFGELGSLSVTLTA"
FT   gene            587960..588439
FT                   /locus_tag="Bcen2424_6388"
FT   CDS_pept        587960..588439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6388"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bcn:Bcen_1440 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13119"
FT                   /protein_id="ABK13119.1"
FT                   /translation="MYEKIMVAVDGSASSKQALAEAVKVALAGDTHVSVVYVVDKSVLF
FT                   TYAGRLDPHALVEEIRDDGRKVLREAEQIIALAGAKGEAELVETESIGEDIAERLQRYV
FT                   KERGIDLAVVGTHGRRGIRRVLLGSVAERFVRGSKCPVLLIRGDDADESAAAAAA"
FT   gene            588453..588644
FT                   /locus_tag="Bcen2424_6389"
FT   CDS_pept        588453..588644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13120"
FT                   /protein_id="ABK13120.1"
FT                   /translation="MIRRQYRIVVAALAVFVSLAGMMAVVTGLLFDAATALRGGAIALI
FT                   VGVAGFVVMLNPGPKGEE"
FT   sig_peptide     588453..588539
FT                   /locus_tag="Bcen2424_6389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.384 at
FT                   residue 29"
FT   gene            588831..590567
FT                   /locus_tag="Bcen2424_6390"
FT   CDS_pept        588831..590567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6390"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bcn:Bcen_1438 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13121"
FT                   /protein_id="ABK13121.1"
FT                   /translation="MKPRLASPPSSDSAPAPAGFPDADELAALRAWYAGMTVRQAVERY
FT                   LPDRLGGGRSARGVIGAIRRRLVRVARQVGRPDLAERLGHADGERLREAKVATDAIGLL
FT                   RHARAPVPQISDDVGLWLPARAVVALRAHGIATLADLTVRIPRRRQWWRTIAGLGMASA
FT                   RRVEAFFAAHPDLTERARALIAATPRGSIVPWEHLKLPHEVDGSAGTFRAPRATSTLDA
FT                   DNDYAAVHAWLSLHESAATRRAYRKEAERLILWAIVERGRALSSLTTEDALAYRAFIRR
FT                   PTPHERWVGPVRPRGAPDWRPFSGALSARSAAYTLSVLGALFRWLIEQRYLLANPFAGV
FT                   KVRDTRGATALDTSHAFTEGEWLLVRTIADGLEFGKRTADGAPQPGWTPAAAQRLRFIL
FT                   DFGYATGLRASELVGATLGDIETDAHGDAWLKVIGKGSKAARVALPPLARTALDRYLVA
FT                   RRLPVTPARWRPDTPLIPRLAEDDAAAITSVRLWKVMQRFFAQTADAVEADHPALAHKL
FT                   RQASPHWMRHTHATHALARGAELTTVRDNLRHASISTTSIYLHGDDVKRARQMSSAFGI
FT                   DK"
FT   gene            590624..590947
FT                   /locus_tag="Bcen2424_6391"
FT   CDS_pept        590624..590947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6391"
FT                   /product="TfoX, N-terminal domain protein"
FT                   /note="PFAM: TfoX, N-terminal domain protein; KEGG:
FT                   bcn:Bcen_1437 TfoX-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13122"
FT                   /protein_id="ABK13122.1"
FT                   /translation="MASSQSTIDFIVEQIAAAGTVSARKMFGEYGIYCDGRMVALVCDD
FT                   RLFVKPTSEGRAYLGACDEAPPYPGAKPHLVIAGDRWDDREWLATLIRLTAAQLPLPVK
FT                   RGR"
FT   gene            591037..591951
FT                   /locus_tag="Bcen2424_6392"
FT   CDS_pept        591037..591951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13123"
FT                   /protein_id="ABK13123.1"
FT                   /translation="METSGPSRGTRHARRVWHALVATLCVGWSALSFGAEGANGAAALL
FT                   ERYRSLGAQLKDNAFHRPVVLESSEASSSLKGDIYAVVDYPFAVVNGQLNDPAQGPANW
FT                   CAVLILHLNTKYCHASSGGNGPVLDVNLGRKIEQKLSDTYRVQFRYRVAAATPDYFQVD
FT                   LTADSGPMGTKDYRIALEAVPVGASRTFLHLTYSYGFGTVGRMAMKTYLATVGSDKVGF
FT                   TNVGAAAQPQYVGGVRGLLERNTMRYYLAIDTYLATLDKPVDQRLARWFDATEQYPQQL
FT                   HEVERGAYLQMKAQEVQRQQTAR"
FT   sig_peptide     591037..591141
FT                   /locus_tag="Bcen2424_6392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.791 at
FT                   residue 35"
FT   gene            complement(591983..593134)
FT                   /locus_tag="Bcen2424_6393"
FT   CDS_pept        complement(591983..593134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6393"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bcn:Bcen_1435 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13124"
FT                   /protein_id="ABK13124.1"
FT                   /translation="MNRRYWLAWLAVCSIGTVAASAQAADPETVRIGFAGPLTGPVARV
FT                   GKDLQYGAQLALDEENAKHPTIGGKPVRFVLDVQDDQADPRIAIQVAQKLVDDGVVGVI
FT                   GHYNSGCSIPASAVYKQANVAMITPGSTNPQLTMQGFRNVFRTMGHDGVGGVVAGRFAV
FT                   EQLKAKRIGIIDDRTAFGQGLADAFEKGVKDAHGSIVGREYTNDKAVDFRGILTTMKSN
FT                   NIDLLFFGGLDEQGAMLVKQMRSLGIRAQLFGAGALKSNAFLKIAGNAGEGTQDLEPGP
FT                   ALDKLPSAVAFAQRYKARFNQDVELYAPFAYDAALAMIAAVRKADSPDRGKIVASLPGV
FT                   SVTGVTGKISFDERGDLVKPPYTLFRVEQGQWHSIRTVGGASN"
FT   sig_peptide     complement(593060..593134)
FT                   /locus_tag="Bcen2424_6393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            complement(593170..594399)
FT                   /locus_tag="Bcen2424_6394"
FT   CDS_pept        complement(593170..594399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6394"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_1434 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13125"
FT                   /protein_id="ABK13125.1"
FT                   /translation="MANVAIVGAGFIGLGAAAWLQRDGHRVTLFDPAGVGQGASFGNAA
FT                   TFAPYGCVPVNGPSVFRDLPHYLFAADSPLRIRWPYLLHGAPWLARFLLASTPARHARS
FT                   ASALAALLSRAADGYAPLLAPSRLAAFVRPRECLYLYARQASFDAAQPSLALRRRLGVP
FT                   FETLDASAIRRLEPALAPIFSRGVLFAGSWHFSDPHGFLGELFAQLAAAGATLERARVE
FT                   RIAPAGHSVNVHAGGTVRAFDHVVIAAGARSREFAAACGDAVPLDTERGYHVQFGAHEP
FT                   IVTRPVGWAERGFYMTPLDEGLRAAGTVELGGFDAPMNPSLVALLTRSAREAVPSLGAP
FT                   TRSWLGFRPTLPDGVPVIGRARDSARVIHAFGHQHLGVTLAGITGQIVADLVAQRAPPL
FT                   DLTPYRAARF"
FT   gene            594631..596043
FT                   /locus_tag="Bcen2424_6395"
FT   CDS_pept        594631..596043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6395"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bcn:Bcen_1433
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13126"
FT                   /protein_id="ABK13126.1"
FT                   /translation="MASDKLSGERDGGLPAPAKRPTYVEVSSSIEAEIRNGMYPPGSRL
FT                   PPQRQLATELGINVSTVSRAYKELQLRGLVIGSKRRGSLVTGGAMPSIEPARASLAAGN
FT                   GVIDLTVNRPATGEFLASLAQTFATLPNDPRFAALQEYQPPQGPDWARAAGAQWLAAPG
FT                   FAPSPDQVVVTSGAQHGLYAVLNSLIGTDGVIVADRLTYYGLKALAPVFQFEIVSAPAD
FT                   DDGLLPDEIERICQRMPVKAIFVVPNLQNPTVTTMSLARRMALVDIARRHHVTIIEDDV
FT                   YGPLVRDRLPAIAGLCPELTFHIGATSKILAPGLRLGYLSCPRDSVALCAEAVRTTAWM
FT                   PAPTSMLIATVWIEDGTAERIMAAQLAEIRARVDLARELLPAGQLKADPACMFVWLRLP
FT                   PPWRADDFAANAKARGVIVMPSSTFAVDRAELEHGVRINLACPATRDELVNGLRILSGT
FT                   LKDRPRALFGSI"
FT   gene            complement(596054..596506)
FT                   /pseudo
FT                   /locus_tag="Bcen2424_6396"
FT   gene            597189..598613
FT                   /locus_tag="Bcen2424_6397"
FT   CDS_pept        597189..598613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6397"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bcn:Bcen_1432
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13127"
FT                   /protein_id="ABK13127.1"
FT                   /translation="MKLYEKLADDIERLIRQGVYRHGDRIPSVRQASQQHRISITTVLH
FT                   AYLLLESRGLLESRPQSGYFVNLRRDDGHAPVRELRPSKPIAISSSVDVSRLVLSTLRS
FT                   IGTDDAVPLGSPYPDPSLFPFEKLNRYAYAAGRDKSLWGVTDGLPPGHPRLIRQIARRY
FT                   LENGMSVDPNEIIVTVGATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERMGMKAIE
FT                   VATHPEYGIDIAALAAIAKSQPIAACMVMPNFQNPLGFQMPDERKRELVEFATKAGIPI
FT                   IENGVYNELYFGDTHPSSLKSYDRTGIVLHCSSFSKSLTAAYRIGWALPGRYRDQVEKL
FT                   KFLNTLATPSLPQLAIAEFLERDGYEHHLRRLRKAYAQQANLMRAMVSRFFPEGTRISS
FT                   PAGGYVLWVELPAQVDAMRLYQLALEQGITIGPGYMFSITDNYRNFIRLNYSSPWSPEI
FT                   EQAVITVGKLAAACMR"
FT   gene            complement(598671..599591)
FT                   /locus_tag="Bcen2424_6398"
FT   CDS_pept        complement(598671..599591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6398"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1431 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13128"
FT                   /protein_id="ABK13128.1"
FT                   /translation="MSRQLPPLLSVRAFEAAARHGGFARAGDELCVTSGAVGHQVRLLE
FT                   EWLGTPLFMRGARSVQLTEIGRRYFLEIERLMDELERASLDIRQAADSPEVTVTAMPSF
FT                   VTRWLMPRLGEFRRLHPDIEVRLLASVPAVDFSRERVDVAIRLGVGPYPGLIAEKLMSE
FT                   TFLAVGQPSICKPLRTVDDLLRATLLHDEYEARIPEQVDWMRWSRMQDVQAGPARLRQG
FT                   PSFSHTYLTLDAAIAGQGVAVASDVLAADAVRQGLLAIAPGKPVQGPYSYHLLTTRAAA
FT                   ARPQIDAFCSWLRSAARSFSAAGWA"
FT   gene            599717..601063
FT                   /locus_tag="Bcen2424_6399"
FT   CDS_pept        599717..601063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6399"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bcn:Bcen_1430 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13129"
FT                   /protein_id="ABK13129.1"
FT                   /translation="MDLSIHGESNPALASSFRKVLVPWAVQGGLNPPVITHAQGCYFYD
FT                   ANGKRYLDLTSGYVAVSLGHGHPKVVEAIQAQAARMCWVASSYFNDVRAEYAELLNSVS
FT                   PWPDGLRVHFTCGGAEANDDAVKIARLVTRRPKVLTAYRSYHGSTLGASAMTGVDRWRD
FT                   PFPALPGMVKFFAPYPYRSPFHTSEPAEETRRALDHLARVLSHEGAQNVAAILMEPMTG
FT                   SSGVVVYPPGYLAGVRDLCDRHGILLIFDEVMTGFGRTGALFCAERVGVLPDLISFAKG
FT                   ASSSYTPLGGVLVREGVARHFDTELFDVGHTHAGHVLAVAGGLAALKVYLEEGLFERAR
FT                   EIEGWLRDGLGELAERHPSIGDVRGMGAQFGIELVRDRETREPLVEWHHPAGSAPMRAF
FT                   YGELLKRGVHAYGRYNVVIVTPPLVISRTELDEGLDALDAALTVLEAAR"
FT   gene            601060..601863
FT                   /locus_tag="Bcen2424_6400"
FT   CDS_pept        601060..601863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6400"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: bcn:Bcen_1429 naphthoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13130"
FT                   /protein_id="ABK13130.1"
FT                   /translation="MNYEDILYREAGGVATITINRPSVYNAFRARTVDELLHAFQQAGW
FT                   NREIGVIVLTGAGEKAFCTGGDQTSHGDGGYGGRGAIGLPVDELQSLIRDVPKPVIARV
FT                   NGYAIGGGNVLVTVCDLAIASEAAQLGQVGPRVGSVDPGFGTALLARVLGEKRAREVWF
FT                   LCRRYTAREALAMGWLNAVVPADQLDGEVARWCDEILALSPTALAIAKRSFNADSENIR
FT                   AIGALGFEALSLYYDTDESKEGTRAFRERRKPDFRRGKAGHDPQP"
FT   gene            601938..603860
FT                   /locus_tag="Bcen2424_6401"
FT   CDS_pept        601938..603860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6401"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_1428 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13131"
FT                   /protein_id="ABK13131.1"
FT                   /translation="MSTTDILWQPPSDWRTSTLLGELCACLGASSFEELIGISLREPQR
FT                   YWAAVMTHLQFQWRTPPQRHVDLAGGPAFPRWFPGGRLNWVDHVLAHADGPRAMQAAVI
FT                   TETEDGRVSTTSYAALAREVRRLASRLATLGVGAGDRVGIMMTMGAQAAASLIAVSALG
FT                   AIAVPLFTGFGADAVAARLTLADARVLLASGGYLRRGRTIDLKPVFDAVQEQMPGLRIV
FT                   VHGDEPARSAALDDPASAHAAAPRAFPAQDPDQPFMIVFTSGTTGEPKGTVHTHAGFPL
FT                   KILHDCAYHFELRPGDRCLWPSDMGWIVGPLTTVGALVRGATLVCYDGAPDHPGAGRLA
FT                   EIIDRHQVTHFGASPTLIRSLAASPDAVDGAVLESLRVLMVAGEVIDPDHFAWFFHAFG
FT                   RARLPVINYSGGTEASGALLGNVPVRPIRACAFNAVSPGVDAFAADEKGQRVRGVPGEL
FT                   VIAAPFVGMTSGFWNAADRYEETYWRQRPGLWTHGDLLLEDDDGQFFILGRADDTLKIA
FT                   GKRLGPAEVESVVLGSPLVRDVAAVSLPDPVKGERLVVCVSTHGEPPSVLVKSLADRIE
FT                   AALGKPFRPGVVHVVPDLPRTRNGKVMRRVVRNVLRGLPPGDVSALENPAALAALQALA
FT                   DQGTA"
FT   gene            complement(603898..604155)
FT                   /locus_tag="Bcen2424_6402"
FT   CDS_pept        complement(603898..604155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6402"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="PFAM: thiamineS protein; KEGG: bcn:Bcen_1427
FT                   thiamineS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13132"
FT                   /protein_id="ABK13132.1"
FT                   /translation="MKLTIKYFASIREQLALDEETVEIDARELTVDALRGTLAARDARS
FT                   ADALRMDRPVRAAVNLEMVTGEFVVREDSEVAFFPPVTGG"
FT   gene            complement(604208..604780)
FT                   /locus_tag="Bcen2424_6403"
FT   CDS_pept        complement(604208..604780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6403"
FT                   /product="molybdopterin biosynthesis MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   bcn:Bcen_1426 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13133"
FT                   /protein_id="ABK13133.1"
FT                   /translation="MTTFTESRAGLPDDPPRAGSAPPPVDATDPHPESAPAIAAGFEVR
FT                   VQHAPIDAGAELAPIVRNPNVGAVVNFLGVVRKEGDVDDVVALEVEHYPTMTEQALWSI
FT                   VEEATARWRLEAVRIVHRVGRIPLGQSVVLVVVAAAHRASAFDACEFLMDFLKTHAPFW
FT                   KKEIRHDGESGWVEAKAHDDQAMRRWG"
FT   gene            complement(604828..605952)
FT                   /locus_tag="Bcen2424_6404"
FT   CDS_pept        complement(604828..605952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6404"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: bcn:Bcen_1425 molybdenum cofactor biosynthesis
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13134"
FT                   /protein_id="ABK13134.1"
FT                   /translation="MQADDPIVNAIVSAAPAAAASSGDASPGAVPRPSDTLGRPLRDLR
FT                   LSVIDQCNFRCGYCMPRESFGADYAFMPSSERLSFAQLEKIARAFTSLGVEKIRITGGE
FT                   PLLRRNLEALIERLAALTTVDGKPVEIALTTNGSLLAAKARALRDAGLSRVTVSLDALD
FT                   DAVFRRMSDADVPVARVLAGIEAAHAAGLAPVKVNAVIERGVNDDQILPLVRHFRHTGV
FT                   AVRFIEYMDVGGASFWSGDKVVPAARMRELIDEHYPLVLVGEPGHDATAIRCAHINGAG
FT                   EVGFIASVSHPFCGTCSRARVSADGRLYTCLFATQGTDLRPWLDDAASTADLAAAVRAR
FT                   WTQRDDRYSERRAARPARAPGKTYPTVRMSLVGG"
FT   gene            complement(606182..607396)
FT                   /locus_tag="Bcen2424_6405"
FT   CDS_pept        complement(606182..607396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6405"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: bcn:Bcen_1424
FT                   MoeA-like, domain I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13135"
FT                   /protein_id="ABK13135.1"
FT                   /translation="MKHLFDFDTAQQQFASAFAPLEAAASVPLPQAAGHILAAPLTAVL
FT                   DQPPADQSAMDGYAVRHADLAHGEPLRVAQRCYAGDTPARLAPRTAARIFTGSLIPPGA
FT                   DTVVMQEHAHEQAGDVTFDAPQRSGSHIRRRGEEVRAGDLLVPAGVRLGAMHVGVAAAQ
FT                   GFARIDVRATLRVGILTTGDELVACGQPRAPQQIYNSNAPMLAALVAGTGADVALSLHA
FT                   ADTAAAVDRALRDVHAQCDLVICVGGASVGDKDLLRPALTELGASFIVTGVRMKPGKPV
FT                   ALAALDARPVVLLPGNPGAAMTTFALFVAPLIRRLQGRDAYLPGVPSLPIDTGFEPDAQ
FT                   RERFVRVRCTVGADGAPVLDTLRQQGAGTLQSLVLASGLARLPAGRAIARGDAVPYYEF
FT                   ARWLA"
FT   gene            complement(607393..608262)
FT                   /locus_tag="Bcen2424_6406"
FT   CDS_pept        complement(607393..608262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6406"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: bcn:Bcen_1423 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13136"
FT                   /protein_id="ABK13136.1"
FT                   /translation="MESCTRRDDPTGSTACQVTRHRAGDARDTVDRVVDETPVALVFNG
FT                   ISHTVMMATPIDLDAFGLGFALSEGIVERASDVFDIESEYRPGSAEVRLTVSQQAFMAL
FT                   KAHRRALAGRTGCGVCGIESIAQLDLHPPRIAAAGAAAGIGADAIARAAHALPARQTLM
FT                   RETGGIHAAAWCDRDGAVLDVFEDVGRHNALDKLIGQLARRRADLRAGFVFLSSRASYE
FT                   LVRKAARVGIPMIATISAPTSLAIDVAREAGVRLLGFCRNDGFVEYVSPAAVHLDPSPA
FT                   PAQPAHSS"
FT   gene            608610..610085
FT                   /locus_tag="Bcen2424_6407"
FT   CDS_pept        608610..610085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6407"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit I;
FT                   KEGG: bcn:Bcen_1422 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13137"
FT                   /protein_id="ABK13137.1"
FT                   /translation="MCRRQAVARFPASSVRPHNHEQITVMEIFDAFHLARLQFAFTVSF
FT                   HIVFPAISIGMASFLAVLEWRYLVTGDAAYKSMFQFWSKIFAIGFGMGVVSGVVMAYEF
FT                   GTNWAGFSRVAGNITGPLLTYEVLTAFFLEAGFLGVMLFGWQRVSPRAHFFATLMVAVG
FT                   TLISTFWILASNSFMQTPQGYKIENGLVVPVDWFKIVFNPSFPYRLVHMTIAAFIVAGF
FT                   IVAACGAWHLLKGRRDEPVKRSFSMALWMLLVLAPIQIVVGDAHGLNTREYQPAKIAAI
FT                   EGLWETEKGGTALNLVGLPDMQAETTRYAIQVPHLGSLILTHSWDGEIRGLKEFPPQDR
FT                   PYSPIIFWTFRIMAGLGMLMLLTALLGLLLRKGGRLYETRWFQWFVVAMGPSGIVALLA
FT                   GWITTEVGRQPWTVYGVLRTIDSVSPLTAQQVGVSLLVFVVVYFLVFGTGIYYMMKLMK
FT                   RGPAAQAGYIELHRHPGLRKSALSTPLNVTEAE"
FT   gene            610088..611095
FT                   /locus_tag="Bcen2424_6408"
FT   CDS_pept        610088..611095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6408"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase, subunit II; KEGG:
FT                   bcn:Bcen_1421 cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13138"
FT                   /protein_id="ABK13138.1"
FT                   /translation="MHIDLPVVWAAIIGLGVFIYVMLDGFDLGIGLLFPFFDAKAERQV
FT                   MLDTVAPVWDGNETFLVLGGAGLYGAFPVVYSTLLPANYLPLVLMLVGLIFRGAAFELR
FT                   AKATRTQHMWDLAFIGGSALAAFCQGIVLGSLLQGIKIENNQFAGGPFDWLSPFSMMCG
FT                   IGVLVTYATLGCGWLILKVDGELQRKMRLLMKPLTGVLLAVMGVVSLWTVIGLPAVAHR
FT                   WFGSGNLGWFLPVPILVVACVWGIFHTVKRAHEATPFLLTLALVFLGYTGLVISIWPNI
FT                   VPPSLTIWDASSSHSSQLFALVGTVIVLPIILVYNAMQYRVFRGKVREGDIGYH"
FT   gene            611261..612181
FT                   /locus_tag="Bcen2424_6409"
FT   CDS_pept        611261..612181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6409"
FT                   /product="protein of unknown function UPF0187"
FT                   /note="PFAM: protein of unknown function UPF0187; KEGG:
FT                   bcn:Bcen_1420 protein of unknown function UPF0187"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13139"
FT                   /protein_id="ABK13139.1"
FT                   /translation="MIVRPRQNWLRMLFVWNGSVLQSIIPQLVFMAIVSTLAVFTNGRI
FT                   FGEKIPLNTAPFTLFGLALAIFLGFRNNASFERFKEARHLWGNLLIAARAVTSQLHRYL
FT                   PDSVSDAERNRLADLLIALAYALKHQLRHTDPTDDLVRILGAERTAALGGKCYKPVAIL
FT                   DELRGGIVGALGRAPGSDATCWMFETQLDELGKSVGGCERILSTPIPFSYSVLLHRTVY
FT                   AYCVLLPFGLVDSTEFFTPLICVFISYTLIALEAIANEVAEPFGLAPNALALDAITRTI
FT                   ERSVLELGDRPLPEEFVPASTYQIT"
FT   gene            612275..612688
FT                   /locus_tag="Bcen2424_6410"
FT   CDS_pept        612275..612688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6410"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_C6974 putative
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13140"
FT                   /protein_id="ABK13140.1"
FT                   /translation="MQLLDHVSIGVPDIDQARPFYDAVMAALGAAKVYDRPTALGYGER
FT                   CHANDVTSTFLAVYLDPAEVGTSKRHWCFKAASREQVHAFFEAGLATGGQSDGEPGLRP
FT                   QYHGAYYAAFLIDPAGNRVEAVCHAAGAERGRP"
FT   gene            612959..614782
FT                   /locus_tag="Bcen2424_6411"
FT   CDS_pept        612959..614782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6411"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase; KEGG: bcn:Bcen_1418 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13141"
FT                   /protein_id="ABK13141.1"
FT                   /translation="MPAYVKPRWLRDLLRFLPLKSQFVLSGNVRDLQAGEIAPEVVTAQ
FT                   SLVNTLGDNLREAGYAQLIVWNPVSGFTVPESRLPPTEPADDTLRRLGLTPVDGAAPGG
FT                   IDALTACLDRLAALPGLPVALVVDFASRLAIRAEALNPAEHALFTRALVLAHTAAPRPA
FT                   GELRRPFFNTVIWIVDKEGDLPDWLLVDNPRIRHIPVSRPDSAARRALAGALLRGVSGA
FT                   PAATPDSLAQAEAAFVDGSEGLLLADMNAIATLARVEQVPVEKIADAVRRYKVGVTEDP
FT                   WLQIDRDKIRRADTFVRQRVKGQVHAVTHMLDLVKRAMTGVGSGRKGNRPRGVAFLAGP
FT                   TGVGKTELAKTITSLLFGDESAYIRFDMSEFSAEHADQRLIGAPPGYVGYDVGGELTNA
FT                   IRERPFSVVLFDEIEKAHPRILDKFLQILDDGVLTSGRGDRVYFSEALIVFTSNLGIYR
FT                   QDESGLRVTNVQPGDDFAAIQSKVLGEIQRHFKLVLNRPEILNRIGENIIVFDFIREDV
FT                   ATDIFDQMVGAVLGDIASQGIAIDLDARSREALRARCLADLSNGGRGIRNQIEAHLLNP
FT                   LARGLFDQDANPGDRFVISGIDAGALQLQKQ"
FT   gene            614786..615430
FT                   /locus_tag="Bcen2424_6412"
FT   CDS_pept        614786..615430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6412"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   bcn:Bcen_1417 organic radical activating enzyme family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13142"
FT                   /protein_id="ABK13142.1"
FT                   /translation="MDIRISRLHFPVTTLGPGQRIGIWFQGCSIRCPGCISMDTWASAG
FT                   GETTVDAVLAQVRNWLSGATGITISGGEPFDQPDALIHLLQGLRKLSACDILVYSGHPI
FT                   ESLADTLTRADGLIDVLISDAFDIDAPQTRPLRGSDNQRLHCLTALGRAGFSHYESMSK
FT                   KPGKALDVMFDEDGSVWFAGIPDRDDFQRLRDLLIDQGHQVRISADKAKNK"
FT   gene            615448..621753
FT                   /locus_tag="Bcen2424_6413"
FT   CDS_pept        615448..621753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6413"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: serine/threonine
FT                   protein kinase; KEGG: bcn:Bcen_1416 serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13143"
FT                   /protein_id="ABK13143.1"
FT                   /translation="MMRFCPNCQTERSVDEWFCAGTIGSASCNWDLSGVPIRATGWRPQ
FT                   DVVTAEAVSQQAAALASGAAARISFSCVNGHPMNDGDLMCLECGADPALHADGGALETA
FT                   RDTTGPATEDETPSEETRIDGWRLLHQISSTDGVRERYVAQQDETGRQAVLTLYRPGAE
FT                   PDPAVYDVIRRLPREHVPEIIATGRWDQRAYEVAEELSGGTLADLGIAVRDIATIRHVV
FT                   DELGRILHAFSEVGLRHRDLRPGTLLVRSREPLDLVISGFGSARLSEFDLDIVSPLETT
FT                   RYMAPEAIAGGVAAASDWWSLGMILLEQLTDGRCFEGINPRAFLIHVLANGVALPDDLE
FT                   PSLHLLLRGLLARDRHQRWQWPQVKAWLDGKPVDAPSAMTVDSDGGEGASIALAGRQYR
FT                   RPAVFALAAAERENWDAARDHLNRGVIMTWAEQAGVGAKTQSGLRQVVQLDGVDDDCRL
FT                   MIALKLLNPEMPLILRGDIVTPGWLLQNPLEGYDLITGPVPAFLERMGTESWLSRLRSR
FT                   ADEVRHRAGQLGIELNEDMVRIALLSTSRAQLAAQWEERRLLLPDSSHPGLLSLTERRV
FT                   HSEEDLIVLLSAAISQFRSVDEILEQAAALAEREHILIFDRQAARAALALPRAELFRAV
FT                   DDRIAGFARTGNQTVDDWAEQFRLERRLPLHEVVVLLSVPAEQWLEPQKQQYVSQILDF
FT                   FEKKVATTVLRGPLVRMTIGKTTGRVDLHELNGERFASTALLDHLLQRNVQTVSVDPDV
FT                   FGAGGTLEGRLHTLYRQTSLYKRDTGIDGLYLGFPFLLYKDHRSTTRPRIAPVLLWPVK
FT                   LLMELGTRGQVAMAFDGEREEVRLNPALEGLLGRDAVKAWRVAADEVLGRSALKAGDVV
FT                   DAFGLLADVESRKLGSLPPPTLDVPVGATRIACAGVLFHVDFAGQAIGEDLRQLKQFSP
FT                   SGTALESMLRLKDKSAYDVSDATPAELDRFLTVASDPSQETAILQARRAPGLLVEGPPG
FT                   TGKSQTIVNMVADAIGRGRSLLIVCQKHAALEVVRKRLAAEGLGDRIVMVNDVNKDREP
FT                   TIRAVREQLDAIFRGTVSDRGSIRQRERMAARIEALEGELDRHHAALHRVDEPTGLSYR
FT                   ALLGELMRLEAGTPPVNMPRLRTRLGTLDIAALTTLEEHCAPLARYWLPSRFEGSALAQ
FT                   LKSFATDAATIEAFNTAFADFRDAERVRIETLAAHPARFDVDDPAPYRAWLDANASRLV
FT                   ALDETQRKRLAQWLPLFRPADHADAEGHRYYRALGDLHRDLLAVGTGDFDIVLSDAVAR
FT                   LPDLALDKLATQAALATRAPSLLSRLNPVTYWRRARLMKFVAGCGVPATDETLRKLLGA
FT                   ARLEKVWRPLRDTLNTISRALHLEAVEPTCGPAFVEICHTRLRQLEEIRELAQHLGIAP
FT                   RGDEFDSAVMTGDRAPVEQLLDGFEAAFVRHNARSHSVQALKPLEEWFSAELMAACRQA
FT                   IADNVSYQAPLNRIGDALPTLTAYQQFRTRARHVTAEALDVFAIMRDYEDALTRVAPEF
FT                   LDETVRRSINREARLGWKRRMEHDNPELLLDQSETAAKIEALAAADEEMRRLNRELLRN
FT                   GIDRDKLGSVRDWEDVTRLTGRRSRRLREFIELGTGLGLMALRPIWLMNPDVASRVLPL
FT                   KSGLFDSVVYDEASQMPVEFAIPTLFRGNVSIVSGDEKQMPPTAFFSSRADSDETEIFD
FT                   GELPDEAATDDERERFEDTWNRREIKDCPDLLQLARSALPVSTLQIHYRSAYRELIGYS
FT                   NAAFYENNLSVPVRHPDATVRQAKPLELIQVNGLYEQQTNSDEADRVVAYLAQLWQQPY
FT                   AQRPSVGVVTFNRKQADLIQERLEQRAEDDEVFRECYREELERTDRGEDMAVFVKNVEN
FT                   VQGDERDIIVFSTTFGRNGQGTFRRLFGVLGQSGGERRLNVAVTRARHKVVLITSMPIR
FT                   EISDMLNTQRKPAIPRDYLQGYMEYARAMSNGELSAGRALLGRMSSERAHAKLGQAGAV
FT                   DGFAEDVLAYLHGLGLSPVPAQEGDAFGLDFAIADPRTGLYSIGIECDAPRHPLLEHAR
FT                   AREIWRPSVLGRAIPKLHRVSSQAWYHEPEAEKARLKAAVELALSQEVAA"
FT   gene            621750..623096
FT                   /locus_tag="Bcen2424_6414"
FT   CDS_pept        621750..623096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13144"
FT                   /protein_id="ABK13144.1"
FT                   /translation="MSGPKVVRIVTREEIIAICEGHLRRLDQAIAIWVAEGTYIGMLSD
FT                   EEIAATRARRAALAALIAADAFMDLQKKVPDEIAFLKADLARRQLEAVDRAEQAAKRRR
FT                   QGRHGATTLLGALEAKGIEVPVELRRQLDRLSSGDVVEHADALLAQGYALLTPDVERTL
FT                   NDAQRALATRLMPAETPAAFQAWKAAQSIASRDPVLDRLDRQIGEARVFLGAQEVAGFS
FT                   SRLDGLDDETNEARRNLLLDSLILDLANAIETARARRAAITVLEELTAEMGAYDTAATV
FT                   AFAERARQCDTTTLPDIVAELTRAGQDLIAQLRQEQAAVARRNAILSGLARLGYDVHEG
FT                   MTTAWAKDGRVVVKKPSLPGYGVEVGGQAQAGRLQVRAVSLVANRDVARDKDVETLWCG
FT                   DFARLQALLAQHGDDLLIERAMGVGEVPLKVVAETGDMSSTEAGKRTMG"
FT   gene            complement(623178..623915)
FT                   /locus_tag="Bcen2424_6415"
FT   CDS_pept        complement(623178..623915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13145"
FT                   /protein_id="ABK13145.1"
FT                   /translation="MAMLGNSLIGIGVLASLIGIGGFIDTRKVDRRFKTGYKNNEPDLR
FT                   NFGLSCKILLSGIGLFLVGLAANRILDPEIVPIRSSQFRADASYPAGNERDITQRENGN
FT                   PPTDGIHASSRSISSLAGPTSVSPEISGHGNDTSDSVADRVVSTRTFVTSFNCLQASHD
FT                   DEWAICHDPGLAAMDRRLAQLYSTALQNSSDTEALRQSETNWVTARHQCGKDLDCLRRA
FT                   YGERIGQFVGSLGSRPVLSTEGN"
FT   gene            complement(624244..625257)
FT                   /locus_tag="Bcen2424_6416"
FT   CDS_pept        complement(624244..625257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6416"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: bcn:Bcen_1413 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13146"
FT                   /protein_id="ABK13146.1"
FT                   /translation="MTQPTRPIILTGDRTTGPLHLGHYIGSLRARVQMQHEATQFLLLA
FT                   DTQALTDNMGRRQRVTENVIEVALDYLAVGIDPAISTIVVQSQVPELAELSQYLLNLVT
FT                   VARLERNPTIKEEIRLRGFERDIPAGFLTYPVSQAADITAFKATHVPVGDDQLPMIEQT
FT                   NELVRRFNATVEQPVLVECEAVLSAVTRLPGIDGKAKMSKSLGNAITLGSTPDEIAQAV
FT                   KDMYTDPNHLRVSDPGQVEGNVVFTFLDAFEPDVAKVDELKAHYRRGGLGDSVVKRVLN
FT                   ERLQALIEPIRTRRREFEADKAEVMAILKRGTLHAREVAGATLAEVKGAMGLTYFD"
FT   gene            complement(625467..625622)
FT                   /locus_tag="Bcen2424_6417"
FT   CDS_pept        complement(625467..625622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13147"
FT                   /protein_id="ABK13147.1"
FT                   /translation="MKKSKQPTRPPRDKDRTPLIRAGAWLLMAGLLYMLWPSAETAYLA
FT                   MESVIR"
FT   sig_peptide     complement(625494..625622)
FT                   /locus_tag="Bcen2424_6417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.336 at
FT                   residue 43"
FT   gene            626134..629004
FT                   /locus_tag="Bcen2424_6418"
FT   CDS_pept        626134..629004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6418"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG: bcn:Bcen_1411
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13148"
FT                   /protein_id="ABK13148.1"
FT                   /translation="MLRAFVGALDQNNRAIRFHWGRHQDALAHVLVPQSIDLTEGLCVG
FT                   IEGHLTCLSSRPDLPLSAFLGLPLSVQLMTDRGKPYPINGIITDVRAGQSDGSLTCVQL
FT                   TLRDALSILDQRINSRTFRSMSVPDILETLLHEWQQRSSALAQAFDFELVLDRNQYPKR
FT                   EQTRQAGESDAAFIRRMCRRDGIFWYTRAGKHDGAAADTPVHTLVFCDDPTKLPQAAAG
FT                   HVPYHRGTQSRERDSVTLWSAARALTPGSVRRASWDYKTGRIAQSEQETIVDQGEAGND
FT                   LAKLLADSVIDVPHAADSDADHERLAKARILAHEHRAECVHASSDVRDVSPGFWFTLAG
FT                   HPEVDTRPEEQRQFVVTSLHHRATNNFSKALDERAQVLFAASRWSFDALPVEEGAGVRY
FT                   ENTFVCVRRGVPLTPAYDPRVDLPPVHPFTAKVVGQDGEEVHCDELGRIKVQILGLRAD
FT                   DHAHAQGAGTSGTERDSAWVRWVSPWAGPNYGMDMLPRAGMEVLIDHLHGDPDKMVVIG
FT                   VLHGGPNMPTTFSHTGSLPGNRYLSGIKTKEVKADRYNQLRFDDTPGQISSQLASEHTY
FT                   TQLNLGYLTEPRNDGKGAPRGDGLEARTDAQAVIRAAKGVYVTAQQQGRAEGKMLERTA
FT                   LQTLIEQLQELVRNLGDASAANDADNTDLARIEKITSQIKGWDAGSNVDQGGGGSGGAP
FT                   MVAIEGPAGVTVVSQDAMVLGAQTNIDAVSAGNTQISVGRRLLMRVGDWMSAFAAKGMT
FT                   LVTADGKLRIEAHKEDVVVKAAKRIILEAGEEIVFRSPKVNTQASDEASINGGSSYSQW
FT                   NGGGVVHGTSGVWREHAASHSLVGPDNKPVKAPDPLTFKELEQQDSFAVVLRSHPSDGR
FT                   PLAYEPYTLYKGAAKIADGVTDEHGQLIIANHQKGTSSYTVKLHNGHEIEVPVMEGGLS
FT                   DDDQLAAQGWRAVDGDPESRQRHAQG"
FT   gene            629040..631121
FT                   /locus_tag="Bcen2424_6419"
FT   CDS_pept        629040..631121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6419"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bcn:Bcen_1410 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13149"
FT                   /protein_id="ABK13149.1"
FT                   /translation="MSDTNTQNKSKAPIDVDKRQAVASAQWFLEKQADYYAPPYEKNNI
FT                   DVFICGEDAFTQIAADLKAAKHSVEIICWGFDPGMELIRKGTVWPRGDTWGGLLRDVAA
FT                   GKFNNGKPVQVRLLSWYGVIGSTLSNNMPGYSGGRLTYEQKMAREVGKAGGIYVQLGNA
FT                   PQPLTPQDRREDFNARWYDDAFAGRLPNLSLRTRDGSSKDVHESLAHEPGKRDNLEDFG
FT                   LEKLATDHQKTILIDYDHEGGTQAVGYVMGLNSVTDYWDTQQHLFNDPRRGEGWEGAND
FT                   SQPGLKPYQDYASRIRGEALVAVSKNFTDAWNRAKGQGANLSRTHDFKKVPPGLTKNIG
FT                   TPCQRAQIARTQPEEKDKSIKALYIQATSFARNYIYIENQYFQYTEWPTKLKELRTEFL
FT                   SCSQAAGRSPADVPNLHVMAVIPTPERPQMVPRTHDTVKVLGYGTSMPNQDKAVEDELA
FT                   RNRQQQATWDAYVKRQKASGARIDPDYYPAPLSPAAQSAKDLGDKASLTKSLDQMGIRA
FT                   LVGSLWSFDYNWRSSKLNTETEKKQARWDDYVKKQQAKGELPDPDLAPMLPLPAQSFAA
FT                   RYREIYIHSKLLMIDDSFFTLGSANLNLRSMAVDAEINVGTDDRAKSEDLRKRVWKLHT
FT                   GNAADCNPSSLTPLAMSKAFRNWVQLLRANELARKKGDAPTGFLHPFHDDRVTGIRLS"
FT   gene            631231..632793
FT                   /locus_tag="Bcen2424_6420"
FT   CDS_pept        631231..632793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6420"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bcn:Bcen_1409 Sel1-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13150"
FT                   /protein_id="ABK13150.1"
FT                   /translation="MNDSLPRNMSLTAFDPHRTAFECKHEVDAVPPLDPEADRWNQQAM
FT                   ALTSSLLWPNQRDYKGAVDLWTKAAERKHWKAMLNLANAYAQGQGVERDSEHAVQITEQ
FT                   AMKLGIPAAYDLMGTYHMNGMGVKQDASRAYAFWQLAADMGSPSAMAYLGGKMDALYDD
FT                   PKAGFWGNRKIALKMLECAVAQGNGLAAYELGTTIVGDRAELSENNERALKTLHAGVKF
FT                   GSAESAGWLSASFGKGDALVGHVKDEARAERYSVLADRLERDPDLRLPNLDKVVPLPPA
FT                   KLPKWDGNKETLIDAAKAVTSVPASPVKPAAHPVSLRTGRAHVPDGYMLPEKPQVAVPP
FT                   QAETTAAPVGGYWLAQLKYPSAERHFAWNAAQVPMHYRNDELFDRSRPGLMPEDGRIFF
FT                   HYVGDAIPMPVQSAESHPRVTQGIARAAEFPDPAIRCRGIRACPVTGIWQAVVADDHPR
FT                   ATTFNQWYRQAYVLQGDAFPDPRVMHLDVSPADVTWTWWNEANHLGFAKLPQVSLGNPS
FT                   ENA"
FT   gene            633106..633609
FT                   /locus_tag="Bcen2424_6421"
FT   CDS_pept        633106..633609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13151"
FT                   /protein_id="ABK13151.1"
FT                   /translation="MSSADIIYKHDQWRKGAGGMPAGLSGQADSSAYAGLDLGLAQFAG
FT                   SSFSGSSFAGTSFRQAGWTGCRFLTCTFTGCDFAEITISGCTFVDCSFNDAAFQGSTFN
FT                   GVKFLGCKWNGVRFDGNTWHSVQVLDCTGTTVEAHGLKGLDVDFTGSYFEHLAFEDTEI
FT                   NGGH"
FT   gene            complement(633832..636111)
FT                   /locus_tag="Bcen2424_6422"
FT   CDS_pept        complement(633832..636111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6422"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: bcn:Bcen_1407
FT                   oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13152"
FT                   /protein_id="ABK13152.1"
FT                   /translation="MTNRREVPGIRKYDGPAGGWGALRATADAVRTQMETIEAPIVLMR
FT                   TNQPDGFDCPGCAWPDKEHKSTFQFCENGAKAVTWEATTKRVTPEFFAANTVSSLLRMS
FT                   DYELENMGRLTHPLVYDRATDTFRAIEWDDAFARIGEVLRALPPEQVEFYTSGRASNEA
FT                   AYLYQLFARELGTNNFPDCSNMCHEPTSVGLPQSIGIGKGTVSLEDFDHCELIISIGHN
FT                   PGTNHPRMMGTLHECARRNVPIIVFNPLRERALERFADPQDMIEMASFGSTRIASTYYQ
FT                   VDAGGDAAALKGIMKALLKLEAEQGNVLDRDFIAQHTNGFDAFSADLEATSWDDIERAS
FT                   GLSQAQLEQVAIAYAKSNATIVTYGMGVTQHNKGTATVRLIADLLLMRGNIGKPGAGVC
FT                   PLRGHSNVQGNRTVGITEKPSAEFLKKIEDVCGFTPPAQHGHDAVQAMQAMIDGTAKAL
FT                   LCLGGNFAVALPDPELSFPAMAKLDLSVHLGTKLNRSHLLVGKETFILPVLGRTELDMQ
FT                   ATGRQSITVEDSMSMVHASAGKLKPASDQLRSEPAIVAGIAHATLPNSKVAWLDLIADY
FT                   DRIRDLIDKTVSGFEAFNERIRTPGGFRLPLPPTERVWPTPTGKAMFSVYKGVKEDADV
FT                   LGAEQVLRLITLRSHDQYNTTIYGLDDRYRGVFGRRDVLFMNAADLEKYGLEHGDLVDI
FT                   ETVTASGRTLRLEKITAIEYDIAPGSVGAYYPEANVLVPLDYIDKESGTPSYKSVPVRV
FT                   VRSAVV"
FT   gene            complement(636236..639076)
FT                   /locus_tag="Bcen2424_6423"
FT   CDS_pept        complement(636236..639076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6423"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: bcn:Bcen_1406 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13153"
FT                   /protein_id="ABK13153.1"
FT                   /translation="MPALCDICHARPAVARATVMQDGERKTISICDYHFRQLMRHQSML
FT                   NPFDSLLGGGGPSSLFGGLGDDSPLAAEIPRESVDPTDAFSEQTLELLQRAAEKAHELR
FT                   RSELDSEHLLYALADTDVCAALLKELKLSPEDIKSYIDAHAHTGTADPDAPLDKLSISP
FT                   RVKKAVQYAFQASRDLGHSYIGPEHLLIGLASVPDSVAGTLLKKYGVTPEALRQKVVKV
FT                   VGKGAEDGRVDAPTGTPNLDKFGRDLTAIARQGKLDPVLGRAQEIESTIEVLARRKKNN
FT                   PVLIGEPGVGKTAIVEGLAQRIVNGDVPEVLRDKRLVEVNINSMVAGAKYRGEFEERAK
FT                   QLIDEVTAKQDELILFIDELHTIVGAGQGGGEGGLDIANVLKPALARGELSLIGATTLN
FT                   EYQKYIEKDAALERRFQPVFVPEPSVEQTIVILRGLRDSLEAHHQVTFADDAFVAAAEF
FT                   ADRYITSRFLPDKAIDLIDQAAARVRIGATSRPVDIQEGEAQIAQLKREQDYATSRKRF
FT                   DEAKQFEEQINAKQKAVDEMMEAWQRKTGSETLEVTVESVAEVVSRLTGIPVSELTQEE
FT                   RQKLLKMEEQLRERVVGQSDAVVAVSDAVRLSRAGLGQTHRPIATFLFLGPTGVGKTEL
FT                   AKALAETVFGDEQAIIRIDMSEYMERHAVARLIGAPPGYVGYDEGGQLTERVRRRPYSV
FT                   ILLDEIEKAHPDVYNVLLQVFDDGRLTDGKGRVVDFSNTIIIATSNLGAAIIMDNLTQP
FT                   EAARKTDKAIREELMQVLKGHFRPEFLNRIDEVIVFHALSKDNIRSIVQIQLDRVVRTA
FT                   AAQDITLVMGSSLVDHLTEVGYQPEFGARELKRQIRQTIETRLAKEILADRLKSGDKCE
FT                   VDYDKDSDEVKFNTLAAPEAKDPKDAKPDADGKAKPDGKAAKAAADAKQDDTRADAPPP
FT                   AAKPGKKSSGAKKDAH"
FT   gene            complement(639711..639980)
FT                   /locus_tag="Bcen2424_6424"
FT   CDS_pept        complement(639711..639980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13154"
FT                   /protein_id="ABK13154.1"
FT                   /translation="MSESNDALQALQASVATLKQTVDANAGSQAGDTAVLFTVVSLMLA
FT                   ELPPDTRNLIEDSFSVWANGLQNAALSADVKQIARQRLAMDLSD"
FT   gene            complement(640085..640900)
FT                   /locus_tag="Bcen2424_6425"
FT   CDS_pept        complement(640085..640900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6425"
FT                   /product="Linocin_M18 bacteriocin protein"
FT                   /note="PFAM: Linocin_M18 bacteriocin protein; KEGG:
FT                   bcn:Bcen_1404 Linocin_M18 bacteriocin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13155"
FT                   /protein_id="ABK13155.1"
FT                   /translation="MNNLHRELAPISSAAWEQIEEEVARTFKRSVAGRRVVDVEGPAGP
FT                   ELSAVGTGHLLDVAAPRELVNARLREVRTIVELTVPFELSRDAIDSVERGARDADWQPA
FT                   KEAAQRLAFAEDNAIFDGYPAAGIVGIREGTSNRRLTLPADVGAYPDAISDALEALRLA
FT                   GVDGPYSVVLGSDAYTALSEARDQGYPVLGHIKRIVSGEIIWAPAISGGCVLSTRGGDY
FT                   ELHLGEDVSIGYTSHTDKGVRLYLRETFTFLMLTSEASVAVAPQGNAAA"
FT   gene            complement(640893..641972)
FT                   /locus_tag="Bcen2424_6426"
FT   CDS_pept        complement(640893..641972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6426"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; PFAM: Dyp-type
FT                   peroxidase; KEGG: bcn:Bcen_1403 Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13156"
FT                   /protein_id="ABK13156.1"
FT                   /translation="MTDRQAAMQTTPPPLSQAVHSTITRSAIFLVATINPGADHADTIR
FT                   SWCGDIAALVRSVGKRVPGGNLTCVCGFGSDAWDALFGEPRPASLHPFREFGAGQRVAV
FT                   ATPGDILLHIRAEAMDLCFELATQLLNALGDAVTVVDEVHGFRNFDQRAMIGFVDGTEN
FT                   PEGREAVDFTVIGDEDAEFAGGSYVLVQKYLHDMAGWNALAVETQERIIGRTKLSDIEL
FT                   APDVKPSCSHSSLTTLDEGGQEVKILRDNMPFGRPGAGEFGTYFIGYARSPAPIEQMLE
FT                   NMFVGRPPGNYDRLLDYSRAVTGSLFFVPSADLLEALADRPAPPAEAIQSESTPSAPAA
FT                   PHRDGSLNIGSLKGTPTYE"
FT   gene            642262..643221
FT                   /locus_tag="Bcen2424_6427"
FT   CDS_pept        642262..643221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6427"
FT                   /product="phosphate-starvation-inducible E"
FT                   /note="PFAM: phosphate-starvation-inducible E; KEGG:
FT                   bcn:Bcen_1402 phosphate-starvation-inducible E"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13157"
FT                   /protein_id="ABK13157.1"
FT                   /translation="MDQTGPGFVRRPLSCTPGARGAVLLSGCVACSRLGSAPPDDGHHD
FT                   EPFGSDAYFRCNRRAWRAVRRGVRTEARRRAGRRAARWARTLSRLPVVAGPLGRRGRMH
FT                   RGRRRVLRVLPAHAVRGRAGDRRERSRCVRNGFAFARRGLAVARNHSLQRRSIDRRAHD
FT                   TTPVNALNTSTASTDTTAERIRRRFGHFLHAAELAGLVVIGLATAFAMAQEAWKVVLAG
FT                   EVSLTDLLLMFLYLEVLAMDLRYLRLGRLPVRFPLFIAMTSLARDLILRGATDSPERML
FT                   MTTFGIVLLAVGVLILSFGQHRFPADVDDVEDDVHVRK"
FT   gene            643309..643764
FT                   /locus_tag="Bcen2424_6428"
FT   CDS_pept        643309..643764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6428"
FT                   /product="membrane protein"
FT                   /note="KEGG: bcn:Bcen_1401 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13158"
FT                   /protein_id="ABK13158.1"
FT                   /translation="MTRQLIVAVFGSVETARQAANDFEALSEKNEGFHIENGVVVEKDA
FT                   NGKLAVLDAESRPFKGGVIGAIAGGLLGLLAGPIGMVTGMAAGAGAGILAQAAGNALLD
FT                   GTFVETVAARLVPGSVAVILEAKEDTPFSVDNVVTGFGGKVFRQTLD"
FT   gene            643799..644047
FT                   /locus_tag="Bcen2424_6429"
FT   CDS_pept        643799..644047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13159"
FT                   /protein_id="ABK13159.1"
FT                   /translation="MRIDQSYRRFDIAATLSPLPGNRAIASVDVTTDDPGRLADLGTGQ
FT                   FLQIRKWIESNDVALLTVVFDECKVAIDHYADNVDDA"
FT   gene            644427..645851
FT                   /locus_tag="Bcen2424_6430"
FT   CDS_pept        644427..645851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6430"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bcn:Bcen_1399
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13160"
FT                   /protein_id="ABK13160.1"
FT                   /translation="MKLYEKFANDVERLIRQGVYRHGDRVPSVRQASQQHRISITTVLH
FT                   AYLLLESRGLLESRPQSGYFVNLRRDDGHAPVRELRPSKPIAISSSVDVSRLVLSTLRS
FT                   IGTDDAVPLGSPYPDPSLFPFEKLNRYAYAAGRDKSLWGVTDGLPPGHPRLIRQIARRY
FT                   LENGMSVDPNEIIVTVGATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERMGMKAIE
FT                   VATHPEYGIDIAALAAIAKSQPIAACMVMPNFQNPLGFQMPDERKRELVAFATKADLPI
FT                   IENGVYNELYFGNMHPSTLKSFDRHDIVLHCASFSKSLTAAYRIGWALPGRYREQVEKL
FT                   KFLNTLATPSLPQLAIAEFLERDGYEHHLRRVRKAYAQQANLMRAMVSRFFPEGTRISS
FT                   PAGGYVLWVELPAQVDAMRLYQLALEQGITIGPGYMFSIADTYRNFIRLNYSSPWSPEI
FT                   ERAVVTVGKLAASCID"
FT   gene            complement(645877..647037)
FT                   /locus_tag="Bcen2424_6431"
FT   CDS_pept        complement(645877..647037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6431"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: bcn:Bcen_1398 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13161"
FT                   /protein_id="ABK13161.1"
FT                   /translation="MATVLCVLYPDPVDGYPPRYVRDTIPVITHYADGQTAPTPAGPPG
FT                   FRPGELVGSVSGALGLRGYMEAHGHTLIVTSDKDGPDSEFERRLPEADVVISQPFWPAY
FT                   LSAERIARAPKLKLALTAGIGSDHVDLDAAARARITVAEVTGSNSISVAEHVVMTTLAL
FT                   VRNYLPSHAVAQQGGWNIADCVSRSYDVEGMHFGTVGAGRIGLAVLRRLQPFGLQLHYT
FT                   QRHRLDASIEQALALTYHADVASLASAVDIVNLQIPLYPSTEHLFDAAMIARMKRGAYL
FT                   INTARAKLVDRDAVVNALTSGHLAGYGGDVWFPQPAPADHPWRTMPFNGMTPHISGTSL
FT                   SAQARYAAGTLEILQCWFDGRPIRNEYLIVDGGTLAGTGAQSYRLT"
FT   gene            647270..648799
FT                   /locus_tag="Bcen2424_6432"
FT   CDS_pept        647270..648799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6432"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Rieske [2Fe-2S] domain protein; KEGG:
FT                   bcn:Bcen_1397 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13162"
FT                   /protein_id="ABK13162.1"
FT                   /translation="MTGSDASSRPDLTQGIALDDLADGAMIEGHVGDAAVLLVRRADEL
FT                   FAVGAQCPHYGGPLAQGLLVGDTIRCPWHHAAFCLRTGEMERAPALDGLPCWRVERRNG
FT                   RAVVVDARPAAAPPALKETGLPTSVVIVGGGAAAIAAAVTLRQEGYPHAITLLSADVDP
FT                   PYDRPNLSKDYLAGTAEADWLPLRAPSFYAGQRIDVRCNTRVTRIDPAQRSVELADGSR
FT                   IEYGALLLATGAEPNRLNVPGADLPHVRTLRSRADCDALIAKLKTARRCVVVGASFIGL
FT                   EAAAALRTRGLDVHVVAPDPHPMGRVLGDALGDTIKALHEAHGVVFHLGATPARIGPDS
FT                   VTLSSGDVLPADVVLVGIGVHPNVELAQDAGLAVERGVTVDRFLQTSAAGIYAAGDIAR
FT                   WPDPLTGERIRVEHWVVAERQGIVAARNLLGQQRPFDAVPFFWSQHYDLTLRYVGHAEQ
FT                   WDRVEIDGDLGAHDCSIAYWRGNTRLAVVTIARDLDNLKAEAALERQRASA"
FT   gene            648842..649219
FT                   /locus_tag="Bcen2424_6433"
FT   CDS_pept        648842..649219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13163"
FT                   /protein_id="ABK13163.1"
FT                   /translation="MNPDVRARFETEFAPRIATRLRGLYQPGEVRVDVVPHDGQGSPTC
FT                   VDVIGLTSTVGLPNRLNARLAWRDDAIAGLLAEPDHSRFDRYLAVLPVTIERWQMELPV
FT                   DFSSRTQRDREILIGDLDFDA"
FT   gene            complement(649269..649487)
FT                   /locus_tag="Bcen2424_6434"
FT   CDS_pept        complement(649269..649487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13164"
FT                   /protein_id="ABK13164.1"
FT                   /translation="MQATDTFMGHEIRVDATRNANGAWVAQVRIFRDGAPVDLPAPELV
FT                   TPEWLTCDEALRGGIDQGRVIIRTRDR"
FT   gene            649538..650248
FT                   /locus_tag="Bcen2424_6435"
FT   CDS_pept        649538..650248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6435"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: bcn:Bcen_1394 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13165"
FT                   /protein_id="ABK13165.1"
FT                   /translation="MACAAHRKRTGVCVSRAARDGSDLVSFDLTFSIKVFAALFAIMNP
FT                   IANIPVFLSLTEGAADGVRRKVALTAAIGVTVGCIVSAVAGGAILHVFGLTIDDFRLAG
FT                   GLLVLLIALSMLHGAPSRQHAPGADESADPAAADSVAIYPLTIPLLVGPGTIATMIVLG
FT                   HGAVATGQEFAFALGLAAFLVLLAVSLLSAPLIGHYLSPRVTAVTQRLMGMILAAIAMQ
FT                   MIVASLKAAFGLPH"
FT   gene            650278..650748
FT                   /locus_tag="Bcen2424_6436"
FT   CDS_pept        650278..650748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13166"
FT                   /protein_id="ABK13166.1"
FT                   /translation="MNTLIVLSYPDLDAARRALAELGTLRDRHVVALAGVVIVECSTDG
FT                   QLRTHAVDPGRVSSGSLLDSVVAHIESSLDAWRERPVDDALTDRVARKARPGTVSLGLA
FT                   ATQLDIYALSAALAPLGGEVTDTTLSIDDELKLVEAISNARDGSGERGPATD"
FT   gene            650889..652094
FT                   /locus_tag="Bcen2424_6437"
FT   CDS_pept        650889..652094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6437"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcn:Bcen_1392 alcohol dehydrogenase GroES-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13167"
FT                   /protein_id="ABK13167.1"
FT                   /translation="MKAVVFHGIGDIRIDTVPDPEVSATTDAVVRLTASAICGTDLHMV
FT                   RGTLGGMKPGTILGHEGVGIVEAVGRDVRNLRRGDRVLIPSTIACGSCAYCRAGYTAQC
FT                   DVANPGGPRAGTSFFGGPAETGPVDGLQAEYARTPLAHASLIRLPDAIDDDRAILMSDI
FT                   FPTGYFGAQLAEVKPGDTVAVFGAGPVGQFAIASAKLMGAGRVIAIDRIASRLEMACAQ
FT                   GAEIVDFSEDDPVDTVLRLTGGIGVDRVIDAVGVDAMRATHGPAAADRDAARAFDAEVD
FT                   AIVPHRKPDGRNWVPGDGPSQVLQWAVRAVAKAGTISVIGVYPPAARVFPIGEAMNRNL
FT                   TIKMGNCNHRTVTPPLVELVRSGAFDPLSVLTRTEPLTNAIDAYRAFDVREPGWMKVKL
FT                   AP"
FT   gene            652130..652453
FT                   /locus_tag="Bcen2424_6438"
FT   CDS_pept        652130..652453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6438"
FT                   /product="protein of unknown function DUF326"
FT                   /note="PFAM: protein of unknown function DUF326; KEGG:
FT                   bpm:BURPS1710b_1573 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13168"
FT                   /protein_id="ABK13168.1"
FT                   /translation="MTDQYDNCMAACDACAHACDTCAAACLAERDVHALATCIALDIEC
FT                   AQLCRFASGAMARRSGLAPRICALCAHACDLCAAECSRHAHEHCRRCALACEACAAMCR
FT                   AMA"
FT   gene            complement(652464..654794)
FT                   /locus_tag="Bcen2424_6439"
FT   CDS_pept        complement(652464..654794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6439"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bcn:Bcen_1391 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13169"
FT                   /protein_id="ABK13169.1"
FT                   /translation="MQIACRRRCRAATVAHRSPGKPPGAPICNAIAVFACRTSWRAAGL
FT                   VRVVRFVRPARLAQPLGAIRLDIGAFLQRRVAIRRRALAGARAVRVAVERRVAAFERMV
FT                   VQRRIDVERMATRARRVAAAVGRVARAQRPAVAAAAGVVVVRAGRFVVGIQGAVHVGLL
FT                   AWLAAGRPAGWPPHDRRTVRSCNRHAAPAADGRAGAHVGGRHGRCAPIDQPNRVPLFFR
FT                   TCQFDPRGRLSGGGSTTCGRPYFRPAAPMKKDDADFHPHPPPDARDLQHRFAEFRFQTV
FT                   VESITDYAVFMLDPDGNVATWNAGAQRIKGYRAAEIVGHHFSRFYPPDAIAAGRPSHGL
FT                   EVAAAHGHFEDEGWRVRKDGTQFWASVTITPVRDATHALCGFIKITRDMTERKRLEELE
FT                   ASTHRLSVFIAMLAHELRNHLAPLRNSVGVLQSLPDPAPVLAQCRDAVNRQVAQLTRLV
FT                   DDLLDVGRITAGKVELDARPVTVRDIVCRGVESIQPKLAARGQWIRVDLPTDSVVLHGD
FT                   DARLVQVLHNLLDNASKFSPHGGRIDVGARIDGPSVAISVVDHGVGIAPGALETIFDLF
FT                   EQEGATGRSPSGGFGLGLAICRSFVELHGGRIAAESGGPGHGATFTVWLPIAQVARNEH
FT                   TAPPPPAAPGQPAVEPLRIVVVDDNRDSADTLAVLLQLKGHAPRVAYNANEALALARDY
FT                   APQLMLLDLTMPDVDGFTLLQELRAIDALRDTTCVALSGHARASDLERTERAGFDDHLV
FT                   KPVEMAVLDALLQRVARQVQGTP"
FT   gene            654865..655728
FT                   /locus_tag="Bcen2424_6440"
FT   CDS_pept        654865..655728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6440"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: bcn:Bcen_1389
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13170"
FT                   /protein_id="ABK13170.1"
FT                   /translation="MQRRYPGRHGERGGSPDWHERDERAYRGAGERGIPDDPARWPEED
FT                   YESAYRRFASEDTGPEDWGSEWTERAARPADQRRGAGDADWSGGAREPARGAERGYGDP
FT                   GRRAQGHEGRYGGERPEYRGHHRMGWYGSERDIGDPRGDPRYGGSAPDLSRFGRDTERD
FT                   ALRHRRGPKGYTRSDERIREDVCERLAHALEIDVSDVTVQVKAGRVELEGTVPARWMKH
FT                   DIEDLADGCLGVQDVENRVRVRRDGEHDAGMVLHPDQRTVTPTQPAARDPEPGTVVGGR
FT                   EREPRH"
FT   gene            655776..658577
FT                   /locus_tag="Bcen2424_6441"
FT   CDS_pept        655776..658577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6441"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: ABC transporter, transmembrane region;
FT                   response regulator receiver; ABC transporter related;
FT                   SMART: AAA ATPase; KEGG: bcn:Bcen_1388 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13171"
FT                   /protein_id="ABK13171.1"
FT                   /translation="MTTGIDETPIKDREAAAGRAPRGRRDERGLRVRIAVELWRAIWHY
FT                   RTRVLAAIVLLVLAKAAAVSVPLLLKDIVDGFGRAAGQPMAWPVLLLFAYAVVRFASNA
FT                   LNEVRDMTFVQVTQHTVASFTVRTFGHLHRLGARFHAQRETGAVVRDLEKGTAGIGYLL
FT                   GVAVFTIVPTAIEIGSVLVIVISKYGGGFTAIIFVTFAVYAAYTVVFTRRRMRYQRRVN
FT                   ALEAESNSRVVDSLLNVDTVKYFAREDVERDRLDRVLDEWREAGVDNQYALSALHIGQS
FT                   ACIGAGIAAVMLLAGQQVARGAMTIGDLVLINAYIIQISLPLNALGFVFREANDAMTNI
FT                   ERLFGLLDARGKPGEDGDAPGAQPLVVRGGAIEFEHVDFGYEPSRQILFDVSFRIEPGQ
FT                   TIAVVGGSGSGKSTLARLLFRLYQPDAGTIRIDGQDLRLVTERSLRDALGIVPQDTILF
FT                   NDTLAYNIAYGKRDATRGEVIAAARGAQLDAFIERLPDAYDTRVGERGVRLSGGERQRV
FT                   AIARALLKAPPIVVFDEATSALDTRSERAIQQELMRVAQHRTSLIIAHRLSTIVDADRI
FT                   LVMEHGRLVEHGTHDELLESGGVYAQMWSLQAKQRELERTEAKFARQPVRINPLVSQVL
FT                   DSLAEAAARRGVPVFRHVSDEDLVVNADPAALRRFVWELCRGAIEASSGGQLEVRTARH
FT                   DPEARITIACTGVDATELSLIDLERLQDAIEEAGGYVVRERDDTGVTLHLSLPMYAVAP
FT                   ASMQPAGAVSNLAAGAAATAKPLDGLRIACVDDHDEAREALGALLKVAGADVHAYASGQ
FT                   ALLDDLWRARRADWPALLVCDIDLGDDEDDGYAVMSRVRQLDAARDRDGRAPLEALALS
FT                   GHARDRDRTRAVEAGFHAYLTKPAVAADLIAALRALAFSSGEIHAEPSEPDDTRSPERA
FT                   SRR"
FT   gene            658603..659046
FT                   /locus_tag="Bcen2424_6442"
FT   CDS_pept        658603..659046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13172"
FT                   /protein_id="ABK13172.1"
FT                   /translation="MAAVELLLPTLSAALQSDFVGDSGCLHIVIMDPALGPHDAAFEDA
FT                   ILYEFSLPDPKDWDADYRAYARAKARLSWETGRDGHVVQALEPYRLRAGDTNLWGGVAL
FT                   GGIVVGVSGAQPWFDEAFAGCIAHCLRALAKHRAQATPDGLAI"
FT   gene            659213..659992
FT                   /locus_tag="Bcen2424_6443"
FT   CDS_pept        659213..659992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6443"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; Male
FT                   sterility C-terminal domain; KEGG: bcn:Bcen_1386
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13173"
FT                   /protein_id="ABK13173.1"
FT                   /translation="MDFRHRQEVQVNATHDPAKPPLAGRTALVTGGGRGLGEAICEELA
FT                   QHGAHVVVADLDGDRAAAVAQRLERHGGQAVGRPLDVRDEASVLQVVHDARESLGELDV
FT                   IVNNAAIDVTAPIDDVSVDAWQQVLMTNLFGPYLMCHAAVPMMKARGNGHIVNIASTAS
FT                   KRAWPNASAYHATKWGLLGLSHALHAELRPSGVRVSAIVAGGMRTPFLLDRFPDIDEDT
FT                   LQPPEHVAAAVRFVLTQPPGTVVPELMVLPMKETSWP"
FT   gene            659983..660594
FT                   /locus_tag="Bcen2424_6444"
FT   CDS_pept        659983..660594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6444"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; histidinol-phosphate phosphatase family protein;
FT                   hydrolase, HAD-superfamily, subfamily IIIA; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: bcn:Bcen_1385
FT                   histidinol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13174"
FT                   /protein_id="ABK13174.1"
FT                   /translation="MALKRERRLPGAVLLDKDGTLLDDVPYNVDPARMRLAPGAARALR
FT                   TLGATGMPLAVVSNQPGVALGRFTENELGAVRQRLAELFEANGATLADFFYCPHHPRGS
FT                   VPRYTCDCICRKPRPGMLRRALSALGAVPEWSWMIGDILDDVEAGRTARCGTILVDCGN
FT                   ETEWQLNAARTPHHVVDRIDLAADIVVREAVRRHGSWVRR"
FT   gene            660591..661796
FT                   /locus_tag="Bcen2424_6445"
FT   CDS_pept        660591..661796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6445"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   bcn:Bcen_1384 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13175"
FT                   /protein_id="ABK13175.1"
FT                   /translation="MSTAWSRARRILCVRLDSIGDVLMTTPALRALKESGADRQLTLLT
FT                   SRTGAALAKHLPMVDDVWSYDAPWVKHPDVRGDPVADLDMIDRLLAGRFDAAVIFTVYS
FT                   QNPLPAAMMCWLAGIPLRLAHCRENPYELLTDRVPETEPESHVRHEVARQLALVRAIGA
FT                   KTSDWRMAFEPGDAARRAVHARLQAALQRIGGAREPGATRARWLVVHPGATAASRRWPA
FT                   ERFGEAAAAVAPLFDGIAVTGSADERALVDAVCERAGPRAVPLAGVLPLGELGALVETA
FT                   DLLLSNNSGPVHLAAALGTPVVDLYALTNPQHTPWRVPHRVLNVDVPCRNCYRSVCNQP
FT                   GHPCLRGVSVDDVAAAVHALLRGRARHAQRAAEWAAAHDEGEPVAAHASNVIPFAHVIT
FT                   RN"
FT   gene            661800..663545
FT                   /locus_tag="Bcen2424_6446"
FT   CDS_pept        661800..663545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6446"
FT                   /product="Carbamoyltransferase"
FT                   /note="PFAM: Carbamoyltransferase; KEGG: bcn:Bcen_1383
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13176"
FT                   /protein_id="ABK13176.1"
FT                   /translation="MPESTYTLGINAAFHDSAACIVRDGVVIAAAEDERFTHVKHAKRP
FT                   VPFSTWELPFHAIDYCLAEAGITLADVDHVAYSYDPWFELDREGTAPALTLPLSPSAHA
FT                   PREDGASPWHPLFLSSIVNAPRQLAGGAPHHLQRRFRGVTHDGPFRWHFIEHHLAHEAS
FT                   AFLAAPFERCAVMTMDGRGERATTSYGVFDGRAYRRLGQVNLPHSLGLLYERLTRYLGF
FT                   LHSSDEYKVMALASYGKPVFADEMRKLVRYRGEGRYDVLDADLAALFGPARERGGPIEP
FT                   HHCDIAHALQLVLEETTLQAVDWLAAETGERQLAMAGGVALNCVMNARIRDRGPFDDVW
FT                   VQPAAGDAGTALGAALWTDFRMRGARGDWRMDHAYLGPAYDDDAIEAFLKEAQLPYRRL
FT                   ADVAAQTAALLAANRVIGWFQGRMEFGPRALGARSILASPIDPDMQQKLNRIKDREDFR
FT                   PVAPVVLEDRAHHWFSGGRRTPLRAPFMLFVYDVLPERAAKIPAVRHIDGTARVQTVDE
FT                   TQHPLLHALLTEFDALTGVPVLVNTSFNTRGEPIVCSPRDAIECFWTSPLDALVIGPFL
FT                   LEKPR"
FT   gene            663542..664543
FT                   /locus_tag="Bcen2424_6447"
FT   CDS_pept        663542..664543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6447"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bcn:Bcen_1382 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13177"
FT                   /protein_id="ABK13177.1"
FT                   /translation="MNMRDTHLPPVVSVVVPTYRRPDLLERCLDALCAQVFDPTTYEIV
FT                   VVDDDPAGSARAVVDACRARVTDVPVIRYMTAPDTQGPAGARNVGWRSAGGALIAFTDD
FT                   DTIPDPTWLRHGAAALLAEPSASAAAGRIDVPLRPRPTDYERDAAGLAQAEFATANCFV
FT                   RRAALERIGGFDERFTRAWREDADLMFALHEHAGPIVEADAARIVHPVRPARWGSSIGA
FT                   QSKVYFDALLYKKHRTTYRRHIRPTPPWHYYAAVLAALGAIGCFAAGWPAPAIVCAAVW
FT                   AAITAGFCAKRLRGTQLTVSHVAEMIVTSIAIPPVSLYWRMRGALHFRVLFL"
FT   gene            664540..665628
FT                   /locus_tag="Bcen2424_6448"
FT   CDS_pept        664540..665628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6448"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   bcn:Bcen_1381 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13178"
FT                   /protein_id="ABK13178.1"
FT                   /translation="MKLDPGVDSDGSRGPKRIAVFRALQLGDMLCAVPALRALRRGEPD
FT                   ARITLIGLPWAREFASRFSDYIDSFIAFPGAPGLGEQPEPDAATREAFIAECRSRDFDL
FT                   AIQLHGSGAHTNAIVASLGATRTAGFVPADGGTAALDCALVWRDDEPEVTRYLALTRKL
FT                   GYADWGDYLEFPLGGLDYALWHVLCDEHSLDPGRYVIVHPGARMASRRWPVERFAHAAR
FT                   QLADDGWQIVLTGTRTELALASAFAEHLGRPCVNLCGRTPLGALAALIARARLLLCNDT
FT                   GVSHVAAALGTPSIVVACGSDTARWAPLDTERHHVLANYPPCRPCMFDTCPYGHECATA
FT                   IGVGDVMDRAGELLAEERRHVT"
FT   gene            665618..666568
FT                   /locus_tag="Bcen2424_6449"
FT   CDS_pept        665618..666568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6449"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bcn:Bcen_1380 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13179"
FT                   /protein_id="ABK13179.1"
FT                   /translation="MSRKRLRVLTWHVHGNYLYYLSQAPHDFYIVTKPQHPPGYAGRVG
FT                   HLPWGDNVHEVPAECVRDTEFDCVLYQHAKHYQHDRLRLLSEAQRALPTLFVEHDPPRE
FT                   HPTDTLHPVQDPNVLLVHVTPFNALMWDNGVTPTRVIEHGVLMPEGVEYHGTLPKGVAV
FT                   VNNLARRGRRLGADLFEVVRHSVPIDLVGMGSSELGGIGEVPNPALPQFLSHYRFFFNP
FT                   IRYTSLGLAVIEAMMIGLPVVALATTEMAQLVKTGSNGVADTRPAVLIDAMRMLIRDPE
FT                   LAREWGAAAKRDACERFGIERFARDWDAALRDVTG"
FT   gene            complement(666606..667760)
FT                   /locus_tag="Bcen2424_6450"
FT   CDS_pept        complement(666606..667760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6450"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_1379 sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13180"
FT                   /protein_id="ABK13180.1"
FT                   /translation="MSSNRYKRYSEYVKDDVCHVLFYLVTTHSVKTSQPGYYSMSKSDD
FT                   DGTRLFGRSRTIQDLLLKVSRVAATRVSVLVVGESGAGKDIVARLIHDMSPRRRGPFVP
FT                   VNCGAIPKDIAESQLFGHEKGSFTGAVAQHVGMFEAARGGTLFLDEIAEMPLELQVKLL
FT                   RTLETNTIVRVGGHEAIPLDVRIVAATHHDPVEALRSGALREDLFYRIAPIALHVPALR
FT                   QREDDVGDIALQIVERLNARHRTRKRLSTQAMKALRAYTWPGNVRELRNTLERAFILAD
FT                   EQIELQLPRRPPPREEVRHNAMTLHIGTTLAHTQQRFIVASLRHFNGDKPRTAKALGIS
FT                   LKTLYNRLALLPESERNAASGSAPPAANASNGGSASTSPPATMP"
FT   gene            667976..669343
FT                   /locus_tag="Bcen2424_6451"
FT   CDS_pept        667976..669343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6451"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: bcn:Bcen_1378
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13181"
FT                   /protein_id="ABK13181.1"
FT                   /translation="MPYVLIVEDDADTRTMLATLARTQQLTCDTAATLEEARTLVSTHT
FT                   PDLVLCDLVLPDGNGMDLFDALPKRAHCEIVLTTGHASLETAIDALRRGATDYLVKPLN
FT                   MQRLNSIFARVPRTTALHEEIAELRSELQRLGRFGRMLGSSPAMQAVYDAIGRVARTEA
FT                   SVLLTGESGTGKELAAQTVHDLSLRRRGPFLAVNCGAIAANLVESEMFGHDRGSFTGAE
FT                   RQHKGFFERADGGTLFLDEITEMPLESQVKLLRVLETGRVTRLGSTREIDVDVRIVAAT
FT                   NRDPEAAMADGKLRPDLFHRINVFPIPLPSLRERGDDIPMLADAFLQRYNEESGRNLRF
FT                   APAVREALKTYEWPGNVRELRNFVQRASIFTDADVIETLPPPIMDELSSMVDSHEDRVT
FT                   VPFGTPLEEVDRKLILGTIAQCGGVKAQAAEVLDVSLKTIYNRLAQLEDEAEKPDS"
FT   gene            complement(669361..670224)
FT                   /locus_tag="Bcen2424_6452"
FT   CDS_pept        complement(669361..670224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6452"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bcn:Bcen_1377 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13182"
FT                   /protein_id="ABK13182.1"
FT                   /translation="MTAIVLTCRRAAELARTLEHLSVLPDRPAIVVVDNAADADTATLI
FT                   HDRFPHVALVHAPGNLGAAGRNLGVAVARTRHVAFCDDDTWWAPGSIAEAANLLDAYPH
FT                   VAAVTARVLVGPDEREDPTCRLMADSPLDAPVALPGRPILGLLAGATAFRRDAFVRAGG
FT                   YHPHYFLGGEEALLALDLYRAGHWLVYAPRLTVHHYPSLQRDRPTRARTAARNAVWTAW
FT                   LRWPASAAWRHTLRMLPLLRRERAIVRTFAGLPWTLRERRTIPPHVERMRRRLEHDTRR
FT                   EAGTET"
FT   gene            complement(670263..670958)
FT                   /locus_tag="Bcen2424_6453"
FT   CDS_pept        complement(670263..670958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6453"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: bcn:Bcen_1376
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13183"
FT                   /protein_id="ABK13183.1"
FT                   /translation="MPDPTRWLVVSPHLDDAVFSCGQLLAQAPGSIVVTVFAGIPPHGT
FT                   PAPPWDQRAGFRHADEAVRARRDEDRRALALLDARPVWLDFLDDQYGVPTTSTAIATRV
FT                   AAAIDAHPGFGVLAPAGLFHRDHLQVQEAMLSLLRADDPSHVWRFYEDVPYRRIDGLMA
FT                   RRVIEWRERGWTAQPVAVPAAGDTNSVAAKAAAVDAYASQVTLLEPHMRAALREPETIW
FT                   RLECDVTSA"
FT   gene            671078..673384
FT                   /locus_tag="Bcen2424_6454"
FT   CDS_pept        671078..673384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6454"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bcn:Bcen_1375 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13184"
FT                   /protein_id="ABK13184.1"
FT                   /translation="MTEIARPQAGNYATAVMLVAIATVLQTLAIRFGGVNLPFVLYYPL
FT                   LAGAAWATSFVFGIVSTVVSGLLVWTLFLSDPAAYTTPLPDRLVQLGTFILIGALVCAV
FT                   ASLLHHTRLTNDRARRREAAARRQFEAVLRALPHGVIATDPNGRLTYLNAAAAELVGCR
FT                   PDEAVGRPVRDVLRIVDHEGRRVPTTPLDRALGGAEATSDRHWLQAGSGDRVPIVAVAS
FT                   PIGDADGNLDGAVLLLRDAGADRARVDASRLQHAVVEASPDAIVGIDADGRIASWNAAA
FT                   QRIFGYDEADARGRRFDTLIARRWLRLNPLADAFDAMHEPVGPLELLCVRRDGRRFRAT
FT                   VSACPVQGEARACVTLSLTLHETGAQRRRDLRAQRSLQGARDARDQADTSNRLKDELLA
FT                   TVSHELRTPLNVIYGWIEVLRNTGDHALQHQAIDAIDRSARSLTRMVGDILDASSLATG
FT                   KLRLDATPVDVVRLFSDQVGTFQTAASSAGILLEFDCAASACIVSGDAERLRQMLSNLI
FT                   SNALKFTPGGGSVTVGLARDGGHAVLTVADTGQGIATEFTPYVFDMFRRADDSPASPRR
FT                   GLGLGLSIVRHIAQLHGGNVTVASAGRDRGTTFTVTLPAGWQPGGAMAWSIVQAGGQRE
FT                   ALVLDTQRILIVDDDATTRASLTAALTTFGAAVAIASSGREALAMVADMRPTVVLSDLA
FT                   MPDGDGFWLLEALRRGTTNGDSGPLDVRVLAVTAHAGLADERRALEAGFDGYLCKPVDV
FT                   RELAHKIAHVTKRDG"
FT   gene            complement(673425..674471)
FT                   /locus_tag="Bcen2424_6455"
FT   CDS_pept        complement(673425..674471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6455"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: bcn:Bcen_1374 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13185"
FT                   /protein_id="ABK13185.1"
FT                   /translation="MKGYDRKRVLVTGGAGFLGSHLCERLVTAGHDVLCVDNFYTGTKD
FT                   NIAHLLDAPNFELMRHDVTFPLYVEVDEIYNLACPASPVHYQRDPVQTTKTSVHGAINL
FT                   LGLAKRVKARILQASTSEVYGDPDVHPQDEHYCGRVNPTGIRACYDEGKRCAETLFADY
FT                   HRQYGIDVRIARIFNTYGPRMHPADGRVVSNFVTQALAEQPLTVYGDGKQTRSFCYVDD
FT                   MVDALIRLMDEPGDASEPVNLGSDVEIAMIDVAREVVRIVGANVPIEFRPLPSDDPRQR
FT                   RPNLAAAQKRLGWRATTTFANGLAHTARYFIQRQVTHHAPGDLVRSTRIASHLLAQVHT
FT                   QNRPAPTT"
FT   gene            complement(674471..675790)
FT                   /locus_tag="Bcen2424_6456"
FT   CDS_pept        complement(674471..675790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6456"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bcn:Bcen_1373 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13186"
FT                   /protein_id="ABK13186.1"
FT                   /translation="MQRIALISEHASPLGVIGGVDAGGQNIYVANVAKQLAERGLDVDV
FT                   YTRCDNPHLPEVVSIGPRMRVIHVPAGPPTDVPKEQLLPYMGPFAQYMIARMRREPDPV
FT                   DVMHANFFMSGDAALRVKKALGIPLVTTFHALGRVRRLHQGTADGFPDARFTIEDTLAR
FT                   RSDRLIAECPQDALDLTTHYRADTARIEIVPCGFDAREFRPVPRVDARARLGWPQDAFV
FT                   VLQLGRLVPRKGIDTVIDALARMPRDPQRPTHLYVVGGSQPTPDPARDPELARLAAFAH
FT                   ELGIANRVTFVGRRDRDALHLYYSAADVFVTTPWYEPFGITPVEAMACAAPVIGSDVGG
FT                   IRTTVDDGTTGYLVPPRDPAALAARLVQLRAQPDLCAALGRAGYLRAHRFYTWQGVADR
FT                   LVDIYRDVAHAQRAGTSAGTGRRTPVATTRGVLAHRKENT"
FT   gene            676035..676445
FT                   /locus_tag="Bcen2424_6457"
FT   CDS_pept        676035..676445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6457"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: bcn:Bcen_1372
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13187"
FT                   /protein_id="ABK13187.1"
FT                   /translation="MKVSPLQARPPRIRRQRALRTGMAVAIAAAAACMVVAPNAVAAGD
FT                   DGAASSSTSSSSSHSSTGTKIRDATITTKAKAELVGTSGLSAGDIHVKTRHGTVTLTGS
FT                   VPDEQQRTQAVSVVKQVDGVQGVRDQLTIRPK"
FT   sig_peptide     676035..676163
FT                   /locus_tag="Bcen2424_6457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.953 at
FT                   residue 43"
FT   gene            676476..677504
FT                   /locus_tag="Bcen2424_6458"
FT   CDS_pept        676476..677504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6458"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_1371
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13188"
FT                   /protein_id="ABK13188.1"
FT                   /translation="MNCMLKPVGEQTIVITGATSGIGLVTARKAARRGAKLVLFARNEE
FT                   ALNTLCEEIRQHGGLAVPVAGDVGNVEDLQRAAAAAADTYGGFDTWINNAGVSIFGTAA
FT                   QVPLEDQRRLFDTNYWGVVHGSLVAADHFRRKSDFHGGAIINMGSEASDAPVPLQSAYV
FT                   ASKHAVKGFTDSLRLEMEADHLPVSVTLIKPAAIDTMFVMHAKNYMNVEAKLPPPIYDP
FT                   DLVADAILFAAAHPRRTLFVGGAAKLTSAGAYHAPRLFDRLAATLFSRGQRTVRPARPR
FT                   DDNALYDSRHALHEREGMEGPVLRSCAYNSVVQRPKVAGAVALGAAALVFAAFARVRRQ
FT                   SA"
FT   gene            677532..677831
FT                   /locus_tag="Bcen2424_6459"
FT   CDS_pept        677532..677831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13189"
FT                   /protein_id="ABK13189.1"
FT                   /translation="MTSRQHTGHEYSHSRAHEGERTQQDHDKGGHQTGHGKPPSPVDVQ
FT                   KALKGMDYPASKSDVVQCAERSHADPAVLDMLRKIPEREYDTPASVSKELGRLM"
FT   gene            677893..678459
FT                   /locus_tag="Bcen2424_6460"
FT   CDS_pept        677893..678459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13190"
FT                   /protein_id="ABK13190.1"
FT                   /translation="MAMIVAGRFTTFDEAEGGARHLYERAFGPDDVSIFFLNPGGQHAR
FT                   FPIGGDVYADTAAKPGGRGAMVGAIRGLLIGVVLGLIAYALGLHYWFVPAAAALAGAYL
FT                   GAFGGALGRMRGEQAEGKGTLAQSETGVILAARVTPDTATAAEDVLRATGAKSIERVEG
FT                   DWQDGEWRDFDPVRRPDEAPSGGPR"
FT   gene            678581..679438
FT                   /locus_tag="Bcen2424_6461"
FT   CDS_pept        678581..679438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6461"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: bcn:Bcen_1368 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13191"
FT                   /protein_id="ABK13191.1"
FT                   /translation="MTTAQTPPPQKQTQQPGTERDMHPKPRDEAADYVGSGKLAGKVAL
FT                   VTGGDSGIGRAVAVGFAKEGADVAIVYLKESDDAAHTKQLIEQAGRRCEAIACDVGDRR
FT                   QARDAVARTVERLGRLDVLVNNAGEQHPQPGIEDVSEEQLERTFRTNVYGMFFCTQAAL
FT                   PHLKEGGRIVNTASVTAYHGSPKLPDYSATKGAIVAFTRSLSIELAERDIRVNAVAPGP
FT                   IWTPLIPSTFTPEQVAKFGSNVPLKRPGQPDELIDCYVLLASDGASYMTGQTLHPNGGS
FT                   IVGG"
FT   gene            679473..680087
FT                   /locus_tag="Bcen2424_6462"
FT   CDS_pept        679473..680087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13192"
FT                   /protein_id="ABK13192.1"
FT                   /translation="MRQPNWTIAALAAGVLAVSGLARAQMPSEPPASNAHVPGGVINPS
FT                   SGAGAAGDPGIAKAPKGTDAEFVDKAAMAGKAEVQASQLALKQAQSADVRAFAKRMVAD
FT                   HGKANAKLNEIAARKGIKPQVEQISDPDVEALRGKSGHDFDTAYLAAAGPDAHQKAVAL
FT                   FEDEARDGKDAQLRAFAQSTLPTLKHHLSMAQTLARKVGTQ"
FT   sig_peptide     679473..679547
FT                   /locus_tag="Bcen2424_6462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            680147..680758
FT                   /locus_tag="Bcen2424_6463"
FT   CDS_pept        680147..680758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13193"
FT                   /protein_id="ABK13193.1"
FT                   /translation="MAQRQSKHEGILELLCQAYETELGGAQIYEAALQCATDEDLHKEW
FT                   EKYHRETLHHQEVLRKVFETLGLDPDAQSPGRAAVAATGKSLVQVIQQAKKQADPAVAQ
FT                   VVAAECVVLAETKDHLNWELIGYAADQLPDSDAAKALKAAHDEVEADEDHHLYHTRGWA
FT                   REMWIESMGFKAVLPPPEEVKKVESAADAARAERSRGKMM"
FT   gene            complement(680855..682147)
FT                   /locus_tag="Bcen2424_6464"
FT   CDS_pept        complement(680855..682147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6464"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein; KEGG: bcn:Bcen_1365 natural resistance-associated
FT                   macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13194"
FT                   /protein_id="ABK13194.1"
FT                   /translation="MSGLDEDAQPAAEAPPAAAKPWYRRLGPGLLAGASDADPSNVAVY
FT                   AQAGSQFGFNMLWMIVVTLPMMVAVQLASAFIGRRNREGLVAGIRQHYSERVAKTLIAM
FT                   VVIVNVVNVGADLAAMGDATALVVGGRSYWYAPLYGIASLALQVMLSYERYARWLKWMT
FT                   LGLIAYVLELGFVHVDWGDLLHAIVLPHIAFTHDYATTAVAVLGTTLSPYLFVWQAALE
FT                   VEETTAEQQNGERNSRRETEQRITFDTWTGMIVTNAVSFCIMVIGAAVFFAHGRHDIGS
FT                   TAQAAEALRPIAGEAAFLVFAFGIVGCGLLAIPAFAGSAAYGCAEAWRFREGLNEPVRR
FT                   APAFYTVLALCVIVGIAICFSPIDPIRALYWSAVLNGVAAVPMLVLVMLLSQQRDAAGQ
FT                   PGSGPVSKVFGWLAVALMAVSVTTMIVDVLT"
FT   gene            complement(682144..682815)
FT                   /locus_tag="Bcen2424_6465"
FT   CDS_pept        complement(682144..682815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6465"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   bcn:Bcen_1364 phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13195"
FT                   /protein_id="ABK13195.1"
FT                   /translation="MTRKTPDRQAPTRQPPDDDAPATLDACRRCALWEHATQPVPGAGP
FT                   VDAPIMLVGEQPGDQEDRAGLPFVGAAGRMLDRALDEAGIERAHVYLTNAVKHFKWEPR
FT                   GKRRLHKTPAQREVAACHYWLERELQAVQPRVVVALGATALRAVLQDNDATLERTRAPV
FT                   RTEDGRLVVATYHPSYVLRTRGADSREHAYRTLVDALRTASRLARERRHGGGRPTHGDA
FT                   G"
FT   gene            683049..683528
FT                   /locus_tag="Bcen2424_6466"
FT   CDS_pept        683049..683528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6466"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bcn:Bcen_1363 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13196"
FT                   /protein_id="ABK13196.1"
FT                   /translation="MQLDPGDDPAADDVLLWRAPDSVPRRPRRVLVVDDYRDAADALRL
FT                   LLEARGFECQVADDPFAVCDVARDWQPFAVVLDIAMPGLDGLQLAARLRRDPQTSDMLL
FT                   IACSGLASRRDCERAKEAGFDAHCAKPLTPHRLLGYLESASGGAMKPDGDVTRPL"
FT   gene            complement(683559..684770)
FT                   /locus_tag="Bcen2424_6467"
FT   CDS_pept        complement(683559..684770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6467"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_1362 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13197"
FT                   /protein_id="ABK13197.1"
FT                   /translation="MQSVSTPECGAAPGHTAAWGAVLAMSLGAFALVASEFMPVSLLTP
FT                   IAGDLHVSEGQAGQAISVSGAFALVTSLLIASLAGRCDRKRLLLSLTLLTIVSGTVVAF
FT                   APNYGAFIAGRALIGVAIGGFWSMSAATAMRLVPDRQVPRALAIVNGGNALATVVAAPL
FT                   GSFLGAIVGWRWAFFCVVPVAALALGWKLVSLPAMPSAPPRTRVGAAALLARRPVAWGM
FT                   AAVGVFFMGQFALFTYLRPFLETVTHAGTTTLSLMLLVIGVAGVAGTALIGGVLKYGLH
FT                   RTLVATPLLMAAIAVALTGFGASTAATACLLALWGLLGTAAPVGWWTWLARTLPHDAEA
FT                   GGGLMVAVVQLAITLGATTGGLLFDLHGYRATFALSAALLLLAGALAAAAGRSSARAAP
FT                   RTGA"
FT   gene            complement(684806..685075)
FT                   /locus_tag="Bcen2424_6468"
FT   CDS_pept        complement(684806..685075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13198"
FT                   /protein_id="ABK13198.1"
FT                   /translation="MNTRLFATVTAVAALVASTPLLAQSASGLTREQVREDMVRYSAAG
FT                   FNPARMNPRTWVDDAQAAAIKVEAARNDDARTHLAGRDTAAHCD"
FT   sig_peptide     complement(685004..685075)
FT                   /locus_tag="Bcen2424_6468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 24"
FT   gene            685269..686162
FT                   /locus_tag="Bcen2424_6469"
FT   CDS_pept        685269..686162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6469"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1360 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13199"
FT                   /protein_id="ABK13199.1"
FT                   /translation="MARENFNDLLVFLAVARDRSFTRAAARLGVSQSALSQTVRDLEAR
FT                   LGVRLLARTTRSVSTTEAGEALFNAVAPRIDEISAQLAALSDFRDKPAGVVRITATEHP
FT                   IDTVIWPKLRAVLPDYPDIRVELSVDYGLSNIVEERYDIGVRYGDQVAQDMIAVRISPD
FT                   IRMAMVAAPSYLDGRKPPKKPQDLLDHDCVTLRLATAKGIYAWELKKGKNAIQARVNGR
FT                   ITCNTQPHLLQAALDGFGIAFVTEDIAHAHLRSGALRIVMPDWCPVFPGYHAYYPSRRQ
FT                   ASRAFSVVIDALRHRS"
FT   gene            complement(686282..686764)
FT                   /locus_tag="Bcen2424_6470"
FT   CDS_pept        complement(686282..686764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6470"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bcn:Bcen_1359
FT                   PRC-barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13200"
FT                   /protein_id="ABK13200.1"
FT                   /translation="MQTPDQGQTRIIGKGAATAAGPGPDVMAADTLEGDKVYTTDGDDV
FT                   GKIKDIMLDVRSGRIAYAVLSSGGILGIGDKLHAIPWSALTLDTERKCFLLSVSSERIR
FT                   NAPGFDKDHWPAMADPQWAEPLHEFYGSTPYWSAGDELGLTDPTEDLDDPRTRGRH"
FT   gene            complement(686857..687288)
FT                   /locus_tag="Bcen2424_6471"
FT   CDS_pept        complement(686857..687288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6471"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bcn:Bcen_1358 CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13201"
FT                   /protein_id="ABK13201.1"
FT                   /translation="MHRVNEIMSQDVVRIAPTDSIRHAAQLMERYDIGALPVCDNNRLV
FT                   GMVTDRDLAVRAISAGKPPETRIQEVASGPIEWCFDDDSLDEIQHYMADAQLRRLPVVD
FT                   HDKRLVGMLSLADIATRTASPERDDVANTLEGVSQPKQT"
FT   gene            complement(687380..687634)
FT                   /locus_tag="Bcen2424_6472"
FT   CDS_pept        complement(687380..687634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13202"
FT                   /protein_id="ABK13202.1"
FT                   /translation="MKDSTRHGRDAPAQERQPDPQPPLKDQDRTHTRHSERHIDKQLED
FT                   TFPASDPPATGGVTRIEPDTPPGKHDDGPAEDKRKRDEK"
FT   gene            687802..688107
FT                   /locus_tag="Bcen2424_6473"
FT   CDS_pept        687802..688107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13203"
FT                   /protein_id="ABK13203.1"
FT                   /translation="MTIPKRRPGVRYEINVCGGGFDSVKSHFDTWKREPLIYRPERRMF
FT                   EGKADVRPLGDETFGATEPARFALQRACEPSDPYALAARVRDDGRELWLVMAAYDA"
FT   gene            688300..688554
FT                   /locus_tag="Bcen2424_6474"
FT   CDS_pept        688300..688554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13204"
FT                   /protein_id="ABK13204.1"
FT                   /translation="MEMPMKHDSAQWLQRPEPPLPDIEPDPEPPDPDDVPPDLPEPYRE
FT                   PEGDPPGHAPPERDPPSREPPVRAWRAGATPLMRMEDLR"
FT   gene            688551..688862
FT                   /locus_tag="Bcen2424_6475"
FT   CDS_pept        688551..688862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13205"
FT                   /protein_id="ABK13205.1"
FT                   /translation="MSIRVKPGMLRDIAETLGRHFEARAMPFHVEEQPAGALHIGFRVD
FT                   GHPASLTVTFDADAFAALERADLSRQRGTLTRVAAEFDTMMARRAPTAYAGDFHFNRL"
FT   gene            689006..689515
FT                   /locus_tag="Bcen2424_6476"
FT   CDS_pept        689006..689515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6476"
FT                   /product="protein of unknown function DUF892"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   bcn:Bcen_1353 protein of unknown function DUF892"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13206"
FT                   /protein_id="ABK13206.1"
FT                   /translation="MANQHEHLEDWLRDAYAMERQAETMIDAQMKRVGHYPQLQDRLRQ
FT                   HLDDTLGQQALVEACLMRLGTSPSASKDLAARIAAYGQIASGMLADDEVVKTALAAYAF
FT                   EQLEIAAYTALVAAAQAAGEEEIRACCERILQQERDMAAWLLRHLPELTTAFLDRSAVD
FT                   RIDAKR"
FT   gene            689747..691180
FT                   /locus_tag="Bcen2424_6477"
FT   CDS_pept        689747..691180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6477"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor, core-binding region;
FT                   sigma-54, DNA-binding domain protein; KEGG: bcn:Bcen_1352
FT                   RNA polymerase, sigma 54 subunit, RpoN"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13207"
FT                   /protein_id="ABK13207.1"
FT                   /translation="MPVSLALQMRQHLALTPRLQQSLRLLQLSSLEFQQELRQALDMNP
FT                   FLEDGQGDEDTVAGTPEQPTEAAAPEAAPEHDDIRPPDGEVPFTAAPAPRGTSRQGDDT
FT                   DGLSPGEWIAAEPSLHQQLHDALRLYPLNKRDREAARLVIDALDDDGYLRQELPELLVA
FT                   ADPAWLLSEQDLAVALRLVQMLDRPGIAARSLSECLVLQLDAIPAGTPALAEAKAIARE
FT                   HLERLARRETAEIQRRLGCNQQTLHAACALVRGLDPRPGNHYGSTRGDYVVPDVIVRQV
FT                   RDEWIVTINPAVLPRARLHERYATLFAQSSGERDSPLGQQLQEARWLIRNVQKRFDTIQ
FT                   RVGECIVARQRDFFRYGEIAMKPLVLRDIAEELDLHESTVSRATGNKYMATPHGTFEFK
FT                   HFFPRKLEAAGKGVCSASAAKVLIRDMIAAERQTDPLSDVALAENLAGRGILLARRTVT
FT                   KYRQAMKIPPADLRRRDAA"
FT   gene            691253..691441
FT                   /locus_tag="Bcen2424_6478"
FT   CDS_pept        691253..691441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13208"
FT                   /protein_id="ABK13208.1"
FT                   /translation="MPAKSQAQQRAAGAALSAKRGDTKMKDLKPPSKSMAKSMSEKELE
FT                   KMASTPTRGKPKHKHDA"
FT   gene            691488..691649
FT                   /locus_tag="Bcen2424_6479"
FT   CDS_pept        691488..691649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6479"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   bcn:Bcen_1350 protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13209"
FT                   /db_xref="GOA:A0KDE6"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KDE6"
FT                   /protein_id="ABK13209.1"
FT                   /translation="MLRYAIIFFIIAIIAAVFGFGGIAAGAAEIAKILFYIFVVIFLVT
FT                   LLLGVVRR"
FT   sig_peptide     691488..691571
FT                   /locus_tag="Bcen2424_6479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.762 at
FT                   residue 28"
FT   gene            691646..692032
FT                   /locus_tag="Bcen2424_6480"
FT   CDS_pept        691646..692032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13210"
FT                   /protein_id="ABK13210.1"
FT                   /translation="MTVMPDRSQRVAELEHALAISFPSQSTVVVHADDASGRLTINVSW
FT                   VRVPSDEDARQWRCSVDMRFDADVIERYATLDAADRLRVRTQLCDRARRAVDEHKPRVE
FT                   DAAIECNVALDVTAVVFDAALRAP"
FT   gene            692160..694274
FT                   /locus_tag="Bcen2424_6481"
FT   CDS_pept        692160..694274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6481"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: ThiJ/PfpI domain protein; Catalase domain
FT                   protein; KEGG: bcn:Bcen_1348 catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13211"
FT                   /protein_id="ABK13211.1"
FT                   /translation="MTTPPSAGKTPPTQPTQPPDSAKSRQLDANRARPDGEALRTNQGV
FT                   RIADNQNTLRGGARGPSLLEDFIMREKITHFDHERIPERVVHARGSAAHGVFRVYEPMA
FT                   DYTKAAFLQDPAAETPVYVRFSTVQGPRGSADTVRDVRGFAVKFYTQEGNYDLVGNNMP
FT                   VFFIQDAIKFPDFVHAVKPEAPNEMPTGASAHDTFWDFVSLVPETTHMVLWLMSDRALP
FT                   ASYRAMDGFGVHTFRFVNAAGVERFVKFHWRPVSGAYSLLWDEAQRIAGHDPDFNRRDL
FT                   WTAIERGDYPEFELGVQLIDPADADKFDFDLLDPTKLVPEELVPVRPIGRMTLNRNPDN
FT                   FFAETEQVAFHPGHVVPGIDFTNDPLLQGRLFSYTDTQLSRLGGPNFHEIPINRPVCPF
FT                   ANNQRDALHRQTINVGQASYEPNSTSGGWPRETPPAPAGGGFETVPEPLEGHKVRVRSE
FT                   SFADHFSQAALFYQSMTEIEQRHIRDAYCFELGKVTQPHIRERVVNEIIARFDAGLAAQ
FT                   VAERLGLPAPQAAATPAVPQRSPALSLIGRAKPGIRSRKIALIATPGVNPVLVEQVRDA
FT                   LQAAHAVPTIVAPTLAPIGGIVPEATLVGMPSVMFDAVFVCGGDGDGRDLAHSADARHF
FT                   VREAFKHLKPIAAVGSGRQLLSAAHLPDPAEGVCVGQAVDLDAVLNTLSDHLGQHRVWA
FT                   REQQAAELPA"
FT   gene            694369..695388
FT                   /locus_tag="Bcen2424_6482"
FT   CDS_pept        694369..695388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6482"
FT                   /product="Ku domain protein"
FT                   /note="PFAM: Ku domain protein; KEGG: bcn:Bcen_1347 Ku
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13212"
FT                   /protein_id="ABK13212.1"
FT                   /translation="MAPRMIWKGAISFGLVHVPVQLFPATRTVKPSFRMLDKRSMDPIG
FT                   YRQINKRTGKEVTREDIVRGYEYEKERYVVLTDDEIRAANPESTQTVDILTFVDEDAVS
FT                   FLYLDTPYYLVPDRKGEKVYALLRDALKDSGKIGIALVVMRDRQHLGALIPVGPMLALD
FT                   TLRWQEELRPLDELSVPADDAKGAGVTARELGMAKKLIDDMSGKWTPDEYHDTFRDDIL
FT                   ELVERKVRAGKIEEIEDRPAQTGRAASNVVDLTELLKRSLKGGAGARAADLRAERGEGE
FT                   DEASSSSSSRGGARRKPAAKSASKGAATKTAAKKTAAKRGAASAPAAKKTAARRKHAA"
FT   gene            695458..698268
FT                   /locus_tag="Bcen2424_6483"
FT   CDS_pept        695458..698268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6483"
FT                   /product="ATP-dependent DNA ligase LigD phosphoesterase
FT                   module / ATP-dependent DNA ligase LigD polymerase module"
FT                   /note="PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: bcn:Bcen_1346 ATP dependent DNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13213"
FT                   /protein_id="ABK13213.1"
FT                   /translation="MAGKLDPYRRKRHFGATPEPEGAHGKRRAKPDTQAASKPKAKQPA
FT                   ARARHPLRFVIQEHHARRLHYDFRLELDGTLKSWAVPKGPSFDPQVKRLAVHVEDHPLE
FT                   YASFEGEIPAGHYGAGSVVVWDEGTWTPDGGVAQAREGYRAGKLTFRLDGEKLHGGWAL
FT                   VRSGRQEGRQEQWLLIKERDDDARSADEFDVVGERPGSVHDGAANGAARKRAARRGRST
FT                   DADGDVHDAQHASHESHESHESHASHRPTDPSQVEGAVRAPLPERVAPQLATLVDAPPT
FT                   QGGWCYELKFDGYRILARIAGKGARRRVTLMTREGRDWTAKLRAQRDALAALDVDDAWL
FT                   DGEAVVLGENGLPDFQALQNAFGTDRSDAITFFVFDLPYLDGYDLRDASLNDRRALLEP
FT                   LLANSDPARVRFSPDLGEDVASLIASACDTGLEGLIGKRADSRYRAGRSPAWIKLKCRR
FT                   RQEFVIGGFTEPSGSRHGFGALLLGVHEPAPAGKRRRGPGPLRYVGRVGTGFDARMLDR
FT                   LAAILRKHERDTMPFDEPPRERTRTRVHWVEPTLVAECEFAEWTGDGIVRQAAFIALRE
FT                   DKPAAQIVREMPKHTETEVTMDQRPTPHDDTRKRASHAARESADRKQSARSRAAARAED
FT                   DASGPDTLGRVRITHPERVLDPQSGTRKIDLARYWQWVAPWLLPDLEGRPVSLVRAPGD
FT                   IAGELFFQKHAERREIPFVTQHEGLDPGHGPLLSIDNVDALLGAAQMGTVELHTWNAHA
FT                   SNIERPDRIVFDLDPDPALPWRTMIDAAQLVRGLLDELGLVSFCKTSGGKGLHVVVPLT
FT                   RHAGWDDVKDFSRAVAQHVAGTLPDRFTATMGPRHRRGKIFVDYLRNGRGASTIAAYSV
FT                   RARPGMGVSVPLDWDEVPDTTGGAQWTIDTLHERLDTLKRDPWEGYAKARQRITAAMRA
FT                   RLGADT"
FT   gene            complement(698273..699595)
FT                   /locus_tag="Bcen2424_6484"
FT   CDS_pept        complement(698273..699595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6484"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: bcn:Bcen_1345
FT                   sodium/hydrogen exchanger; TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13214"
FT                   /protein_id="ABK13214.1"
FT                   /translation="MHETLWYLIIGAVLLGMGVVTSALRHLPCSSAMIYLVLGVALGPA
FT                   GAGLLHLDLERDGQLLREIVEVALLVSLFAIGLRLRVPLSDKLWLVPCRLGLLAMIVTV
FT                   PLLAACAVLALGLGWGPALLLAAILAPTDPVLAHDVQVHDPGDRDLVRFALSGEGGMND
FT                   GIALPFALAGLALCGAPGATHGIPPLSGTFALVALWGIAGAAAIGGGLGWATTKTIGWL
FT                   RTRHAQALGLEGFFALALIVLSFGAAQLAHTFGFIATFAAGVAMRRVEHRASGDRPPRE
FT                   VIGQIDSEDVVATEKHPEKAHAFMAESVLGFTIELERIAEAIVMTMIGSVLSTLPGPLL
FT                   TWGAVALAAVLFVAVRPLAVLVTLAGSRATHAQRRLMAWFGIRGIGSFYYLLFALEHGP
FT                   SDVVRPLAAPVLAVVSASVVAHGISATPLMNWYYRLQQHRR"
FT   gene            complement(699650..700018)
FT                   /locus_tag="Bcen2424_6485"
FT   CDS_pept        complement(699650..700018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13215"
FT                   /protein_id="ABK13215.1"
FT                   /translation="MPSASASHAHDKPHGKRHTRHPGRARSADPAHRKRWSGKVTQKSD
FT                   ALDIEPDIFKSDDPAAIAASLKRSAEHSRRRKASPFQSAMSMLNFYVNRAGRNLPKTRR
FT                   ATLERAKRKLREAFGRKP"
FT   gene            700176..700625
FT                   /locus_tag="Bcen2424_6486"
FT   CDS_pept        700176..700625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13216"
FT                   /protein_id="ABK13216.1"
FT                   /translation="MKSAFESKCVARHVLACAAVAIVAAAPAAWAQNSQRSDEGTGAPN
FT                   PSMDMSTPGTNGNTTAPPPPAGTQRHGAKHGMRSHSGSAGHVKPGGGPNGAGQGGSGAT
FT                   GGGVGGGSGGAGGSGGTGAGNGGSAGSTGTGGGGAGGTGGGSSGY"
FT   sig_peptide     700176..700271
FT                   /locus_tag="Bcen2424_6486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            700711..701076
FT                   /locus_tag="Bcen2424_6487"
FT   CDS_pept        700711..701076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13217"
FT                   /protein_id="ABK13217.1"
FT                   /translation="MQSNSRIFVDNDELDGDASDTDDLDTTVHVDVETGRVMFHAAWAN
FT                   PVEAPPEAARHSVVLALECSTMERYADLDEGARMRVHAMLHDAVQQTLEQLPDTDENLT
FT                   LTVELTDAMLDAVRHLQ"
FT   gene            701325..701873
FT                   /locus_tag="Bcen2424_6488"
FT   CDS_pept        701325..701873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6488"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: bcn:Bcen_1341 peptidase
FT                   C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13218"
FT                   /protein_id="ABK13218.1"
FT                   /translation="MSGKLDHCKVAILAVDGFEEAELVEPQRALAAEGAQVDVISQKRG
FT                   EIQGFRHVDKGERVKVDRTFDDAREGDYDAVVLPGGVINGDAIRMVPAAREFVTAAVGA
FT                   GKPVAAICHGGWLLVSAGLVEGKTMTSWPSLQDDIRHAGGKWVDEEVVRDGNLITSRKP
FT                   ADLPAFNGALVERLASRGA"
FT   gene            701878..702210
FT                   /locus_tag="Bcen2424_6489"
FT   CDS_pept        701878..702210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13219"
FT                   /protein_id="ABK13219.1"
FT                   /translation="MPADSDTPRRVTLTDEPPTFDGAALQLRFVVDVDGVPQACAITVE
FT                   ALEDHFGARSALEADLRDAFERGRARIEAACADVLASGNHDVVLHSGYFRAPAGRARAG
FT                   LFRSRP"
FT   gene            702500..702745
FT                   /locus_tag="Bcen2424_6490"
FT   CDS_pept        702500..702745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13220"
FT                   /protein_id="ABK13220.1"
FT                   /translation="MLTAHEFAALFLAHHAPEQIQIDRDDVVALVEQHLIVLQQDDTSG
FT                   AHRPALTADGLSVLRCVQRHDAAEFHAIGVSDGADA"
FT   gene            complement(702768..704081)
FT                   /locus_tag="Bcen2424_6491"
FT   CDS_pept        complement(702768..704081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6491"
FT                   /product="phosphatidylserine decarboxylase-related protein"
FT                   /note="PFAM: phosphatidylserine decarboxylase-related;
FT                   KEGG: bcn:Bcen_1338 phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13221"
FT                   /protein_id="ABK13221.1"
FT                   /translation="MPPPGQASCCIDSTETVPEETMPTNRNTPPATRRRLGGWMASEEA
FT                   HMAAFREKIAAEARAHAGDRLRTPAVQELARLFDDNAVLRMSLTRAIDEAREAGYRLGY
FT                   ASIGELMTVIDHLMTYTPPFSEESLIVCPVNAFLDWPMCMPSGHAVFRDAAVNAQFKRV
FT                   LNVWCDFLGGPHSRAHLDTSAPDGWFCDEARKRLGLSQFQYREDQPHWGFDSWNDFFTR
FT                   RFRDGARPVAAPDDPHVIVSACEASPYHTETNVKLRDTFWIKSQPYSLRDLFTPARLSL
FT                   AERFVGGDVYQAYLSAYNYHRWHAPVRGVVTHAYRVDGTYYSVAEAEGPDPAGLNDSQG
FT                   YMTAVAARAVVAISSDDPGIGTVAAVFVGMGDVSSCVIEVVPGQRVDKGDEIGYFQFGG
FT                   STYCLLFEAGVIDRFLYAPPFEGEPPVVQVNASVAIAR"
FT   gene            complement(704140..704424)
FT                   /locus_tag="Bcen2424_6492"
FT   CDS_pept        complement(704140..704424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13222"
FT                   /protein_id="ABK13222.1"
FT                   /translation="MQSTTGFGNLTTTLPAASRRGHPPTAVSPPPLHGSASLARCRWHD
FT                   RHRAHSAAHHRAALPAGVFACASASRSAARRGDARPSIPRRSSVVHSKL"
FT   gene            complement(704552..707317)
FT                   /locus_tag="Bcen2424_6493"
FT   CDS_pept        complement(704552..707317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6493"
FT                   /product="maltooligosyl trehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /note="KEGG: bcn:Bcen_1336 malto-oligosyltrehalose
FT                   synthase; TIGRFAM: malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase, catalytic region; SMART: alpha amylase,
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13223"
FT                   /protein_id="ABK13223.1"
FT                   /translation="MTPRATLRLQLHAGFTFDDAAAHADYFARLGVSHLYLSPVSTAEP
FT                   GSRHGYDTVDHGALGAELGGEAGFMRLVDALRARGLGIVIDIVPNHMGVGGSSNGWWND
FT                   VLEWGPASPYARYFDIDWHPPDPTLDGKVLLPCLGAPYGDALAAGDITLRADPATGRFI
FT                   IACPGRRLPVAAATYAEILRIANRADLNALAERFDAAPARDSARLAAAHAALRDYAAAH
FT                   GPHAFDAVLRGADPRRARSRACLHRLLERQHYRLAWWRTAADELNWRRFFDIATLAAVR
FT                   VEDEAVFDAVHALPLRLHAAGLVDGVRVDHVDGLADPRAYCRRLHARLAAQRDARPYVV
FT                   VEKILAPGEALSSDWAVDGTTGYDFMNDVGALLHDPAGAEPLAAHWAAVSGSARTFAQE
FT                   ALDGKRRVLMRQLAAEHARVARLLHEIARASPVTRDVSRIAIQRVLGELAVRLPVYRMY
FT                   PAPGNEPADEDRRVLAHAYEGAYAAVDPTDRFALERVAAWLGLPVVRVPRANADALLAA
FT                   RVAFAQLTAPLAAKGVEDTANYRYGRLLSRNEVGADAGDFSLSRGAFHARNRRRARTVP
FT                   HGLVATATHDHKRGEDARARLAVLSEVPDAWRAVSLDWSALNAPHRGGPHRDLAWTPGP
FT                   AAEAMLYQTLVGCWPPALAPDDAAGLDALATRVVQWQTKALREAKQYTDWLAPEPDYEH
FT                   GCEAFVRAILTPRGAGDFPHRLHAFVARIAPAGVVNSLTQTALRIASPGVPDLYQGTES
FT                   WDHSLVDPDNRRDVPFATLAAEPVDGPVASYLPTWPDARVKRALIERMLALRARWPATF
FT                   ADGAYVPLRVRGKLARHVVAFARCDEAATVVVVATRLACRLLGEAPEIPRVEPAQWGDT
FT                   TVVLPRGVEGPWTDWLNARNAIEAPEGVLALDRCLAELPVAVLVAARTGN"
FT   gene            complement(707314..709536)
FT                   /locus_tag="Bcen2424_6494"
FT   CDS_pept        complement(707314..709536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6494"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: bcn:Bcen_1335 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase, family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13224"
FT                   /protein_id="ABK13224.1"
FT                   /translation="MTTDVPIAALARAAGLQPDWTDAGGVARRVDDDALVALVDALGWP
FT                   CGTAIQRVDSAAALADANASPPRLVTGDAGLPLTLPATIAPPGARFRISLETGGHVDGR
FT                   VGGAGEHGTLPPLAMPGYHALDIGEQRIGLAIAPPRARPFDALARAHDGGRWGIAAQLY
FT                   SLRRTGDDGAGDYTALARLAAQAARHGAQAVAISPTHAGYPALPAHDSPYSPSSRRWHN
FT                   VAYLDCDAVPGADAAHRPSAATADAALIDWPSVLPTKLRRLRACFDAWRASDDPSRDTH
FT                   QRFRAAGGAALDAHARFDALQAFCIEHGIGADWRQWPSQWRMSGSAEVDAFAHEHADTI
FT                   AFHTFLQWCASRALGDAQHAARGAGMATGLIADLAVGSDQAGSDAWAHGTTLLRGVSLG
FT                   APPDLFNAAGQAWGVTTWTPDALRADGFMPFIDLLRAAFAHAGGIRIDHVLGFARMWIV
FT                   PDGGSPRSGAYLHYPLDDLVRLVALEAARHRAIAIGEDLGTVPAGLRERLGAQGVAGMR
FT                   VLWFERDADGAFRPPAAWDRDAIAMTSTHDLPTVAGWWRGVDLGWRRVAAEAAAAKRRD
FT                   EAQPPRDVAAPAPDDASAHDSDAIVQSMAFGHDTVQRPDSNHSTPPPPPELLAAHAERA
FT                   TERAALWHALQHAGCAPADAAVPPANMPPVNAILGYVASSPSPLALLPLEDLLALDAQP
FT                   NLPGPPCGHPNWRQRLPRTIDALFDADVRTRIAAVVHARRSRRHGP"
FT   gene            complement(709533..711404)
FT                   /locus_tag="Bcen2424_6495"
FT   CDS_pept        complement(709533..711404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6495"
FT                   /product="maltooligosyl trehalose hydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /note="KEGG: bcn:Bcen_1334 malto-oligosyltrehalose
FT                   trehalohydrolase; TIGRFAM: malto-oligosyltrehalose
FT                   trehalohydrolase; PFAM: glycoside hydrolase, family 13
FT                   domain protein; alpha amylase, catalytic region; SMART:
FT                   alpha amylase, catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13225"
FT                   /protein_id="ABK13225.1"
FT                   /translation="MTSRSARPTGTHVFESSFGATCIEADRTRFRLWAPASRTAAVELQ
FT                   DAGGRAIPMTPAGDGWFETVAPCGPGTLYRYLLDDALAVADPASRFQPYDVHGPSQVVD
FT                   PAAYRWRHDAWRGRPWHETVLYELHVGACGGYAAVERRLPAIAELSVTAVELMPVNAFP
FT                   GARNWGYDGVLPFAPDASYGRPEELKSLVDSAHGLGLQVFLDVVYNHFGPDGNLLPRYA
FT                   PDFFRADRQTAWGPAIDFTRPQTSAFFIDNALYWLDEYRFDGLRIDAAHAIDDDAWLRE
FT                   LARRVRAQAGDARHVHLVLENERNTASLLGPGGFDAQWNDDFHNSAHVLLTGERDGYYR
FT                   AYADAPLRHFARTLGEGFAYQGDPSPLHDGAARGEPSAHLPPTAFVVFLQNHDQVGNRA
FT                   FGERLRALANDDAVRAATALMLLAPSIPLLFMGEEDGSTQPFQFFTDYRGALADAVREG
FT                   RRREFAAFPAFADAAHRDAIPDPNDIATFVRSSSHHPPDESWPDAAAWRRFYRSALAVR
FT                   AALVTPHLENARSLGVELLAGDGDPPALVARWRLGDGSTLTIALNLGSHDATLPALPVG
FT                   KIVFETPPRARDRLPGGHVPPRACIVWRDGAVNRDARHHSTNGRSLS"
FT   gene            complement(711413..713530)
FT                   /locus_tag="Bcen2424_6496"
FT   CDS_pept        complement(711413..713530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6496"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: bcn:Bcen_1333 glycogen debranching enzyme
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase, family 13 domain protein; alpha
FT                   amylase, catalytic region; SMART: alpha amylase, catalytic
FT                   sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13226"
FT                   /protein_id="ABK13226.1"
FT                   /translation="MPTALPDRLEPGRSYPLGASWDGLGTNFAVFSAHAQRIQLCVFDP
FT                   TGRKELARLDLPECTDEVWHGYLPNAHPGTVYGFRADGPYQPQHGHRFNPTKLLLDPYA
FT                   RKLVGQFRWSDALFGYRVHSNRADLSMDRRDSAPAMPKAVVVDEAFDWSNDRRPNVPWR
FT                   STVIYETHVRGASMRRAGLRPPERGTFASLAHPAFIDHLLSIGVTTVELLPIHAFLQQR
FT                   ELVKRGLRNYWGYDTAAFFAPEPSYLTTRRLDEMRIAVRQLHAAGIEVVLDVVYNHTCE
FT                   GNQLGPTLSWRGLDNASYYRLRPDDPRYHVDETGCGNTLNMSHPRVVQMVMDSLRYWAT
FT                   AFNIDGFRFDLGVTLGREDHGFEPGAGFFDALRQDPVLAQRKLITEPWDLGPGGYQLGR
FT                   HPPGFAEWNDRFRDTVRRFWRGDAGQRPELAARLSGSADLFNHGRRRTWASINFVTAHD
FT                   GFTLADLVAYAGKHNDANGEDNRDGRDDNCSANWGVEGPTDDTAIRDVRLRVARSMLAT
FT                   LFTALGTPMLVAGDEFGRTQHGNNNAYCQDNELSWLDWDLAHSDAGVQMTRFVSRLAAL
FT                   RRMYPVMSAPRYPSGDRDGAPGMREIDWFDERGDALTVPAWEDGERRALTMRRVGTGRT
FT                   GRTEALLVMLNASADTITFIPPAPVLDYRILLDTATPDSGPRSWPEAGLDVAAHAAVIA
FT                   VAAVPPPDQSS"
FT   gene            complement(713563..715773)
FT                   /locus_tag="Bcen2424_6497"
FT   CDS_pept        complement(713563..715773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6497"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: bcn:Bcen_1332 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   glycoside hydrolase, family 13 domain protein; alpha
FT                   amylase, catalytic region; alpha amylase, C-terminal
FT                   all-beta; SMART: alpha amylase, catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13227"
FT                   /db_xref="GOA:A0KDG4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KDG4"
FT                   /protein_id="ABK13227.1"
FT                   /translation="MTDTLFDRADIDALLAGRHPDPFACLGPHRHDDQIVVRALLPGAE
FT                   RVRALSPDGAELGTLACVDRAGCFAGTIAHDGGAPHYLLSIDWPDAHQVTDDAYAFGTL
FT                   LDEAALARFSAGDPEAVLDCLGATPVRIDDTDGVRFAVWAPSAQRVSVVGDFNAWDGRR
FT                   HPMRLRRPSGVWELFVPGIGAGERYKYELCAADGRVLPHKADPCARATEAPPRTASVVA
FT                   DVAALHAFAWHDDGWMHARPRHDDRYRVPWSIYEVHPESWQRIPEQMDRSATWDELAER
FT                   LIPYVKGMGFTHVEFMPIAEYPFGGSWGYQPLAQFAPSARFGPVEGFARFVDRAHAAGI
FT                   GVLVDWVPAHFPNDAHGLAQFDGSALYEHADPREGMHPDWNTCVFNVGRTEVSAFLVAS
FT                   ALAWARRYHVDGIRVDAVASMLYRDYSRKEGEWVPNVYGGRENLESVAFLRRLNDTLHG
FT                   DAAPAGVVTVAEESTAWPGVTAPTADGGLGFDFKWNMGWMHDTLAYLHEDPIHRRYHHD
FT                   RMTFGLVYAFSERFVLPLSHDEVVHGKGSLVAKMPGDAWQRLATLRAYFGFMWAHPGKK
FT                   LLFMGSEFAQWSEFAHDATPHWDLLDAPAHRGVQRLVRDLNRAYAAEPALHALDCHAAG
FT                   FAWLIGDDRDNSVFAFARRDDTGRLVVAVCNFTPVPRAGYRLGLPAPGHWRELMNTDAA
FT                   SYGGTNAGNDGAVWAEAVPAHGEAWSASLRLPPLATLWLTPA"
FT   gene            complement(715770..719183)
FT                   /locus_tag="Bcen2424_6498"
FT   CDS_pept        complement(715770..719183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6498"
FT                   /product="trehalose synthase"
FT                   /EC_number="5.4.99.16"
FT                   /note="KEGG: bcn:Bcen_1331 trehalose synthase-like;
FT                   TIGRFAM: trehalose synthase; trehalose synthase-fused
FT                   possible maltokinase; PFAM: alpha amylase, catalytic
FT                   region; SMART: alpha amylase, catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13228"
FT                   /protein_id="ABK13228.1"
FT                   /translation="MMKREDSLDDVRRAQFPSLAPAGTPRRRRARRREPALCADDPLWY
FT                   KDAIIYQVHVKSFYDSNNDGIGDFPGLIAKLDYIAELGVDTIWLLPFYPSPRRDDGYDI
FT                   ADYRDVHPDYGTLADVRRFIREAHARGIRVIAELVINHTSDQHPWFQRARRAKPGSTHR
FT                   DYYVWSDTDTKYAGTRIIFLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREV
FT                   IQVMRFWLDLGIDGLRLDAVPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLA
FT                   EANQWPEDVQEYFGNEDECHMAFHFPLMPRIYMSIASEDRFPILDIMRQTPALAPSNQW
FT                   AVFLRNHDELTLEMVTDSERDLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINS
FT                   LLLSMPGTPVIYYGDELGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVM
FT                   GSLYGYDAINVEAQTRDPHSLLNWTRRILATRRASQAFGRGTIRFLRPENRKVLAYLRE
FT                   LDGHEPVLCVANLSRASQAVELDLSEFAGRVPIEMTSDSPFPPIGQLPYLLTFPPYGFL
FT                   WFVLAEHGREPSWRQPHAEPLPEYVTLVMRRGDTRPDVSQLHALAHDALASWLARRRWF
FT                   ASKDRKIGDAWLNVVTPIPDEPFQYAEAWVSASDGGVERYVVPLATAWGGETSHPLFAQ
FT                   LALARVRRGHTVGYLTDAFALPAFARGMLRKLRDGATVPTSDGGRLTFLPEDALAGLDP
FT                   GDDAEVRWLAAEQSNSSLVIGDAIVLKLVRKVAHGIHPEAEMSRHLTRIGYANTATLVG
FT                   EVVHVDPDGTPHTVAILQRYVDNQGDAWTRSFDFLRRAIDELALPAADEGEAAETDEEP
FT                   DALLGYAAFAGIIGTRLGQLHVALAQPSDDPAFAPERATPDHVDGWCVDAIASFERALD
FT                   VLRTRLDALDAPTRASADALLASRDAAVEALGELVPRTLDAQCTRIHGDFHLGQVLDVQ
FT                   GDALLIDFEGEPARPLERRRAKSHPLRDVAGLLRSLSYVSATAQFAIEKAPPQAAGRKR
FT                   ALFDRFGQAAADRFVECYRAAADLAPARFVDPHYADRLLALFLIDKASYELCYEAANRP
FT                   DWLSVPVGGLAALVDRLLGDGALPDDGGNP"
FT   gene            complement(719180..722572)
FT                   /locus_tag="Bcen2424_6499"
FT   CDS_pept        complement(719180..722572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6499"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: bcn:Bcen_1330 alpha
FT                   amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13229"
FT                   /protein_id="ABK13229.1"
FT                   /translation="MDSTPPFAPHLYFCDARLVGTLDAWPQTFAHIAGMGFDHVLVGAF
FT                   WAASVAGFPRHVADFRRPAQSFETRASALETFSRLAQLAKGHGLRLLLEVVPDRIARDN
FT                   PLRTEHPDWYAERTHDDALIDPRGTAHALDIAHANTADEAVRDALSAWWCAHLATYADA
FT                   GAAGFLIDAPHHLPADWWPGWRAALRRARPDVAVLAGVPGHARDALAQLEAAGFDAVFS
FT                   SVRWWDLRAPWFADEHRLLRRIGAPIAFPDAPDGPRLADDWPDAPDDTVARAYRRALWT
FT                   AAAVGTGWLVPMGFERGVTVPLMARDADAARYRAAFEHARFDLSGALADANAWRRATPV
FT                   AAARGEIVQLSAPGASATALLRGTGPLLEHDDAALLIALNPDLDAPATVDPATILPGVP
FT                   GGFTRVVTQDGARTHPPAALEPFTLAPGAYALLHAWRAPPVTTRADAARERTALSAALV
FT                   ADRIAIERVEPSVDDGRFAIKRVIGEPLVVSASIFTDGHAHLAAVLQWRAADDDTWREV
FT                   PFEAEPNDRWHARVTLDRLGRHEFRVVAWRDDWASLVTDIAKKRAAGQDVTLEVREAQL
FT                   LLATALKLADPVDPRALKQMERLAAELKDASADDRLALIGGPALADAFAALRYRPFVTH
FT                   DATTYPVDVERRQARFSSWYEMFPRSASDDPHRHGTFDDVIAHLPRIRDMGFDVLYFPP
FT                   IHPIGTSARKGRNNSLTAGPDDVGSPYAIGSPDGGHTAVHPQLGTLESFRALVDAARGH
FT                   GLEIALDFAIQCSPDHPWLAAHPGWFAWRPDGSLRFAENPPKRYQDIVNPDFYAPDALP
FT                   DLWLALRDAVLFWVDAGVRIFRVDNPHTKPLPFWAWMIADVRGRHPDVVFLSEAFTRPG
FT                   MMYRLAKVGFSQSYTYFTWRESKRDFIDYLTELTAGPPREFFRPNFFVNTPDINPRHLQ
FT                   NAPRSQFVIRAALAATLAGSWGLYSGFELGESAPLPDSEEYADAEKYELRARDWSKAAH
FT                   IGTEIARLNRARRDHAALQTHLGLTFVEADNDSVLVFMKATPAFDSVVIVAISLDPWHP
FT                   QAANFTLDAALWRGLGLADGEPLDALEQDAAHAETWRGHRQYVSLDPHVRPYAIWRLAP
FT                   SPGAARAAAPEPDSARRPSGAHA"
FT   gene            complement(722729..723217)
FT                   /locus_tag="Bcen2424_6500"
FT   CDS_pept        complement(722729..723217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13230"
FT                   /protein_id="ABK13230.1"
FT                   /translation="MRTDALDGKDLDYWCARALCADDEDTLRFTAVAPTVVVTAACDAF
FT                   RHLDAPFAPSASWADAGAVLDRVEDLRIARHGDDVECDATFVDGPSTCGAHGHTAREAL
FT                   LRAFVRARFGDEVDAPPPFPHRIEHGAVVRSDPGVPIPTTDDDAATGDSSDIRSIPRM"
FT   gene            complement(723247..724038)
FT                   /locus_tag="Bcen2424_6501"
FT   CDS_pept        complement(723247..724038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6501"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bcn:Bcen_1328 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13231"
FT                   /protein_id="ABK13231.1"
FT                   /translation="MALSKQPAPAPHVVTADAAPAAAPGGRDLRIATYNIHGGYGAWSA
FT                   RAVDRIAAVIDELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTPERRYG
FT                   NAVLSRCPIRAARTLDLSFHPREPRGALDADIDCSTGPIRVVATHLGLSASERSAQVQR
FT                   LLAAFDTGAMPVILLGDINEWFVRGRALQALVTRFRRAPAPRTFPTVCPVFSLDRIWIH
FT                   PGELLVDVVVHRSARARHASDHYPLVARMRSTPATGTALAL"
FT   gene            complement(724029..726227)
FT                   /locus_tag="Bcen2424_6502"
FT   CDS_pept        complement(724029..726227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6502"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bcn:Bcen_1327 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13232"
FT                   /protein_id="ABK13232.1"
FT                   /translation="MIAPDRVTRADDRRIDAASADGPSRHGLLERGRNCDTIRHADRFT
FT                   MLVDGDAYFSTLRAALLRARHTVFIVGWDVDSRMRLAPGGADDTLPDTLAAFLHALASA
FT                   RHNLRIYVLAWDFAMIYALERDWPPVYRAGWRAHRGIRFRLDDAHPRGASHHQKLVVID
FT                   DRLAFVGGLDLTRARWDTPAHAADDPRRRDEQGMPYGPFHDVHAMFDGDAAAAIGDQAR
FT                   ARWLQACGRPIAIRAQRHLYRPDDDDPWPREARVDVRDVRLGIAYTAPRHGGREPVRQV
FT                   RALVEDTIRAAQRHLYVENQYFTAAVVRDALSSRLADTDGPDVTVVAPRVQSGWLQEAT
FT                   MGVLRARLHATLASADRFDRYRLLYPHVDGLGDACVNVHSKIAIVDDECIVIGSANLNN
FT                   RSMVLDTECCIALVAAGDPRIRGAIAGMRERLLAEHLGTTPAEVADAFACGERPNVVLD
FT                   RLRAKPGRTLRTLDPAVSPQFEALVPVSARLDPEQPIEPDRFVREFVPHEQHRSLTARF
FT                   FVLGAIVLAIAALALAWRFTPLGAHLNVASLSHAVAGIARLPAAPVLLLAAYVVAATCA
FT                   VPITLLIAATGLVFGAWPGFAYAGIGSMAAAAATYALGRWLGRDAVRRLAGPRANRLSE
FT                   HIGRRGVVAMAVLRLLPIAPFTVVNLVAGASHIGLRDYLIGTALGMLPGIVLTVTFAHQ
FT                   LTAALSHPGPGAFAWLAAIGLALVGVSILLVRMLRRWR"
FT   gene            complement(726224..726547)
FT                   /locus_tag="Bcen2424_6503"
FT   CDS_pept        complement(726224..726547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13233"
FT                   /protein_id="ABK13233.1"
FT                   /translation="MTQTDLLSYLVTSQLAARMRSGTWLTTSQLVGALRAWLACQHAEC
FT                   DWLDRIRIAHASATIAQEIYDIAVADGEHARLDAHSPELQGLRARCDALLQRIDGNRDV
FT                   GAR"
FT   gene            complement(726544..727248)
FT                   /locus_tag="Bcen2424_6504"
FT   CDS_pept        complement(726544..727248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6504"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: bcn:Bcen_1325
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13234"
FT                   /protein_id="ABK13234.1"
FT                   /translation="MHIMIGHLELLGRLLLAALLGSVIGLERERLNWAAGLRTHMLVCV
FT                   GSALVMLVSTFGFEDVRGQNGVVLDPSRVAAQVVSGIGFLGAGSILLRGEVVRGLTTAA
FT                   SLWAVAGVGLAAGGGMVVASVGATAIVLAILAGVKPLERRFIAQRQQRTLQLVAERGGL
FT                   TLGTLHEALGPGRVRVKRFIVQQSDDDPDTDDISVSFSRTSGPEFAAICETLQNIACVR
FT                   TCQPDTSSRSFV"
FT   gene            727366..727659
FT                   /locus_tag="Bcen2424_6505"
FT   CDS_pept        727366..727659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13235"
FT                   /protein_id="ABK13235.1"
FT                   /translation="MRRAFFASLSQIRQEATVAHQQDAQVRDPYRGHEIFVWARPNERG
FT                   AWRDEVQVYVNGARIELVVPEAAGPEWLTEVEALRAGLERGRYLIDKRVDDD"
FT   gene            727752..728459
FT                   /locus_tag="Bcen2424_6506"
FT   CDS_pept        727752..728459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6506"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: bcn:Bcen_1323 succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13236"
FT                   /protein_id="ABK13236.1"
FT                   /translation="MSDPRTLHIYRYDPDRDAAPYMQRYEIDVNPDDRMLLDVLGRVKC
FT                   DDETLSYRRSCREGICGSDAMNINGKNGLACLTNMQTLPREIVLRPLPGLPVVRDLIVD
FT                   MTDFFNQYHSIRPYLINDTTPPARERLQSPEERDQLDGLYECILCACCSTSCPSYWWNP
FT                   DKFVGPAGLLQAYRFIADSRDLATAERLDDLEDPYRLFRCRTIMNCTDVCPKGLNPTKA
FT                   ISEIRTMLVRRTV"
FT   gene            complement(728494..729546)
FT                   /locus_tag="Bcen2424_6507"
FT   CDS_pept        complement(728494..729546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6507"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bcn:Bcen_1322 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13237"
FT                   /protein_id="ABK13237.1"
FT                   /translation="MSAMPMQERAMHAAGPVDETAPLPYPDGWFALCFSRELKRGAVLA
FT                   TPFMGRDVVLYRTASGVACAVDAYCPHQGAHLGHGGTVDGEQIVCPFHHYAYGPDGRRI
FT                   AAGCTKGGQRPTLRTWHVREWNGFVFVWQNADGLAPTWELPEVDMTGFSAPVGQAFTLR
FT                   GVMQNLPENGFDLEHFGALHRWKDMKPHTPVIDGPRISMQVDMAWKHIKWRTLIGVHGL
FT                   GCVSSDHEMKAIGLEAKIFACGVQIAPLRWTFRDGISFRFSWLSRWPAPVQRLVYAVLG
FT                   RLLHRLWLVPVFKEDIMVWGNRDYTGYGTPVAGDGPYPVFQRWARQFYPASDRVAARHR
FT                   AAQADAFAGK"
FT   gene            complement(729543..730598)
FT                   /locus_tag="Bcen2424_6508"
FT   CDS_pept        complement(729543..730598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6508"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bcn:Bcen_1321 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13238"
FT                   /protein_id="ABK13238.1"
FT                   /translation="MHAPLPLVPEPAAASRHRYPDGWFALAYSRDVKPGALVVTRFMGA
FT                   DVVLYRTASGLIRAVAPHCPHLGAHLGHGGVVRGEEIVCPFHHLAFAPDGTCVRAGRDG
FT                   KPPAATLRQRPVCEWNGLVLAWQDRAGAAPSWSLPELDLDGYSRPRGQCHTLNGSLQNP
FT                   AENGVDINHFSPVHGWSNPVLEPPQADGHRLTMRSTLVLLGQRLLLDITMHGLGCMAAR
FT                   MELPDLGLHARVVLFPTQIEPDRWTCREFVALRVERASAWPSPLRRALHEVLASAAYRL
FT                   WFVPQFKRDLRIWDHRDYDARPTLMAGELPIMTFRRWAAQFYPAPGGDAPDGRDGPVSA
FT                   AIAHADREFAR"
FT   gene            complement(730611..731705)
FT                   /locus_tag="Bcen2424_6509"
FT   CDS_pept        complement(730611..731705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13239"
FT                   /protein_id="ABK13239.1"
FT                   /translation="MQASGTPRATSAPPSETQTLVLPLPHLSLPVARHPQHEAIERQLA
FT                   IDDYPYIVQHYRSDAAARRFLAQRIPAYGSLCYPNARPDRVYALHRMMHVTTLMDDAFT
FT                   HLARTGDQAGLDTLREHFLAAVDGTPPPADAPSARLLHDTLQLMRTQSEARPAFWRRFV
FT                   ECIREQIHTQASPTATDATRLSLADYLAFRRVEGFGHWITLLTEYALDIDMGQRLAQHA
FT                   ALADARDATIDSVILVNDLFSFRKEWSAHERFNAVWILMRVEQLNAQAALDRLAVLCMS
FT                   NERRLIDAREAVATGALAGDADAQAYVTELCYMSAGNAEFHAFSTRYHGDDLGGGRFAG
FT                   GAVAMTALPTLEEIAAADRHARPR"
FT   gene            complement(731719..732681)
FT                   /locus_tag="Bcen2424_6510"
FT   CDS_pept        complement(731719..732681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6510"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bcn:Bcen_1319 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13240"
FT                   /protein_id="ABK13240.1"
FT                   /translation="MNQISEQAIAELRAPHLEPALPIRVLHGETVSDYERKVQTTYAGS
FT                   PDDWRKAIGEYLLFQFGVYDDPRSTPPISLDESGIRYFERQLHLAGFDDPVPARVERIL
FT                   DIGCGWGYILKYLAGRFPGCMRLDGINVSREQLDYCARFHAQHGLAERINLYQCNAQDV
FT                   DRLPDPATPYDLVIIRGVISHFPNALYEKAMRALHARVRGGGSVVISDNLYNVDLSEYA
FT                   SDTPDEVDRIACKHRKTPDYFRQVLIDAGFAIRDMRVLPSNIDVARWLMDAKANIDRHF
FT                   PHRAPDTLEELRVLAENWSVALIKNKVSTYSIVAVKPDA"
FT   gene            732843..733100
FT                   /locus_tag="Bcen2424_6511"
FT   CDS_pept        732843..733100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13241"
FT                   /protein_id="ABK13241.1"
FT                   /translation="MKVKDPCAFIESPDKWRKGRYDATSRHRPDIAPGTSGDEAGAGWP
FT                   VRLRTQRVFSRFWHCDREPETKYFCYMKGDSIFQESSRVF"
FT   gene            complement(733321..733995)
FT                   /locus_tag="Bcen2424_6512"
FT   CDS_pept        complement(733321..733995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6512"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: bcn:Bcen_1317 HAD-superfamily hydrolase subfamily IA,
FT                   variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13242"
FT                   /protein_id="ABK13242.1"
FT                   /translation="MRIETSFLFDLDGTLVDSVYQHVLAWKEALDAEGIELSVWRIHRK
FT                   IGMSGGLFLNQLLRETAGDIDAERVERLARLHAAAYQRLRAQVRPLPGARELLAALSNA
FT                   GIRWAIATSGRMETAAINLEALGVDPAKNVVVTRDQVKYAKPDPDLFLTAAAKLNVPIE
FT                   HTVVVGDSIWDMLAAARCRALGVGLLAGGYGSDELERAGALRVYDDPADLLWHLDEVAA
FT                   RP"
FT   gene            734045..735400
FT                   /locus_tag="Bcen2424_6513"
FT   CDS_pept        734045..735400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6513"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_1316 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13243"
FT                   /protein_id="ABK13243.1"
FT                   /translation="MRHIIGARPCHRHVPRRTHRARRRRVEHRWYNRADAPGGPPAHAQ
FT                   PSSNPRMATPDAVSSEQSWWGVLALALTAFIFNTTEFVPVALLSAIGDSLQMQPTAVGL
FT                   MLTIYAWAVAVVSLPLTFVTRHVERRKLLSVALLVFIGSHVVTGVAWNFTVLMIGRLGI
FT                   ACAHAVFWSISIPLAVRLAPSDRKSRALSLIAMGSAIAMVAGIPLGRVIGEAFGWRVTF
FT                   LIIAGTAGIALLLLRATLPLLPSQGAGSLSSIGVFLRKPALVALYAITVLVVSAHFTSY
FT                   TYIEPFVQSINHASNSRITYVLILFGIAGLPAAVCFNRVYPHRPDDFLLASIVALSGCL
FT                   LILFPCALNIVTLSVHTLVWGGAIVCFGLAMQAWVLKLAPDATDLAVSIYSGLYNVGIG
FT                   AGALLGNHIAGDFGLPWIGTFGGVVAIFAAGVAWAALRLHAKREAALAAPAP"
FT   gene            complement(735429..736205)
FT                   /locus_tag="Bcen2424_6514"
FT   CDS_pept        complement(735429..736205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6514"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_1315
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13244"
FT                   /protein_id="ABK13244.1"
FT                   /translation="MNASTHSAPLDGRIALVTGASSGIGRASAIELARRGAKVVVNARR
FT                   KAELDRLVDEIATAGGNATAFAADVANEAELRKLFDFTVSTHGRLDVAFNNAGTEGVFA
FT                   PMLEQDAQSYDRVFEPNVRGVFNSMKFAAEIMLRQGKGSIINNASMGGVIGFENASVYI
FT                   ASKHAVIGMTKTASIEWFKRGVRVNALCPGLIDTPFHHRGIWASEEARLAFAESTPAGR
FT                   WASADEMATVVAFLASDDASYVSGHALVADGGYSIA"
FT   gene            736364..737266
FT                   /locus_tag="Bcen2424_6515"
FT   CDS_pept        736364..737266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6515"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1314 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13245"
FT                   /protein_id="ABK13245.1"
FT                   /translation="MLNRLDILKIFAAAAAAPTFREAAARLGVSPQVVTRAVRELEEML
FT                   GETLFHRTTRSIRITAFGQSFAREVQGALAVVDGLFGPATGQRDEPVGVVRITAPSGMG
FT                   RHYVQPILTGLMQRYPGLVPDLRLSDVPSPVVDEQIDIGVRVGAIGDNRFVARMVGPLP
FT                   MWVVAAPSLIRRLGEPKNRKALEAMPVTCLIDRASGRPWPWMFRGEQQFVPSSPAYLTD
FT                   DTEVEIEAVCAGVGVGQCSEYLVRPYVRKGRLVRVLPSLEPEPWKLHVYRPRRGPMPRR
FT                   IRVVYDELVAKLAEATWRE"
FT   sig_peptide     736364..736435
FT                   /locus_tag="Bcen2424_6515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.482 at
FT                   residue 24"
FT   gene            complement(737405..738586)
FT                   /locus_tag="Bcen2424_6516"
FT   CDS_pept        complement(737405..738586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6516"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /note="PFAM: helix-turn-helix, Fis-type; KEGG:
FT                   bcn:Bcen_1313 helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13246"
FT                   /protein_id="ABK13246.1"
FT                   /translation="MERSVNTAPESLSRPVDLDRLRARFAAGEPLPETALPASVARSWL
FT                   RSRDAGLRPWQTARYEMQREPAESRADRRLTRCVAQEIEPLWAAFGGSEWTIMCVNPHG
FT                   TIVHARRSPQCDDALLTPIVAGRRIVEPNIGTTAPSCVIHDGAETVVAGAQHYLDELSR
FT                   VFCLAVPLVGFDGEVIGALDITGIGRRNIAQLRESFRHASLSAEQRLYAILRDCHLLQV
FT                   QFDPRWLGTPLAGVIALDEAGRVRAVSRLARQMLDLAPAGPVAPVDLRQLFPGATPAQQ
FT                   RRLLTPARTPQRIARDDGSHVWVRTVRAPLDRATRARHADVLEDAADVCNVASAAGPQA
FT                   SLHEQSLDAIRRALDEHDGNVSAAARQLGISRTTLYAKLRQLDAAGIRHDGPH"
FT   gene            complement(738729..739856)
FT                   /locus_tag="Bcen2424_6517"
FT   CDS_pept        complement(738729..739856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6517"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcn:Bcen_1312 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13247"
FT                   /protein_id="ABK13247.1"
FT                   /translation="MYTEHDTRAVTAAVARAAGAPFSIEAARIRAPRGDEVLVRVVATG
FT                   LCHTDLIVRDQYYPVPLPAVLGHEGAGVVEAVGPNVKTLAAGDHVVLTYGACGHCTSCV
FT                   GGHGAYCRQFFALNFGGADADGQTALRDASGQPLHDHFFAQSSFASYALARENNAIKVP
FT                   KEAPLELLGPLGCGIQTGAGAVINSLAVRTGSSFASFGAGAVGMSAVMAARIAGATTII
FT                   AVDIVPSRLALALELGATHALDSREVDVVDAIREITGGGVDFALESTGLPAVLSQGIDA
FT                   LGSRGTMGVVGAPKLGTRAEFDVNSLLLGGHTIRGIVEGDSVPQTFIPQLVQLHLQGRF
FT                   PFDRLVKFYPLDQINQAAEDSSKGITLKPILRLPH"
FT   gene            complement(739871..741340)
FT                   /locus_tag="Bcen2424_6518"
FT   CDS_pept        complement(739871..741340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6518"
FT                   /product="benzaldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.28"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_1311
FT                   benzaldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13248"
FT                   /protein_id="ABK13248.1"
FT                   /translation="MDSNTPALFDTDIWRGKTFTGRWHASPHAADVIEPATGNTLGRIG
FT                   LADSSAIAEASATAHRAQPAWFALPYDDRAAVLRRAAAVAETHADAIVDWLVRESGSTR
FT                   AKAAFETSVTIKALHEAAGLPSRAAGEVLPSAAGRLSLARRRPRGVVGVISPFNFPLYL
FT                   AIRAVAPALALGNAVVLKPDPRTAVCGGIAIARVFELAGLPEGVLHVLPGDGAAGAALV
FT                   ADPHVAMIQFTGSTAAGRKVGEAAGRHLKKVSLELGGKNSLIVLDDADLDRAVANTAWG
FT                   AYLHQGQICMATGRVLVQRAIHDRFVAKLVEKARSLRVGDPATGDVGLGPLINAAQRDH
FT                   AASVVDAARRAGARIETGGGHRGLFFEPTVLSGVAPGNPAFDEEIFGPVAIVVPFDTDE
FT                   DAIALANRTEYGLSMAILSADVGRALRIGERLNTGLLHINDQTVNDEVINPFGGVGASG
FT                   NGSSIGGAANWEEFTQWQWLTIKGEAPPYPI"
FT   gene            complement(741712..742566)
FT                   /locus_tag="Bcen2424_6519"
FT   CDS_pept        complement(741712..742566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6519"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1310 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13249"
FT                   /protein_id="ABK13249.1"
FT                   /translation="MFYQTSKSHIPADRVAATRRITMADYVTSWHEHEEFMFLLPSQGT
FT                   LTLTSECSKHSQRIGAGVLAMVPAGIFHDTASNPGEHCHTAVYAERDFVSFCARKSNVR
FT                   IDGGDAPRYCVPPPALLGALRLQTQFDAGDETEEAHDMARYQNDLVDRLIASACVAAVL
FT                   GAAPSDANPKVSRGQLVSEIKAYLDVMLAERIDIETIASEFAISRRHLTRIFREETGES
FT                   LTDYQLRQRVMRARSLLNVPGTTVLSAALSVGIESPSYLARLFTKFGLPAPRDLKASRA
FT                   RCN"
FT   gene            742770..743642
FT                   /locus_tag="Bcen2424_6520"
FT   CDS_pept        742770..743642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6520"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   bcn:Bcen_1309 phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13250"
FT                   /protein_id="ABK13250.1"
FT                   /translation="MSIVQRVRLVRVFSITDEGGNPAPVVLDANGWSDAQMKEVARAYG
FT                   LESGFVMRAVDPHHDFRFRFFVPNHEMEMCGHATLGALWLLRHTGAWRTNTALIETLSG
FT                   SIEARYDASDARIEVSQPAGRVEPVVDAALIARTLDALNLDAGDLLPLDIVNATTSRTK
FT                   TLVPVRTTSRLNAIMPKLDTIEALCDALSSTGLYPFALDANAPRVFDARQFPRASGYSE
FT                   DAATGIAAAALLYGAHRHGLVTGAGRGIVVRQGAAMGRPSAITVNFRDPADASSGCWLS
FT                   GPVGLMDEA"
FT   gene            743646..745127
FT                   /locus_tag="Bcen2424_6521"
FT   CDS_pept        743646..745127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6521"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: bcn:Bcen_1308 transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13251"
FT                   /protein_id="ABK13251.1"
FT                   /translation="MLLGTLEVDLSTRSLRRDGKAIHVGSRAFDVLAVLLSAAGRLVTK
FT                   DELMAAVWPGTVVEENNLQVHISALRKLLGPQRDLIVTVPGRGYQLTQRSAPSANLTPA
FT                   TPPRQGDSDIPRRHGALTGRDSLVSNIAAILDTTHILTLVGAGGVGKTSAAIEVAHAAV
FT                   SGRFDITRFVALSDAASPEAVLQKIATAFGLSIRDDRSAVDALVAALPRDRTLLVLDNA
FT                   EHVIDAVARLVDSVCMRLGNLRVLVTSREPLRVSGETVCHVRPLQVPRPESSIAELLDC
FT                   EAVQMFLQRARQSGCDLDTLRKSARLVGDICRRLDGNPLAIEMAVGRIGALGVRGVHGF
FT                   LDDRFKLLTRGYRTALAHHQTLQASFDWSFASLSPSSQKLLGHVAAFQRAFTFEALRAL
FT                   VCDARYTLSDVAGDIAELTEKSLVSVEPGNGEHRFFLSESARAYALQKRRIGGKDIRMF
FT                   AHYAGYHFSACEEASTIGTDAFNEKVEERELAYAI"
FT   gene            complement(745471..745713)
FT                   /locus_tag="Bcen2424_6522"
FT   CDS_pept        complement(745471..745713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13252"
FT                   /protein_id="ABK13252.1"
FT                   /translation="MRFSSVRRGCEVRIEHRHRAMHRGRGQLALAARRQIDDAGFDAIS
FT                   GGGGRGARCVGYSWNGFIRGGEMARPILLVALFDT"
FT   gene            745768..746718
FT                   /locus_tag="Bcen2424_6523"
FT   CDS_pept        745768..746718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6523"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.1"
FT                   /note="KEGG: bcn:Bcen_1307 catechol 1,2-dioxygenase;
FT                   TIGRFAM: catechol 1,2-dioxygenase; PFAM: intradiol
FT                   ring-cleavage dioxygenase; Catechol dioxygenase, N-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13253"
FT                   /protein_id="ABK13253.1"
FT                   /translation="MSVKVFDTTEVQDLLKAASNAAGNRGNGTNGDARTQQIVLRLLGD
FT                   LFKAIDDLDITPDEVWAGVNYLNKLGQDSEAALLAAGLGLEKYLDIRMDAADKAIGLDG
FT                   GTPRTIEGPLYVAGAPVRDGVAKIDLDADDGAGPLVIQGTVTGLDGKPIAGAVVECWHA
FT                   NSHGFYSHFDPTGKQSDFNLRGAVRTGADGKYEFRTLMPVGYGCPPQGATQQLLNRLGR
FT                   HGNRPAHVHFFVDSPAHRKLTTQFNIDGDPLIWDDFAYATREELIPPVTEKTGGTALGM
FT                   KADAYQDIEFNFVLTPRVQGRDNQIVERLRASATA"
FT   gene            746836..748194
FT                   /locus_tag="Bcen2424_6524"
FT   CDS_pept        746836..748194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6524"
FT                   /product="benzoate 1,2-dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: bcn:Bcen_1306 Rieske
FT                   (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13254"
FT                   /protein_id="ABK13254.1"
FT                   /translation="MSATIDHTNDLDHLLETAVQDDKEAGIFRCRRDIFTNAELYELEM
FT                   KHIFEGNWVYLAHESQIPDNNDYYTTWIGRQPIVITRDKTGELHAVINACAHKGAMLCR
FT                   RKHGNKGSFTCPFHGWTFSNTGKLLKVKDEKTTEYPVQFNTHGSHDLKKVARFANYRGF
FT                   LFGSLNADVLPLEDYLGEARVIIDQIVDQAPNGLEVLRGNSSYIYEGNWKMQMENGCDG
FT                   YHVSTVHWNYAATMGRRKEDGTKAVDANSWSKSVAGVYGFDHGHILLWTRTMNPEVRPV
FT                   YRHRDEIKARVGDVQADFIVNQTRNLCVYPNVFLMDQFSTQIRVVRPLAVDKTEVSIFC
FT                   FAPKGESEADRTTRIRQYEDFFNVTGMGTADDLEEFRACQAGYAGITAMWNDLSRGAPL
FT                   WVDGPDENAKKMGLNPRISGERSEDEGLFVCQHEHWVNVMRDALKKERGEVAA"
FT   gene            748191..748679
FT                   /locus_tag="Bcen2424_6525"
FT   CDS_pept        748191..748679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6525"
FT                   /product="2-chlorobenzoate 1,2-dioxygenase"
FT                   /EC_number="1.14.12.13"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: bur:Bcep18194_C7047 2-chlorobenzoate
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13255"
FT                   /protein_id="ABK13255.1"
FT                   /translation="MSFDYRTICAALYREARLLDDREWDAWLTCYTEDVTYWMPAWDDD
FT                   DRPTDDPRSEISLMYYADRGGLEDRVFRIKTERSGASTPEPRTSHNVTNVEVLAERDDE
FT                   VDVRYNFHTLNHRYRVTDHFFGTMFVTLRRAGDALLISHKKIVLKNDYIRQVLDVYHV"
FT   gene            748719..749741
FT                   /locus_tag="Bcen2424_6526"
FT   CDS_pept        748719..749741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6526"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   FAD-binding 9, siderophore-interacting domain protein;
FT                   KEGG: bcn:Bcen_1304 oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13256"
FT                   /protein_id="ABK13256.1"
FT                   /translation="MSSYKIALNFEDGVTRFIDCKAGEKVLDAAFRAKINLPMDCADGV
FT                   CGTCKCRAESGHYDLGDDYIDDALTEDEKDGGLVLTCQMVPHSDCVIAVPTSSVACKTG
FT                   QSAFAATVTKVEQHNDAAVVLELDVGASAPAFLPGQYVNIGVPGSGQHRSYSFSSAPGD
FT                   TKVGFLIKKIPGGVMSRWLESAKPGDTLELHGPLGSFYLRDVQRPLLFLAGGTGLAPFL
FT                   SMLEVLARSGSQQKVHLIYGVTRDLDLVLVDAIEAVASKLPNFSFATVVADAASNHARK
FT                   GWVTQHIPADALNDGDVDVYLCGPPPMVDAVRQYFDDAGVKPNSFHYEKFTPNVTAKAA
FT                   "
FT   gene            749738..750514
FT                   /locus_tag="Bcen2424_6527"
FT   CDS_pept        749738..750514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6527"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcn:Bcen_1303 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13257"
FT                   /protein_id="ABK13257.1"
FT                   /translation="MTMQRFSGKVVVVTGAAQGIGRGVALRAAAEGGKVLFVDRADFVA
FT                   DVAAEATGGETAGFVADLETYEGAHASIAYAVQRFGGIDILINGVGGAIRMRPFAEFEP
FT                   AQIDAEIRRSLMPTLYACHATLPHLIARGGGTIVNISSNATRGIRRVPYSAAKGGVNAL
FT                   TSALAMEYAEHNIRVVATAPGGTSAPPRRVPRNAAGDTEQEQAWMGEAVRQVTESTYFK
FT                   RYGSLDEQIAPILFLASDEASYITGTVLPVAGGDTG"
FT   gene            750604..751002
FT                   /locus_tag="Bcen2424_6528"
FT   CDS_pept        750604..751002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6528"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bcn:Bcen_1302
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13258"
FT                   /protein_id="ABK13258.1"
FT                   /translation="MSKREAIIPAGMEAVYEKIGYAPAIKVGDTVYVSGQIGRDAAMQL
FT                   VEGREAQIVQAFENLKRVLDAGGASLDDVVDLTTFHTDMRDLPLFMQVRDRYFHAHPLP
FT                   AWTAVGAHMLGGSPGYIVEIKAMAVLRD"
FT   gene            751092..752939
FT                   /locus_tag="Bcen2424_6529"
FT   CDS_pept        751092..752939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6529"
FT                   /product="Feruloyl esterase"
FT                   /EC_number="3.1.1.73"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   bcn:Bcen_1301 feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13259"
FT                   /protein_id="ABK13259.1"
FT                   /translation="MLNGRTRRGGWRFGMAVAASAAGILMVSGCNDNEVQNAGGGTADA
FT                   ALTCDQTMKARFAPDANTAVIAVKSFKAGDPLVLDASAVTSATPVAGNSLCLVKLNVGP
FT                   GHAGPSAAPSTSAGIGMEIWLPAPSNWNRRIHNLGGGGWQGGAYGDPTKIASAGATPNA
FT                   ATIAASEGAVVGTTDTGHAIQNGSFAMNPDGTINTTLWNDFAQRSLHELALKTKALVAA
FT                   YYATPQKYAYWDGCSTGGRQGYNEAQNNPSDYDGYLNGAPAFNWSKFITGELYPQVVAQ
FT                   VDLGGVTLTDAQQSLLSGAAVSACDTVGGQHLGYLMDPAQCRYDPTQDANVLCSGVKIG
FT                   AVTGTNATAACVTAARATAMNKTWYGMTRDGSVPNPALDIGTATSLASNQMWFGLMRGT
FT                   GTGALAGATPFSISTDLVALELQDPTIAGAGFTNATGNGANKWKDLGYAGLANAYDQGI
FT                   ALQSSFGNINTDNPDLSGLVTHGAKVLHYHGLADPLITPSGSIHYYERIASRMGGIPAV
FT                   QQFDRLFLVPGMGHCSGYGGVNGTAGPAQTANTVPLPHADRQDLYAQLVNWVENGNAPT
FT                   SIKLTSADGSASQPVCMYPTKATYNGSGSIRDAANYSCK"
FT   sig_peptide     751092..751181
FT                   /locus_tag="Bcen2424_6529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.719 at
FT                   residue 30"
FT   gene            complement(753072..753878)
FT                   /locus_tag="Bcen2424_6530"
FT   CDS_pept        complement(753072..753878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6530"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Insect alcohol
FT                   dehydrogenase family; KEGG: bcn:Bcen_1300 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13260"
FT                   /protein_id="ABK13260.1"
FT                   /translation="MSNPTVVVVTGVSSGIGRATAEQFAKRGCRVFGTVRSIARTAPVA
FT                   GVELIEMDVRDDASVQSGIRTIVERAARIDVLVNNAGTSLIGAVEETSLAEAAALFDTN
FT                   VFSILRTVQAVLPHMRARRGGRIVNVSSVLGFLPAPYMGLYAASKHAVEGLTETLDHEV
FT                   RQFGIRATLVEPSFTRTNLDVNAPLANAKIADYDRERTLAARAVVDNVKAAPEPDGVAA
FT                   TIVEAALGAWRMRRAPSGEASLLGKLRRFMPAGPVDSSLRKKFRLA"
FT   sig_peptide     complement(753813..753878)
FT                   /locus_tag="Bcen2424_6530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.875 at
FT                   residue 22"
FT   gene            complement(753914..757054)
FT                   /locus_tag="Bcen2424_6531"
FT   CDS_pept        complement(753914..757054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6531"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bcn:Bcen_1299 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13261"
FT                   /protein_id="ABK13261.1"
FT                   /translation="MSERRFNLSALAVRERAITLFLICLISLAGLVSFFKLGRAEDPAF
FT                   TIKVMTIITAWPGATAQEMHDQVAEKIEKRMQELRWYDRTETYTRPGLAITTLTLLDST
FT                   PPSEVQEQFYQARKKIGDEATNLPAGVIGPMVNDEYADVTFALFALKAKGEPQRLLVRD
FT                   AEALRQRLLHVAGVKKVDIIGEQPERIYVQLSHDRLATLGVSPQEVFAALNGQNVLTAA
FT                   GSVETRGPEIFIRVDGAFDKLQKIRDTPIVSQGRTLKLSDIATVERGYEDPSTFLIRNN
FT                   GEPALLLGIVMRDGWNGLDLGRALDHEVGAINAGLPLGMSLTKVTDQSVNISSAVDEFM
FT                   VKFFAALLVVMLVSFVSMGWRVGLVVAAAVPLTLAVVFVVMAATGKNFDRITLGSLILA
FT                   LGLLVDDAIIAIEMMVVKMEEGYGRVAASAYAWSHTAAPMLAGTLVTAVGFMPNGFARS
FT                   TAGEYTSNMFWIVGIALIASWVVAVVFTPYLGVKMLPDFRKIEGGHDAIYDTPRYNRFR
FT                   QVLTRVIAHKWLVAGSVVGLFVLAILGMAVVKKQFFPISDRPEVLVEVQMPYGTSISQT
FT                   SAAASKVEAWLAKQKEARIVTAYVGQGAPRFYLAMGPELPDPSFAKIVVRTDSQDERDA
FT                   LKARLRRAVADGLAPEARVRVTQLVFGPYSPFPVAYRITGPDPDTLRGIASEVGNVMNG
FT                   SPMMHTVNADWGTRAPTLHFTLQQDRLQAVGLTSSAVAQQLQFLLTGVPVTAVREDIRT
FT                   VQVIARSGGDARLDPARLDDFTLAGANGQRIPLSQVGKVDVRMEEPIMRWRDRVPTVTV
FT                   RGDIAEGLQPPDVSAAITKQLQPIVDKLPSGYRIEQAGSIEESGKATTAMLPLFPIMLA
FT                   ITLVIIIFQVRSISAMVMVFMTSPLGLIGVVPTLILFRQPFGINALVGLIALSGILMRN
FT                   TLILIGQIHQNEQAGLDPFHAVVEATVQRARPVILTAMAAVLAFIPLTHSVFWGTLAYT
FT                   LIGGTFAGTILTLVFLPAMYAIWFRIGPGRTAGSHHGEPEPASLSDSTLAATLDARN"
FT   gene            complement(757051..758175)
FT                   /locus_tag="Bcen2424_6532"
FT   CDS_pept        complement(757051..758175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6532"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_1298 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13262"
FT                   /protein_id="ABK13262.1"
FT                   /translation="MVRRRPAFFAVASALPLALAACSGKAPSDPRTEAPLVRTAVVQAA
FT                   VPASRSFTGTVAARVQSDLGFRVAGKVLERLVDTGQTVKRGQPLMRLDPVDLKLAARAR
FT                   DEAVAAARARARQTAEDEARYRDLRGTGAISASAYDQIKAAADAAKAQLSAAEADADVA
FT                   RNATGYAQLVADGDGVVMETLAEPGQVVSAGQPVVRLAHAGSREAVIQLPETLRPAIGS
FT                   VAQAGLFGKPDISVPATLRQLSDTADARTRTFDARYVLQGALADAPLGATVTIRIPDDA
FT                   RAASQRGMQVPIGALLDAGKGPGVWVVAGEPAKVTWRPVKVEHLDDDSARVAGDGALKP
FT                   GERVVALGAQLLREGEAVRMSAPAATVASAGARP"
FT   sig_peptide     complement(758110..758175)
FT                   /locus_tag="Bcen2424_6532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.584 at
FT                   residue 22"
FT   gene            complement(758258..758875)
FT                   /locus_tag="Bcen2424_6533"
FT   CDS_pept        complement(758258..758875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6533"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_1297
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13263"
FT                   /protein_id="ABK13263.1"
FT                   /translation="MKKIDPSPAPARGPADHDVRDQIVAAATEHFSRYGYEKTTVSDLA
FT                   KAIGFSKAYIYKFFESKQAIGEMICANCLREIETDVRAAVAAAELPTEKLRRLFKVSTE
FT                   ASLRLFFHDRKLYDIAASAATENWQSVQAYEARVQTLLQDVLQAGRQNGEFERKTPLDE
FT                   TATAIYLVMRPYLNPLLLQYNLDTTDAAPAQLSSLVLRSLAP"
FT   gene            758953..760413
FT                   /locus_tag="Bcen2424_6534"
FT   CDS_pept        758953..760413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6534"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_1296 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13264"
FT                   /protein_id="ABK13264.1"
FT                   /translation="MLPKPIVAAALAAILSAGCAVGPDYARPDVAMPRQFQGQRAVDQR
FT                   HAAADADLATWWTGFGDPQLTRYITLALAQNLDLAQAAARVAQARAGLGAANAALLPSG
FT                   NVSGQAARVYQSVETPLGQVLNATPGFDRHGNDYEADFNASWELDIFGGLRRGREAALA
FT                   DYQASEAAAVATRLAVAAQTADTYITIRGLQGRLEVARHQVQTEQDLLSTLNLLYGKGL
FT                   AAELQVRQAEGALAQVRATVPVLEAALDAAMNALDVMLGAQPGTHRAELLDGGEVPVAP
FT                   RIAATGTPGELLRRRPDLIAAERRVAASNARIGVAIAEYYPKFSLGGLIGSATTMGAGN
FT                   LFAGGANQAAGVLGLRWRLFDFGRINAQIAQAKGQDAEMLAAYRLAALHATEDVENAFS
FT                   ALVKRDEQAAILGDGVKSLGRARAASFAAYQKGVVSLIEVLQADESLLRVSDERVQART
FT                   ESARAAVAAFKALGGGWQAPEAQAVASR"
FT   sig_peptide     758953..759033
FT                   /locus_tag="Bcen2424_6534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.661 at
FT                   residue 27"
FT   gene            760458..760823
FT                   /locus_tag="Bcen2424_6535"
FT   CDS_pept        760458..760823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6535"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: bcn:Bcen_1295 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13265"
FT                   /protein_id="ABK13265.1"
FT                   /translation="MKISELAEFDGSKYLKDDEAIRYYLAQAFEDGDPRLIQAALGNVA
FT                   KVRGMTALARESGVKREALYRALSEGGNAEFATIMKVVAALGLHLTVAPTTQTAEAAPA
FT                   PEPTSRTRSHARATAHG"
FT   gene            complement(760914..762497)
FT                   /locus_tag="Bcen2424_6536"
FT   CDS_pept        complement(760914..762497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6536"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: bcn:Bcen_1294
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13266"
FT                   /protein_id="ABK13266.1"
FT                   /translation="MALISFALFPFRFPGRRAGVAFAVCVALCGCEMRQDDNTAAPGNA
FT                   ADAASAAEAPEPASGWRFVRIGASAAEAGASMSARVKDDRRLSRDRGALVADSTSSAAS
FT                   TPPPDAASASTARRPVIAAAAASADAATLARGRYLALAGDCAACHDAADHTPYAGGQPV
FT                   NSPFGPIYAPNITPDPTHGIGNYTLRQFDDAMRRGVRADGSRLYPAMPYPSFAHLTDDD
FT                   VRALYAYFMRGVAPSANAAKLTQLPFPFNQRWALGLWSLVFANRDRFTPQPSQSAQWNR
FT                   GAYLVQGLGHCGACHTPRGPAYNERGYDERSPAFLTGGINDHWFAPNLTGTAPDGLGRW
FT                   SADDIAAFLRSGHAARGAVFGAMALVVGESTALLTDADRHAIAVYLKSLPAQRTAATNP
FT                   LGVGVPRLTVAGPRPEGGQQAPGAGVYAGFCARCHGAEGKGVPDHGPALAGSSIVLAAD
FT                   PTSAIRIVVEGARPTPGKPGPVQRMPAMRGALTSGEIAAVVSYVRGAWGNRAAPVSERD
FT                   VRRLRGAIHR"
FT   gene            complement(762488..762889)
FT                   /locus_tag="Bcen2424_6537"
FT   CDS_pept        complement(762488..762889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bps:BPSL0721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13267"
FT                   /protein_id="ABK13267.1"
FT                   /translation="MNDARRAWTPLLAIAAGLVGAPALWFAQMLVSETLASTACYPLGV
FT                   AQAVPRWAHVGVWLALIAAGAFALAAGCATWLARAWRHRHDGDAPAATRDDSTRFLARC
FT                   GMLAALGFVIGLVFTGIVTAFVGPCSPWR"
FT   sig_peptide     complement(762791..762889)
FT                   /locus_tag="Bcen2424_6537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.684 at
FT                   residue 33"
FT   gene            complement(762886..765525)
FT                   /locus_tag="Bcen2424_6538"
FT   CDS_pept        complement(762886..765525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6538"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; cytochrome
FT                   c oxidase, subunit I; KEGG: bcn:Bcen_1293 cytochrome c
FT                   oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13268"
FT                   /protein_id="ABK13268.1"
FT                   /translation="MAIARDTPAPLSRVPDLGEAPPGSTHERVLAELWESEPGWRGWLG
FT                   TVDHKRIGLRYIVTAFVFLLLGGVEALVMRIQLARPNATVLTPAQYDSLFTMHGVTMIF
FT                   LYALPVLSGFANYLWPLMLGSRDMAFPRLNAFSYWSFLFAGLFLYASFPLGAVPDGGWF
FT                   NYVPLTSLDYSAGANIDIYALGMILLGISTTGGAANFVVTLLRMRAHGMSIDRLPIIVW
FT                   GTLTASVANLVAVPSVSLAFLLLWLDRNAGTHFFDVAHGGRPLLWQHLFWMFAHPWVYV
FT                   VVLPAMGIVSDALPTFCRRPLVAYEAVAVSTVATMLIGFEVWVHHMFATGIAPLALAFF
FT                   GAASMLISIPSAVAVFAWIATIWTGRPVFRTPFLYFAGFVLMFVVGGVSGVMTAAVPLD
FT                   WQLTDTYFVVAHLHYVLLGINVFPVLGGVAYWFPKFTGRMMNERFGKLTFWVVLVGFNL
FT                   GFFPMHISGLLGMPRRIYTYPSGMGWDTSNLLTTIGSFVFGIGIVMFVVNALVSARRGV
FT                   RAGDNPWGAAGLEWSVASPTPVYNFAVLPLVASRHPLWETRDDPTRTSLRVGYRLADGR
FT                   EALAVTPLAAAPSAILKMPEDSCVPFVLALLATAVFAAMLARSPTLVCMAVAGCTIATA
FT                   AWLWPRRELGQRARLPARADTLAPAAATGLHPDEPPSATVPPGAPAACIEPLPVGSCGE
FT                   RAGGWWGVLTLIVTEAGLFGYLLFCYFYLQSQWSAPWPPEGMPKIWLAAANTVVLLSSS
FT                   VFVWLAERAVRADRQARAVAMLVVALVLGTAFALVQLHEWRDHPYGPTAHLYGSLYFTI
FT                   TGFHLAHVVAGLAILALLAGWTAAGFFGRGRRVALTIGGLYWHFVDVVWLFIFTALYVS
FT                   PFWLRSTG"
FT   gene            complement(765539..766843)
FT                   /locus_tag="Bcen2424_6539"
FT   CDS_pept        complement(765539..766843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6539"
FT                   /product="Cytochrome c, monoheme"
FT                   /note="TIGRFAM: Cytochrome c, monohaem; PFAM: cytochrome c
FT                   oxidase, subunit II; cytochrome c, class I; KEGG:
FT                   bcn:Bcen_1292 cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13269"
FT                   /protein_id="ABK13269.1"
FT                   /translation="MADTPPLSRRSGTRSAQQTACRLPRGRVKMRRSIYKPAVTRRLLC
FT                   PPSRPLTTAYVRAARARNLLCRERLSSRRRMRQGVVLLVPPFRKTRRITRIAPFAWAAA
FT                   PIVARAAAEPVAPGNPAAPLPLAYVVHAAGPAAQPVFVLGWALLALCTFVCVAIAVLLL
FT                   IALFRRRVQAGGGYGSGLTIVTVGTAISILLLFGALVYMLRVLGAVAAPPRPPTLTITV
FT                   TAQDWWWAVRYPDDADGRGFVTANEIHIPVGQPVAIELKSADVIHAFWVPQLAGKTQTI
FT                   PGQTNRQWLQADRPGVYRGQCSQYCGAQHAHMAFEVVAEPPAAFHAWLAAQRQPAPAPA
FT                   AGAGAERRGQRVFAARCAGCHAVRGTDAAGDAGPDLTHVGTRRLLAAGTLDNTPDNLRR
FT                   WIAHAQQVKPQSLMPSIALAPRDADDLAAYLATLH"
FT   gene            complement(766887..768722)
FT                   /locus_tag="Bcen2424_6540"
FT   CDS_pept        complement(766887..768722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6540"
FT                   /product="thiamine pyrophosphate enzyme TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: bcn:Bcen_1291 thiamine pyrophosphate enzyme-like TPP
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13270"
FT                   /protein_id="ABK13270.1"
FT                   /translation="MATVADFIVERLYDWGVRRIYGYPGDGINGFFGALNRADGKIEFI
FT                   QARHEEMAAFMASAHAKFTGELGVCVATSGPGAAHLVTGLYDARLDHMPVLAIVGQQAR
FT                   AALGGHYQQEVDLPALFKDVAGAFVQLATVPGQVRHLVDRAVRTALGARTVTALVLPND
FT                   LQELDYAPPKRAHGTVHSGVGYTAPKVVPYADDLRRAADVLNAGSKVAMLVGAGALKAT
FT                   DEVIAVADRLGAGAAKALLGKAALPDDLPWVTGSIGLLGTKPSYELMTECDTLLVIGSG
FT                   FPYSEFLPKEGQARGVQIDLKADMLSLRYPMEVNLVGDSAETLRALLPLLNERRDTAWR
FT                   DRIAQWNHDWHDALAARAAAKASAGRGVNPQRAFTELSPRLPDDVILTSDSGSCANWYA
FT                   RDLMMRRGMMGSLSGGLASMGAAVPYAIAAKFAYPVRPVIAMVGDGAMQMNNMAELITV
FT                   AKYWRQWPDPRWICMVLNNEDLNQVTWEQRVMEGDPKFDASQQIPNVPYYRFATLLGLK
FT                   GIYVDDPEQLGAAWDEALASDRPVVLEVKSDPEVPPLPPHVTLQQAKHFAETLVKGDPR
FT                   EGNVIVETARQVLSAVLPGNGEHGGKSGKGGKGES"
FT   gene            769055..769438
FT                   /locus_tag="Bcen2424_6541"
FT   CDS_pept        769055..769438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6541"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   bcn:Bcen_1290 protein of unknown function DUF305"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13271"
FT                   /protein_id="ABK13271.1"
FT                   /translation="MPAFNRSFLRRCAACALLAACASALPAAAQLRPPNPASVPDTSTQ
FT                   AFKRADRKMMEAMESAPYTGDADRDFVSHMAPHHQGAIDMAQVELKYGKDPTLRQLASR
FT                   IVAAQRDEIALMERWQKERGKTP"
FT   sig_peptide     769055..769144
FT                   /locus_tag="Bcen2424_6541"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 30"
FT   gene            769566..770306
FT                   /locus_tag="Bcen2424_6542"
FT   CDS_pept        769566..770306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13272"
FT                   /protein_id="ABK13272.1"
FT                   /translation="MDGEHETAGRSIDSVADYMAAIGAQRQTMALRLFRGQCNAGWPLV
FT                   PGIARQRASPDVEARMLDEFTRRALPHLEPGQNLDACDWLALAQQHGMRTRLLDWSGNA
FT                   LAALWFAVRRAGEAGGDGVVWCLSHDADDIATAAERRAPLQVTRTKVFRPRHVMPRITA
FT                   QDGWFTIHCYDAGAERFVPLDQHGDLAGRLMRIVVPGARFATIRQELAGVGVSVATIFP
FT                   DLDGIAQLTDTRYFPDDEDTHAPR"
FT   gene            770465..770971
FT                   /locus_tag="Bcen2424_6543"
FT   CDS_pept        770465..770971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6543"
FT                   /product="protein of unknown function DUF1452"
FT                   /note="PFAM: protein of unknown function DUF1452; KEGG:
FT                   bcn:Bcen_1288 protein of unknown function DUF1452"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13273"
FT                   /protein_id="ABK13273.1"
FT                   /translation="MREPNEPPRGRRDTACGPAAGSRPAGNAVTRAFERFASSVTTWAG
FT                   SPVAFGSAVAITVLWLVSGPLFHYSNAWQLVINTGTTIITFLMVFLLQRNQNRDSVALH
FT                   LKLDELLAVTRAASDRLIGIEDASEEELRALAQTYVEMAQRAAERGEDEPGGKRAETAD
FT                   TPPES"
FT   gene            771214..771624
FT                   /locus_tag="Bcen2424_6544"
FT   CDS_pept        771214..771624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6544"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: bcn:Bcen_1287
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13274"
FT                   /protein_id="ABK13274.1"
FT                   /translation="MYFLDPASGRRRRAYLRDKAVAGRHDVADYANTQVKRAADHARGA
FT                   IVGLRADWLAGDASDVQVAERVRAALGRLVARPRDIDVSVERGNVCLTGQVEEAERQAL
FT                   IDGVAALHGVHHVEDAMGARSEYKASPDGHSQ"
FT   gene            771739..772221
FT                   /locus_tag="Bcen2424_6545"
FT   CDS_pept        771739..772221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13275"
FT                   /protein_id="ABK13275.1"
FT                   /translation="MIDRQPPDTTPPQPEPGAHDALEHLLGSLHRHGFLRFANEVVSAN
FT                   ARLADTFVDALDKPGMQSGMENLAVLVTALSRIPPEQFSRAAFAAADALHHVGSWQPSQ
FT                   HEHVAPGVRGVYRLLHDEALWDALTPLLEGLKVFAQGLARDPRSPVAELNETTKDA"
FT   gene            complement(772196..772753)
FT                   /locus_tag="Bcen2424_6546"
FT   CDS_pept        complement(772196..772753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6546"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bcn:Bcen_1285 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13276"
FT                   /protein_id="ABK13276.1"
FT                   /translation="MPAGAAAKRACTLLYKAVDLSITRCLPCMTLPDPADFPVRAVPLA
FT                   PLAKERATIICHRNQRVLLVARGRASRWTLPGGVIRRGESALDAAHRELREETGLADLE
FT                   LAYFFYVDGSVKRHHVFVASLPLGAHACPGREIALCRWVGIDAVSHWPASAPTQRIIRQ
FT                   FAGLCAASDLQPRALTRLSSSR"
FT   gene            772805..773152
FT                   /locus_tag="Bcen2424_6547"
FT   CDS_pept        772805..773152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13277"
FT                   /protein_id="ABK13277.1"
FT                   /translation="MSFLPPAIEGGPCGATYELSRVVRFVGPMRRPAFRLGRLAFGGVV
FT                   GAARRRRARAAALAFGAGRAVAAIFAACIGVERGGACHGSRVLSGAVVMHASRIVHAAV
FT                   GRSRWPGPPFA"
FT   gene            773213..774640
FT                   /locus_tag="Bcen2424_6548"
FT   CDS_pept        773213..774640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6548"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bcn:Bcen_1283 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13278"
FT                   /protein_id="ABK13278.1"
FT                   /translation="MPDAILCPLSVRERWCVAVRRALTPGPRRTGAPDAFAPAVAGVAL
FT                   STPMRPMAPMRVPWPALAPAFQRWSTAIARAGDGQSGGGSGSGAAPGRNGEHSTDAPGG
FT                   GGGDDHPHDDRGGRTGGDGDGNDGERKRPGKKPLIILGAVVLVLLIGGLVWWFATRNQE
FT                   STDDAYTDGNAIAVAPHVSGYVTRLAVDDNTFVRRGDVLVEIDPRDYRAQVDAAQAQLG
FT                   LAQAQLDAARVQLDIARVQYPAQYRQARAQIESAEAAYRQALAAQSRQRAVDARATSQQ
FT                   AIDAADAQRATADANVAMAQAQARTASLVPQQIRQAETAVEERRQQVLQARAQLETANL
FT                   NLSYCEMRAPSDGWVTRRNVQLGSFLQPGTSIFSIVTPRVWVTANFKESQLERMRIGDR
FT                   VDVSVDAYPDLDLHGHVDSIQLGSGSRFSAFPTENATGNFVKIVQRVPVKIVLDGPLPT
FT                   RPPLGLGLSAVPTVHLK"
FT   gene            774726..776318
FT                   /locus_tag="Bcen2424_6549"
FT   CDS_pept        774726..776318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6549"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_1282 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13279"
FT                   /protein_id="ABK13279.1"
FT                   /translation="MSRPPERGGASGGTWRPAANPWLIAIVVTLAAFMEVLDTTIVNVA
FT                   LPHIAGTMSASYDEATWTLTSYLVANGIVLPISGFLGRLLGRKRYFLLCIAAFTVCSFL
FT                   CGVATNLGELIVFRVLQGLFGGGLQPNQQSIILDTFPPEQRNRAFSISAIAIVVAPVLG
FT                   PTLGGWITDHFSWRWVFLLNVPIGALTVLAVMQLVEDPPWRRDAERGISIDYIGIGLIA
FT                   IGLGCLQVMLDRGEDEDWFGSNFIRVFAVLSVLGLVGATLWLLRTKKPVVDLSCLRDRN
FT                   FALGCVTIATFAAVLYGSAVIVPQLAQQRLGYTATLAGLVLSPGALLITLEIPLVSRLM
FT                   PHVQTRYLVGFGFVLLCASLIYSRTLVPDIDYTHLMLIRCAQSLAIGFMFVPITTLAYL
FT                   TVPQRLNDDASALFTMFRNVAGSIGISVSTALIRERTQARMAHLSTHMSTLSQNFQDAL
FT                   QENARAIGALTGAQPSAALQTASGRLYQTFIEQATILAYIDVFAILAVFCAFSIPLTFL
FT                   FSPAKAAGGAGGH"
FT   gene            776318..778003
FT                   /locus_tag="Bcen2424_6550"
FT   CDS_pept        776318..778003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6550"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_1281 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13280"
FT                   /protein_id="ABK13280.1"
FT                   /translation="MMTMHRRGRCRHSLPARGIAAMLAACAVLAGCTVGPDFKPPQADA
FT                   PANWHDLQAADAASPASGASAASAASAASAPGAHAPSSPVTSADPDPRWWRAFGDPLLD
FT                   QLVERAAHDNLDVQAAVLRIAQARAQIRAAAAQGLPDVRATASYQREQLGLKGIVEEQG
FT                   IDQRVDRLGAPGSPLDRFGPGTGASVQQGARGALDALEAPVNLWQAGFDASWELDLFGR
FT                   VRRSVEAAGAQASAAIASRDDALLSLEAEVAQTYLQLRGAQAQRALADDLQRAQRELLD
FT                   LTREQAAHGLASDLDVRSAEARLAQIRTQLPQFDQQIVLLRNGLAYLVGGAPGALDDWL
FT                   DAPRALPDVPPAVPVGLPSTLARRRPDIRRAEAELHAATADVGVAVAQFYPDISLTGQV
FT                   GLRASHVRELAHWSHLFYSFGPAVSLPIFSGGQLVSNLRLSQARQAEAALAYRQAVLVA
FT                   LRDVDNALAVYRTDQARAAALDDAVKAEQGALDLARDRYRKGLSPFLDVLDAERQWSEG
FT                   RQQAEQGALQKTTDLVALYKALGGGWEAGSGTNSDAGAEAARTR"
FT   sig_peptide     776318..776410
FT                   /locus_tag="Bcen2424_6550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.434 at
FT                   residue 31"
FT   gene            complement(778071..778781)
FT                   /locus_tag="Bcen2424_6551"
FT   CDS_pept        complement(778071..778781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6551"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcn:Bcen_1280 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13281"
FT                   /protein_id="ABK13281.1"
FT                   /translation="MPIRILLVEDDVPLSALIADYLRQHHYRVDTLFDGAGAVPAIVAS
FT                   RPDLVLLDVNLPGKDGFEICREARMHYDGIVIMVTGRDEPFDELLGLELGADDFLRKPV
FT                   EPRLLLARIKAQLRRTRVPAGEPVPDSPQRYVFGKFSIDRADRRVHLPDGSMPRLTSTE
FT                   FDLLWALVCRAGEVVSREDLTLLLRGIAFDGLDRSIDGRISKLRRKLRDDANEPKRIKT
FT                   IRSKGYQFSKHAWD"
FT   gene            779309..779722
FT                   /locus_tag="Bcen2424_6552"
FT   CDS_pept        779309..779722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13282"
FT                   /protein_id="ABK13282.1"
FT                   /translation="MPHRLATGRQADKTNDSRKSRDSRGSEMTPLQVVLSLDALTHAIE
FT                   AAVARADWNEAVRAAEMRSAFIVALAPDQPDEVMSALMKVQEIDVRISTVARETLEALV
FT                   AEGWTALHASRAATNALRVRQRSLDTGAAATRH"
FT   gene            complement(779990..780556)
FT                   /locus_tag="Bcen2424_6553"
FT   CDS_pept        complement(779990..780556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6553"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_1278 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13283"
FT                   /protein_id="ABK13283.1"
FT                   /translation="MERPMTFSAVPPVSSPPVLDTPRLILEGHPLGDFDALAAMWAEPG
FT                   VVAHIFNGTPSTPRDSWMRMLAYRGLWPLLGYGYWAIREKASGRYVGDLGFADFHRNIK
FT                   PPIRGVPEAGWALATWAQGNGYATEALAAALAWLDAQQRFERSVCLIAPTNVASIRVAE
FT                   KAGYGEPRRIRFNDADSLMFSRKSR"
FT   gene            complement(780679..780900)
FT                   /locus_tag="Bcen2424_6554"
FT   CDS_pept        complement(780679..780900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13284"
FT                   /protein_id="ABK13284.1"
FT                   /translation="MNDNLTSNTPNLSASAIWALERLADVRYGRDAPALGWSIARELVS
FT                   AGFVSHPPHGRSGASITAEGRSFLKSRK"
FT   gene            complement(780966..781316)
FT                   /locus_tag="Bcen2424_6555"
FT   CDS_pept        complement(780966..781316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6555"
FT                   /product="phosphocarrier HPr protein"
FT                   /note="PFAM: phosphocarrier HPr protein; KEGG:
FT                   bcn:Bcen_1276 phosphocarrier HPr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13285"
FT                   /protein_id="ABK13285.1"
FT                   /translation="MPAARCPQHARHRAGRAPLRPPVRRLSSIVATVVYVQIGPAWNRN
FT                   RGRAARDATVDAARRFDSDIQLIANGHGSNAKDSGAIASLQVHGGTSAQVLATGPDEEA
FT                   ALQALLPLLQAG"
FT   gene            781591..781944
FT                   /locus_tag="Bcen2424_6556"
FT   CDS_pept        781591..781944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6556"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein; KEGG: bcn:Bcen_1275
FT                   alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13286"
FT                   /protein_id="ABK13286.1"
FT                   /translation="MEAAMNAPACPQCAMENTYPDGALTVCADCGHEWSADAGAEAGDE
FT                   PAGDVVKDANGNVLSDGDSVVLIKDLRVKGSSITLKMGTKVKSIRLVGGDHEVDCKTDM
FT                   GGFMLKACYLKKV"
FT   gene            782012..782848
FT                   /locus_tag="Bcen2424_6557"
FT   CDS_pept        782012..782848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6557"
FT                   /product="spermidine synthase-like protein"
FT                   /note="KEGG: bcn:Bcen_1274 spermidine synthase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13287"
FT                   /protein_id="ABK13287.1"
FT                   /translation="MAEDRTSYDAFVRFLATPLNDGRPFVLETQHAVSLHFDHFGTQSF
FT                   MSLRDPVRLALGYTRVMMGFLLLQAEPAHICMLGLGGGSLAKYCYRHLPGTTLDAVEIN
FT                   PDVIALRDVFRIPADDARFRVVCADGADHLERADVRTDVILHDAFVADGRRGRCTGGTF
FT                   LDMCRARLSESGVLAINFMDDDPALPEHLEQLRSVFGSSYALVPCGDDNNFVAFAWKDG
FT                   SRLPSLRILLERTLACPQAGELKLAATARRMKHGEGIDPRRLVWRAQSHERWEIGA"
FT   gene            complement(782914..783099)
FT                   /locus_tag="Bcen2424_6558"
FT   CDS_pept        complement(782914..783099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6558"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: bcn:Bcen_1273 CopG-like DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13288"
FT                   /protein_id="ABK13288.1"
FT                   /translation="METKTARLTVLIDPAKKEAFEMLCAEQDLTPSQVVRQLIREYLDR
FT                   HGVTYKTRSAIGKRVK"
FT   gene            complement(783196..783954)
FT                   /locus_tag="Bcen2424_6559"
FT   CDS_pept        complement(783196..783954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6559"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bcn:Bcen_1272 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13289"
FT                   /protein_id="ABK13289.1"
FT                   /translation="MPAQYFRNLTGKHRSATANRQLGFSLAFVAGAANAGGFLAVKQYT
FT                   SHMSGIVSAIADQTALGDVRLALAGISSLGSFLIGASCSAILVNWGRRRGLHSQFMLPL
FT                   LVEAGLLLLFGLLGSHLALWETFFVPVTVTLLCFIMGLQNATITKLSGAEIRTTHVTGI
FT                   VTDLGIELGKLFYWNRSAIDVDAHAVIANRSKLRIHATMLASFFVGGLAGAIGFKHVGY
FT                   VSTVPLAAVLVTLAIVPVIDDLLALLRSQR"
FT   sig_peptide     complement(783847..783954)
FT                   /locus_tag="Bcen2424_6559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.944 at
FT                   residue 36"
FT   gene            784128..784547
FT                   /locus_tag="Bcen2424_6560"
FT   CDS_pept        784128..784547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13290"
FT                   /protein_id="ABK13290.1"
FT                   /translation="MRRRPAVSPLRGARLRSPSAHRFMTPIKFILRYTAIPFTAIVAVV
FT                   IWTVIPSSKEIDARQYAALSRAYASFPLPFRREISDTMAHGTINDRRYQVLVRDSLGNG
FT                   VALDWPASGVGGVADERQKLAELIQADSDLQRQRQ"
FT   gene            784544..784756
FT                   /locus_tag="Bcen2424_6561"
FT   CDS_pept        784544..784756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13291"
FT                   /protein_id="ABK13291.1"
FT                   /translation="MKTLLVSVAFAMIIASLIFALYFMNHDRGKSKRMAWSLAARVGLS
FT                   VTLFLSLLIAYKLGWIEPTGLPIGR"
FT   sig_peptide     784544..784606
FT                   /locus_tag="Bcen2424_6561"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.890 at
FT                   residue 21"
FT   gene            complement(784879..786558)
FT                   /locus_tag="Bcen2424_6562"
FT   CDS_pept        complement(784879..786558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6562"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: bcn:Bcen_1269 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13292"
FT                   /protein_id="ABK13292.1"
FT                   /translation="MSTPDTVARATTSSAAPLARIERLTIGFRGPRGTQAVVGPLDLAV
FT                   HAGECVALVGESGSGKSVTARSLVGLNGPHAVIDAARFEIAGIDARGHRERDWRAIRGR
FT                   RIGYVLQDALVSLDPLWRVRDLVAEALHDTRRRDVAARSADLLRSVGIDDPERRLPQYP
FT                   HQLSGGLRQRVLIGTAIAGGASLLIADEPTTALDMTVQRQILSLLRARRDAGDAILLIS
FT                   HDLAVVAELADRVLVMRAGQVVEQGSARDVLSAPTHPYTRALLAAIPTAASRGFRLATA
FT                   ERVPLPPKRIDAQAPVLAVDALTKRYGGRDAPPAVDGVSFSLARGETLGIVGESGSGKS
FT                   TVARIVLGLVEPDAGTVTLDGQPWNGIPEAARRTRRARLQLIAQDPYSSFDPRYSVGRI
FT                   IGEGLEVVGLHGDARRRRVLQLLDEVQLGAACLDRYPRELSGGQRQRVAIARAFASNPA
FT                   LLVADEPVSALDVSIQAQVLDLLADLQAEHGTAMLFISHDLGVVHHVADRILVMRRGRV
FT                   VESGPVTQVFDAPSHPYTASLLDALPTLPGGTATAPTLTALA"
FT   gene            complement(786555..787424)
FT                   /locus_tag="Bcen2424_6563"
FT   CDS_pept        complement(786555..787424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6563"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_1268
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13293"
FT                   /protein_id="ABK13293.1"
FT                   /translation="MSTPIDFTLRSPATFAAADWLRRHPGLALAAVYLLLNAIAVVAPG
FT                   WLAHYDPLAADPLSAQLGSSAEHWLGTDQLGRDIFSRVVYGARYSLSISAAAIGVATLF
FT                   GTALGLFAGLARGWLDELITRVLDVVSAFPDLLLALMLISFTGPGAVNLVFALGVASVP
FT                   RFARVVRAQTFVVAASGYVEHARTLGLAPAVLVWRHVLPHAIAQVPVLATIGLGTAIIG
FT                   TSGLSFLGMGPQPPAAEWGLMLAEGRNYLYNAWWIAVWPGLAITAAVIAVNALGGYWQA
FT                   RFEHREAA"
FT   gene            complement(787438..788448)
FT                   /locus_tag="Bcen2424_6564"
FT   CDS_pept        complement(787438..788448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6564"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_1267
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13294"
FT                   /protein_id="ABK13294.1"
FT                   /translation="MNRPSSAFVSVPDARPAAAPPAAWRRWLRSPIATRLATGALVLWA
FT                   AVTLSFAAVHLAPGDIVSILIGEQLSTPEIEAAIRQEWGLDEPLALQYVHYLWRVLHGE
FT                   FGRSYILNTDVAPLVLGQLWPTLKLTGAALVVTIVFAVGLAVLTAGRRWAGRAASGVEL
FT                   LLASTPSFWLGIMLLFVFSFTLKLFPVAGDRGFASLVLPALSLGLAQGAVIGRVLRQGI
FT                   ERALDEPYALTVRSWGIGGLALRVRHALRHAALPAVTLAGWLVGGLLSGAVITEQVFGR
FT                   PGLGKVTVDAVLSKDMPVILAIAILSAAIYVTLSTAVDLLYLLIDPRLRDRRAAR"
FT   gene            complement(788510..790150)
FT                   /locus_tag="Bcen2424_6565"
FT   CDS_pept        complement(788510..790150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6565"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: bcn:Bcen_1266 extracellular solute-binding
FT                   protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13295"
FT                   /protein_id="ABK13295.1"
FT                   /translation="MTFAFPDSALRASRRTVSVALLLALALPHAAFAQGAPVAGGTLTW
FT                   GVETEPRTLNPQLNGQDKVELLLRNAYESLLAQKPDGSYVPWLATGYKVSADGKTYTFT
FT                   LRDGVKFTDGAPFDAKAVARNFLNARELSYAAGSQLARLISHVADVKTPDEHTVVITLD
FT                   APYAPFLTFAGRLPLLSPNAFDRPGLKSGGPDIAGTGPFILRRYVKGQEIEFAKNPDYR
FT                   WAPPTAGHQGPAYLDRVVYRFLPESSVRTGALLSGQVDVIEGVSGNDAALIRKNADFTY
FT                   RRALNTGTPYSLFLNVGYGPTQDVKVRRALLEGLDTTGIVQSIYRGERTRAWGITSPID
FT                   PFYDASIEKTYGNNPKLANQLLDEAGWSARDSGGFRTKNGERLTIAVVQAQATVRDQRD
FT                   VLLQALQAQARQRLGVDLKIQYVDDGTYVEARKSGKFGSIANSNTPPDGIDIEGHYLPV
FT                   DRGGALNYSRAAAPELTRWLQAAARTQNVAERRKLYGELQHFAINEQAYALPLYEPEDQ
FT                   IAAAKAVQGLRFRSFAQMPENPYDVWVKK"
FT   sig_peptide     complement(790049..790150)
FT                   /locus_tag="Bcen2424_6565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 34"
FT   gene            complement(790228..790803)
FT                   /locus_tag="Bcen2424_6566"
FT   CDS_pept        complement(790228..790803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6566"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_1265 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13296"
FT                   /protein_id="ABK13296.1"
FT                   /translation="MTDTIRIAGADDVPAVYALLQDAYAPLAAQGVHFTITRSPIERVA
FT                   QTVARETTFVLEHATPDGRTALAATLTVRFPWVPGERHRTPYPFLHWFAVAPAFKRQGF
FT                   GHALIAHVETQFLASQVKAPATYLATATNHPWLQSYYERSGYQPFDRSTNALGTPLVWL
FT                   RKILIPDLYPGAAADDTARDHERIHANA"
FT   gene            complement(790800..791969)
FT                   /locus_tag="Bcen2424_6567"
FT   CDS_pept        complement(790800..791969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6567"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: bcn:Bcen_1264
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13297"
FT                   /protein_id="ABK13297.1"
FT                   /translation="MTFDALRSHFDLSALSALPFRLSVLDKSPVAPGETAADALARSVS
FT                   LARFADAAGYHRYWLAEHHNTAALACPSPEIVIAHVLAHTRRIRVGSGGVMLQHYSPYK
FT                   IAENFNLLASLAPGRVDLGIGKAPGGLPLSTRALQAGYDPARRASFADLADELNRHLKG
FT                   DDATADAAGQDGGATLHATPRPPVPAQPFLLGASAESATLAARLGWAFVYASHLNASAT
FT                   DLERTFDTYREASGGRTPLLAVSAIVADTRDAAAQLASGHQGFRVQVGDTPAVNVGSLE
FT                   QAHAYIRQAGGGPHRIEPRETRIVHGTRDDVLRELDALHRRHGIAEFVVDTPVADAAPR
FT                   IASLRLLAGVPADDDHDTAAARGTLGGSNARAPHARTTTHQPDFEGTAP"
FT   gene            792018..792305
FT                   /locus_tag="Bcen2424_6568"
FT   CDS_pept        792018..792305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13298"
FT                   /protein_id="ABK13298.1"
FT                   /translation="MPNYFASTFARSNNQEEYRKPKIFVPAARGACAMVVGCAPRGACV
FT                   EPARRSGARTLAVALFAGTLRFSDRTESRGMRMNQQRERRKALTATGAAS"
FT   gene            792302..793609
FT                   /locus_tag="Bcen2424_6569"
FT   CDS_pept        792302..793609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6569"
FT                   /product="putative monooxygenase"
FT                   /note="KEGG: bcn:Bcen_1263 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13299"
FT                   /protein_id="ABK13299.1"
FT                   /translation="MSGARRRLKTLVGAASVLYAPGDADVAQGVRRAASLARKAEAEKI
FT                   TGLFTADLLQADAAGLAGTTGSQEPIVALAALSQATSAIGLVATVSTTYHHPYNLARLI
FT                   GTLDHVSGGRAAWNAVTSSVGEENFGDAALPDPEQRYARAAEFVEVVNALFDANDPRAT
FT                   RRGPGGGISVDPLKLGAIDYRGAHFQVQGPLNVPPSPQRRPVLFQAGQSASGVALGARY
FT                   AEVVYTSQPTLDDARLFVAELHRQAAAFGRGDRPPLVMNSFHSVIGESDADVARRLRDK
FT                   HERIDYEQGRLKLADMLGGGVDLSGLPLDQPLPSSLLPAIDSVHRRRGRVAIFVGYARQ
FT                   RLTLRELIIRAQETGHWFVAGTPEQLADAIETRYRAGLVDVLSLHGLGQPDQEDLLLNG
FT                   LLPELRRRDLLDTDYVGGDFRANLELPALRREAVAA"
FT   sig_peptide     792302..792376
FT                   /locus_tag="Bcen2424_6569"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.638 at
FT                   residue 25"
FT   gene            793778..794590
FT                   /locus_tag="Bcen2424_6570"
FT   CDS_pept        793778..794590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6570"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_1262 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13300"
FT                   /protein_id="ABK13300.1"
FT                   /translation="MRHMNRLMRSRVRRVAAALFVLGLAPVSHAAQPTLRVGIDAESYP
FT                   PFFSKDAGGKWKGWEIDVLDAACGKLNVRCELTDIAWDGLIPALQNRKIDVIWSSMTIT
FT                   GERQKAIDFSRAYYESPTVFVGAKSDRRRVDCAVPTTFKGSVIGVEAGTNFSAFLDARF
FT                   KQDAQIKAFDKFDNALADLVSGRVDYVQEGKGLFTAFLASRDGKDFEVKATCADNPVLG
FT                   LGIGAGVRHGDALRGKLSTAIAQLQQDGTWDAITARYPNLKGTIEKGR"
FT   sig_peptide     793778..793870
FT                   /locus_tag="Bcen2424_6570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            794595..795329
FT                   /locus_tag="Bcen2424_6571"
FT   CDS_pept        794595..795329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6571"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_1261 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13301"
FT                   /protein_id="ABK13301.1"
FT                   /translation="MAADDSLLALLAFGDGGYGRVFAGAFALTFGVAAASFCTGVLLGI
FT                   AGALGKLSRYAAFVWLARLYTMLVRALPELLCLLLAFYAVAPAIENALHGSGIVSGDFA
FT                   FDPFVVAALSLGFIQGAYLTDIFRAALANVPVGQIEAAHAYGMTPWQTFTRIRLPAAAR
FT                   LALPGVGNVWLNATKDASFISVLGSFTDLLKASQLAAGATRHYVFFYLVTAALFLLLSI
FT                   TSTGIFAALERHANRGTRRATT"
FT   gene            795428..796093
FT                   /locus_tag="Bcen2424_6572"
FT   CDS_pept        795428..796093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6572"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bcn:Bcen_1260 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13302"
FT                   /protein_id="ABK13302.1"
FT                   /translation="MLLGVPLALAAGARHTPLRWSARGWLMLIRGTPLLVQLYLLYYGF
FT                   GQIVPREWMRDSWASPLLRDAFWYAIVALSVNESAYVATILRGAIAGVPAGEIEAGHAY
FT                   GMTRTQVLRRIVGPRAWRLALPALTGEAILLLKSTVLASTVTVFDVMGTANTLRFETLR
FT                   VYEPLAGAAIVYVVLVALLTIPAARLEQRINRYLTRQPDERVPARRRRASSGAWAAPN"
FT   gene            796120..797502
FT                   /locus_tag="Bcen2424_6573"
FT   CDS_pept        796120..797502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6573"
FT                   /product="coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases-like protein"
FT                   /note="KEGG: bcn:Bcen_1259 coenzyme F420-dependent N5
FT                   N10-methylene tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13303"
FT                   /protein_id="ABK13303.1"
FT                   /translation="MSDPRPLLFSLYEQASVGCGGAPSLWTHPADERLRANTLAFWSNL
FT                   ARTAEQAELDMLFFADVLGLYDVYGGSADAAVQWAVEAPANDPMMLIPALVAQTERLAF
FT                   GVTASTTYEHPFALARRFSTLDHLSNGRIGWNIVTSYLTSAARNFGLDQMIGHDERYAR
FT                   AEEFLDVVYKLWEGSWADDAVVADKHAPRYARGERVRPIAHEGAHYRVQGPHVCAPSPQ
FT                   RSPVLIQAGWSGRGRAFAAKHAEVVFVAKSNPHEIRTGLDEIRRLAAERGRAADDVKSL
FT                   TVLRIVTARSSSDAKEKYHSLQQHYHQHAQLVSYAGDTGIDIDRYADDEPLTTQTEGLT
FT                   SYVVRPDGSGKPLTAGDVRRKFASVTRGTDLILVGAPDEVADQLAEHARQSTTSGYMLN
FT                   PLISPGTLDDFAELIVPELKKRGLYRTSPAGGTFRSRLGGGDRLPDTAYGASFRFPVPE
FT                   AV"
FT   gene            797605..799167
FT                   /locus_tag="Bcen2424_6574"
FT   CDS_pept        797605..799167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6574"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_1258 ABC transporter related; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13304"
FT                   /protein_id="ABK13304.1"
FT                   /translation="MNSATNETMEATRREARPHRSASPPVLSVTGIAKRFDATVALAAL
FT                   DLSIGAGEVVALMGANGAGKSTFVKILSGALQADGGTLTLRGEPYRPASPHAAKRLGVA
FT                   TVHQSVADAVVPTLSIADNLLLDRLCDPASPWRAPPAARRAAARSLAARVGLDADLAAP
FT                   LASLSLADQQRVTLARALAGQPSLLILDEPTASLSAAEAERLFELVDALRRDGVAILLV
FT                   SHRLGDLRRIADRAAIVRDGRIVADLAAPIDFDAAVETMIGRPLPRTRAVAPERVAPAE
FT                   SGPGSGFSVRQIRLTPTSTPFDLDVRRGEIVAIAGPVGGGKSRFARTIFGAVRAAGGEM
FT                   TLDGRPWRPRTPADAIRAGVFLAGEDRWRTSLFPDSVPFASIAGTIGFPFLARWFVSGA
FT                   VRRTRERTAAAAAIARFGIRCEGPDDRVAHLSGGNQQKVVLARWHAEPARLLLLDEPFQ
FT                   GIDAGARADIVDTLRRHAHERTTIVFVSDLEEAAEIADRIVRFDRATLDGLSPTSSIVG
FT                   ACS"
FT   gene            799164..800225
FT                   /locus_tag="Bcen2424_6575"
FT   CDS_pept        799164..800225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6575"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcn:Bcen_1257 inner-membrane translocator; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13305"
FT                   /protein_id="ABK13305.1"
FT                   /translation="MKPVTSSSAVRQAASVERSSRRGPARIRDALERTGILLVLAVLVV
FT                   VFALREPAFLNLDNLFSILQAVSIVALLGIGVTVTLAAGGFDLSVGSVAATAQMAASYV
FT                   LVVWHGSAWAAVFACVVLGVAAGLFNGLLITRLRVPDQLATLGTLFLLAGLQLIPTGGR
FT                   SLATGSVLPDGTDATGVFPDAFLALGRLRVFDVVPLPVLLLAAVTVLACVTMEATRWGR
FT                   VIYAIGGNETAARLAGAPAARYRIAAYVVSGAIASLGGVLIAARVGRGDVSAGHSLLLD
FT                   AVAAALIGYAVWGAKRPNVFGTVVGAVFVGVLLNGLTMLNAPYYMQDFIKGVLLVLALA
FT                   FTFGIGRRADARA"
FT   gene            800392..801462
FT                   /locus_tag="Bcen2424_6576"
FT   CDS_pept        800392..801462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6576"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bcn:Bcen_1256 periplasmic
FT                   binding protein/LacI transcriptional regulator; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13306"
FT                   /protein_id="ABK13306.1"
FT                   /translation="MRSLLRRKSRLEPKLGALVLGAALALGMPAAHAGPLKGAPAPFDK
FT                   GGVKIALVNYLSTGDFFQAYEAGAQKQARALGVDLRIYEGRQDAAEQREQIQQAISIGV
FT                   SAIIVNHGLPESLKDVVQRALDKGIKVVAFDVDLANPKVPQIEQNDRDLANLLLDQAVK
FT                   DNGDAFSAGYVYVAGFAPLDRRDAAWRDFKRAHPKVQEKARWGTVDNPIAQSVANQAAA
FT                   AYRANPDIRVVFAPYDEFARGAKLAADEARLSSKIRIYSADVSTADIAAIRAPNSAWVA
FT                   TAATNPAVVGAVSVRAAALLVAGQNPGARIAVKPTLITRDDLVKNDIHTVAELGAKFPA
FT                   FRASDAATAAWIPALD"
FT   sig_peptide     800392..800493
FT                   /locus_tag="Bcen2424_6576"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            801523..802053
FT                   /locus_tag="Bcen2424_6577"
FT   CDS_pept        801523..802053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6577"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcn:Bcen_1255
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13307"
FT                   /protein_id="ABK13307.1"
FT                   /translation="MTTLNDYLAQKRDAWHAKQQAARNDPDFKATPLKATVRALGRSGV
FT                   REIRIRDFQVISDSPPDFAGYNLGPASPELQLGVLGSCLTHITLIQAAERGLKIDAIEV
FT                   EVTGDQHPLAQQPGFEHVPVFPHNLRYTLDIVSPEPPEAIRALHQAVEEVCPIFNLLRL
FT                   PQHIDGELRHTSA"
FT   gene            complement(802197..803123)
FT                   /locus_tag="Bcen2424_6578"
FT   CDS_pept        complement(802197..803123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6578"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcn:Bcen_1254 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13308"
FT                   /protein_id="ABK13308.1"
FT                   /translation="MRVDPLSEVLSLLETRDSFFTGLRAGGPWAVDLPPPDGIKFNAVV
FT                   EGSCWLTVDGAGPPVRLRTGDCFLLAAPRAFSLASDPSVAPVPAADVYRHLERGIAHYG
FT                   EPADCFLIGGRFAYEERMPLLLGSLPPVVIVSGDSEPAAVLRWSLQQLAREFGASSPGG
FT                   SLMVRHLGHMMLVQILRRYVDAGANGDVGWLAGFADARVSAALAAIHAAPERRWTVDAL
FT                   AACCHVSRSTFALHFKQRLGFGPLEYVLRWRIQLAMRELRRSNASISAIAQRLGYDSDS
FT                   AFGHAFKRIVGCSPRAYRHDVTKEPGN"
FT   gene            803257..804222
FT                   /locus_tag="Bcen2424_6579"
FT   CDS_pept        803257..804222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6579"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcn:Bcen_1253 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13309"
FT                   /protein_id="ABK13309.1"
FT                   /translation="MTSRQHPLHSGFDAASTASDVLAGLDLHGKTAIVTGGHSGLGLET
FT                   TRALAQAGAHVVVGARSAAAAREATRGIAGVEVAPLELADAASVAAFAARFVDAGRHVH
FT                   IVINSAGIMACPETRLGDGREAQLAVNHLGHYALVNRLWPVLAHGDGARVVAVSSLGHR
FT                   LSPIRWDDIDFARGYDKWLAYGQSKTANALFAVQLDMLGAPFGVRAYSLHPGKIATPLQ
FT                   RHLTREEMMAQGWVDEHGVPIDPTFKTPAQGAATQVWAATSPRLADLGGVYCEDCDVAA
FT                   VTRGNEESGVRPHAIDPEEAARLWAWSAAATGVDAFAARG"
FT   gene            complement(804292..805596)
FT                   /locus_tag="Bcen2424_6580"
FT   CDS_pept        complement(804292..805596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6580"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: bcn:Bcen_1252
FT                   HipA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13310"
FT                   /protein_id="ABK13310.1"
FT                   /translation="MAARTLIASANGVRMGTLTDDKGIWSFAYDPQWLASPVAYPLSPA
FT                   FPLRAGVFTDTSTDRPVQWFFDNLLPEEGMRTSLAREAKVDAADAWGLLAYFGRESAGA
FT                   LTLLADGEQETPGGLQPLPLDELERRIQAMPERALTATAPKRMSAAGAQQKLLLVLRGD
FT                   APDYALLEPVGSEPSMHLLKPDMRAAGYPHSAINEFFCMQLAKKMGLDVPDVHFLRAPS
FT                   ACYVIDRFDRDVASEPAARVHTIDAMQLLNYDRGFKYQRANAQELARAIERTSTRALTR
FT                   LSVFRWTVFNVVVGNADAHLKNLSFFVDARGYRLAPFYDIVSTVVYHTPTHRPDHRGDH
FT                   WPHCELTMPLGNATRFVDIDANALVAFGQALGLRDKAAASELQRFLEPLDRHVEQTLDE
FT                   VRNIAHPDAGEMRLLNSIVAMPIAEMGRALRQARG"
FT   gene            complement(805586..805870)
FT                   /locus_tag="Bcen2424_6581"
FT   CDS_pept        complement(805586..805870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6581"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bcn:Bcen_1251 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13311"
FT                   /protein_id="ABK13311.1"
FT                   /translation="MSESQSVDTIGALAHFIRAARIQQGFTRDELANATGLSPKFISQV
FT                   EAGKPTAQIGKVMLLLGELGVRLYAESSIEISEATALKAAQRRRSSHGG"
FT   gene            806540..807019
FT                   /locus_tag="Bcen2424_6582"
FT   CDS_pept        806540..807019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6582"
FT                   /product="MgtC/SapB transporter"
FT                   /note="KEGG: nha:Nham_0456 MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13312"
FT                   /protein_id="ABK13312.1"
FT                   /translation="MLQVNALLLQAGKPEGAFSVLDLMRLPLGILTGMGFIGGGAILHR
FT                   DGLVSGVTTAATLWCVTVIGLCIGGGQLSLGALGLALALLVVWPLRFVERRLAGVRTAL
FT                   VTVEYPLGSAAREQLAAKLRDAGFTCRTKSFCETAARAVREEELFGSGAKRPAPT"
FT   gene            807162..807587
FT                   /locus_tag="Bcen2424_6583"
FT   CDS_pept        807162..807587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6583"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bcn:Bcen_1249 CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13313"
FT                   /protein_id="ABK13313.1"
FT                   /translation="MTCVSEVMTRDAATIGPTQSLREAARLMSDLNVGALPVCDGTRLI
FT                   GMLTDRDIVVRAVSMGVPPDEAVEGVVSGPANWCYEDDDISAVQKKMENAQIRRVPVVD
FT                   RQKRLVGIVALGDLATAADGAMSSTLGAVSAPSRPDR"
FT   gene            807593..807886
FT                   /locus_tag="Bcen2424_6584"
FT   CDS_pept        807593..807886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13314"
FT                   /protein_id="ABK13314.1"
FT                   /translation="MADTENDMNEDRETQIRERAYRLWQADGAPDGRADEYWQRAEQQL
FT                   DAEGSIAVDERAGQTEEVPADQSAKRRIPGEPLQDTDAIPTDEVAHERRRTR"
FT   gene            808602..808883
FT                   /locus_tag="Bcen2424_6585"
FT   CDS_pept        808602..808883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13315"
FT                   /protein_id="ABK13315.1"
FT                   /translation="MTQDSQRQDPASPDAARETADTPERRNPTRGGESTARPGHAPGGG
FT                   ELDSIPDDQARKVVPDDSRQTEVHDPAGKPWPDEHDAPDDSGNRPRPL"
FT   gene            808956..809963
FT                   /locus_tag="Bcen2424_6586"
FT   CDS_pept        808956..809963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen2424_6586"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   Insect alcohol dehydrogenase family; KEGG: bcn:Bcen_1246
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen2424_6586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13316"
FT                   /protein_id="ABK13316.1"
FT                   /translation="MSSDEVSESRRKWVQGTTAGLVASVALPTLAQTGGGAPDAGDTAP
FT                   RDPRTLYPHAPFPQQQQPWPGLAGRMTPRPDHGERSYRGSGRLDGRKALITGGDSGIGR
FT                   AVAIACAREGADVAIVYLPDEEPDAREVVDQIRGAGRKAVPLPVDIRSEGACNGLVERA
FT                   VAALGGLDILVNNAGRQQSHESILDISTEQFDWTLRTNLYAMFWITRAAIPHMPPGSAI
FT                   VNTTSVNAYDPSANLLDYAMTKAAIANFTKGLAKQMIKRGIRVNGVAPGPFWTPLQVSG
FT                   GQTTHNVETFGEQVPMGRPGQPAEIASIYVELLSSRSSYVTGQIYGASGGAGQP"
FT   sig_peptide     808956..809051
FT                   /locus_tag="Bcen242