(data stored in ACNUC7421 zone)

EMBL: CP000462

ID   CP000462; SV 1; circular; genomic DNA; STD; PRO; 4744448 BP.
XX
AC   CP000462;
XX
PR   Project:PRJNA16697;
XX
DT   07-NOV-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome.
XX
KW   .
XX
OS   Aeromonas hydrophila subsp. hydrophila ATCC 7966
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales;
OC   Aeromonadaceae; Aeromonas.
XX
RN   [1]
RP   1-4744448
RX   DOI; 10.1128/JB.00621-06.
RX   PUBMED; 16980456.
RA   Seshadri R., Joseph S.W., Chopra A.K., Sha J., Shaw J., Graf J., Haft D.,
RA   Wu M., Ren Q., Rosovitz M.J., Madupu R., Tallon L., Kim M., Jin S.,
RA   Vuong H., Stine O.C., Ali A., Horneman A.J., Heidelberg J.F.;
RT   "Genome sequence of Aeromonas hydrophila ATCC 7966T: jack of all trades";
RL   J. Bacteriol. 188(23):8272-8282(2006).
XX
RN   [2]
RP   1-4744448
RA   Seshadri R., Joseph S.W., Chopra A.K., Shaw J., Graf J., Haft D., Wu M.,
RA   Rosovitz M., Madupu R., Tallon L., Kim M., Jin S., Vuong H., Stine O.C.,
RA   Ali A., Horneman A.J., Heidelberg J.F.;
RT   ;
RL   Submitted (06-SEP-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr., Rockville, MD
RL   20850, USA
XX
DR   MD5; d36c02a7ee7adb9625241c4d1219cbfb.
DR   BioSample; SAMN02604052.
DR   EnsemblGenomes-Gn; AHA_0024.
DR   EnsemblGenomes-Gn; AHA_0025.
DR   EnsemblGenomes-Gn; AHA_0026.
DR   EnsemblGenomes-Gn; AHA_0027.
DR   EnsemblGenomes-Gn; AHA_0077.
DR   EnsemblGenomes-Gn; AHA_0078.
DR   EnsemblGenomes-Gn; AHA_0079.
DR   EnsemblGenomes-Gn; AHA_0080.
DR   EnsemblGenomes-Gn; AHA_0081.
DR   EnsemblGenomes-Gn; AHA_0145.
DR   EnsemblGenomes-Gn; AHA_0146.
DR   EnsemblGenomes-Gn; AHA_0147.
DR   EnsemblGenomes-Gn; AHA_0148.
DR   EnsemblGenomes-Gn; AHA_0198.
DR   EnsemblGenomes-Gn; AHA_0199.
DR   EnsemblGenomes-Gn; AHA_0200.
DR   EnsemblGenomes-Gn; AHA_0201.
DR   EnsemblGenomes-Gn; AHA_0202.
DR   EnsemblGenomes-Gn; AHA_0203.
DR   EnsemblGenomes-Gn; AHA_0335.
DR   EnsemblGenomes-Gn; AHA_0336.
DR   EnsemblGenomes-Gn; AHA_0337.
DR   EnsemblGenomes-Gn; AHA_0338.
DR   EnsemblGenomes-Gn; AHA_0339.
DR   EnsemblGenomes-Gn; AHA_0752.
DR   EnsemblGenomes-Gn; AHA_0753.
DR   EnsemblGenomes-Gn; AHA_0754.
DR   EnsemblGenomes-Gn; AHA_0755.
DR   EnsemblGenomes-Gn; AHA_0756.
DR   EnsemblGenomes-Gn; AHA_0836.
DR   EnsemblGenomes-Gn; AHA_0865.
DR   EnsemblGenomes-Gn; AHA_0866.
DR   EnsemblGenomes-Gn; AHA_0867.
DR   EnsemblGenomes-Gn; AHA_0868.
DR   EnsemblGenomes-Gn; AHA_1026.
DR   EnsemblGenomes-Gn; AHA_1027.
DR   EnsemblGenomes-Gn; AHA_1028.
DR   EnsemblGenomes-Gn; AHA_1088.
DR   EnsemblGenomes-Gn; AHA_1116.
DR   EnsemblGenomes-Gn; AHA_1319.
DR   EnsemblGenomes-Gn; AHA_1343.
DR   EnsemblGenomes-Gn; AHA_1555.
DR   EnsemblGenomes-Gn; AHA_1556.
DR   EnsemblGenomes-Gn; AHA_1785.
DR   EnsemblGenomes-Gn; AHA_1825.
DR   EnsemblGenomes-Gn; AHA_1851.
DR   EnsemblGenomes-Gn; AHA_1852.
DR   EnsemblGenomes-Gn; AHA_1853.
DR   EnsemblGenomes-Gn; AHA_2108.
DR   EnsemblGenomes-Gn; AHA_2109.
DR   EnsemblGenomes-Gn; AHA_2110.
DR   EnsemblGenomes-Gn; AHA_2111.
DR   EnsemblGenomes-Gn; AHA_2112.
DR   EnsemblGenomes-Gn; AHA_2113.
DR   EnsemblGenomes-Gn; AHA_2387.
DR   EnsemblGenomes-Gn; AHA_2388.
DR   EnsemblGenomes-Gn; AHA_2389.
DR   EnsemblGenomes-Gn; AHA_2390.
DR   EnsemblGenomes-Gn; AHA_2391.
DR   EnsemblGenomes-Gn; AHA_2392.
DR   EnsemblGenomes-Gn; AHA_2393.
DR   EnsemblGenomes-Gn; AHA_2394.
DR   EnsemblGenomes-Gn; AHA_2449.
DR   EnsemblGenomes-Gn; AHA_2507.
DR   EnsemblGenomes-Gn; AHA_2539.
DR   EnsemblGenomes-Gn; AHA_2541.
DR   EnsemblGenomes-Gn; AHA_2542.
DR   EnsemblGenomes-Gn; AHA_2603.
DR   EnsemblGenomes-Gn; AHA_2673.
DR   EnsemblGenomes-Gn; AHA_2769.
DR   EnsemblGenomes-Gn; AHA_2770.
DR   EnsemblGenomes-Gn; AHA_2771.
DR   EnsemblGenomes-Gn; AHA_2815.
DR   EnsemblGenomes-Gn; AHA_3027.
DR   EnsemblGenomes-Gn; AHA_3028.
DR   EnsemblGenomes-Gn; AHA_3090.
DR   EnsemblGenomes-Gn; AHA_3091.
DR   EnsemblGenomes-Gn; AHA_3153.
DR   EnsemblGenomes-Gn; AHA_3158.
DR   EnsemblGenomes-Gn; AHA_3159.
DR   EnsemblGenomes-Gn; AHA_3160.
DR   EnsemblGenomes-Gn; AHA_3161.
DR   EnsemblGenomes-Gn; AHA_3162.
DR   EnsemblGenomes-Gn; AHA_3163.
DR   EnsemblGenomes-Gn; AHA_3164.
DR   EnsemblGenomes-Gn; AHA_3165.
DR   EnsemblGenomes-Gn; AHA_3306.
DR   EnsemblGenomes-Gn; AHA_3307.
DR   EnsemblGenomes-Gn; AHA_3442.
DR   EnsemblGenomes-Gn; AHA_3443.
DR   EnsemblGenomes-Gn; AHA_3444.
DR   EnsemblGenomes-Gn; AHA_3445.
DR   EnsemblGenomes-Gn; AHA_3446.
DR   EnsemblGenomes-Gn; AHA_3451.
DR   EnsemblGenomes-Gn; AHA_3452.
DR   EnsemblGenomes-Gn; AHA_3453.
DR   EnsemblGenomes-Gn; AHA_3454.
DR   EnsemblGenomes-Gn; AHA_3455.
DR   EnsemblGenomes-Gn; AHA_3456.
DR   EnsemblGenomes-Gn; AHA_3457.
DR   EnsemblGenomes-Gn; AHA_3458.
DR   EnsemblGenomes-Gn; AHA_3472.
DR   EnsemblGenomes-Gn; AHA_3473.
DR   EnsemblGenomes-Gn; AHA_3513.
DR   EnsemblGenomes-Gn; AHA_3514.
DR   EnsemblGenomes-Gn; AHA_3515.
DR   EnsemblGenomes-Gn; AHA_3516.
DR   EnsemblGenomes-Gn; AHA_3622.
DR   EnsemblGenomes-Gn; AHA_3623.
DR   EnsemblGenomes-Gn; AHA_3624.
DR   EnsemblGenomes-Gn; AHA_3625.
DR   EnsemblGenomes-Gn; AHA_3626.
DR   EnsemblGenomes-Gn; AHA_3627.
DR   EnsemblGenomes-Gn; AHA_3628.
DR   EnsemblGenomes-Gn; AHA_3629.
DR   EnsemblGenomes-Gn; AHA_3630.
DR   EnsemblGenomes-Gn; AHA_3631.
DR   EnsemblGenomes-Gn; AHA_3632.
DR   EnsemblGenomes-Gn; AHA_3633.
DR   EnsemblGenomes-Gn; AHA_3634.
DR   EnsemblGenomes-Gn; AHA_3635.
DR   EnsemblGenomes-Gn; AHA_3696.
DR   EnsemblGenomes-Gn; AHA_3706.
DR   EnsemblGenomes-Gn; AHA_3707.
DR   EnsemblGenomes-Gn; AHA_3708.
DR   EnsemblGenomes-Gn; AHA_3709.
DR   EnsemblGenomes-Gn; AHA_3710.
DR   EnsemblGenomes-Gn; AHA_3711.
DR   EnsemblGenomes-Gn; AHA_3805.
DR   EnsemblGenomes-Gn; AHA_3806.
DR   EnsemblGenomes-Gn; AHA_3807.
DR   EnsemblGenomes-Gn; AHA_3808.
DR   EnsemblGenomes-Gn; AHA_3809.
DR   EnsemblGenomes-Gn; AHA_3842.
DR   EnsemblGenomes-Gn; AHA_3843.
DR   EnsemblGenomes-Gn; AHA_3844.
DR   EnsemblGenomes-Gn; AHA_3845.
DR   EnsemblGenomes-Gn; AHA_3940.
DR   EnsemblGenomes-Gn; AHA_3941.
DR   EnsemblGenomes-Gn; AHA_3942.
DR   EnsemblGenomes-Gn; AHA_3943.
DR   EnsemblGenomes-Gn; AHA_3944.
DR   EnsemblGenomes-Gn; AHA_4011.
DR   EnsemblGenomes-Gn; AHA_4012.
DR   EnsemblGenomes-Gn; AHA_4013.
DR   EnsemblGenomes-Gn; AHA_4014.
DR   EnsemblGenomes-Gn; AHA_4015.
DR   EnsemblGenomes-Gn; AHA_4016.
DR   EnsemblGenomes-Gn; AHA_4035.
DR   EnsemblGenomes-Gn; AHA_4037.
DR   EnsemblGenomes-Gn; AHA_4038.
DR   EnsemblGenomes-Gn; AHA_4085.
DR   EnsemblGenomes-Gn; AHA_4132.
DR   EnsemblGenomes-Gn; AHA_4242.
DR   EnsemblGenomes-Gn; AHA_4243.
DR   EnsemblGenomes-Gn; AHA_4244.
DR   EnsemblGenomes-Gn; AHA_4245.
DR   EnsemblGenomes-Gn; AHA_4246.
DR   EnsemblGenomes-Gn; EBG00001180761.
DR   EnsemblGenomes-Gn; EBG00001180762.
DR   EnsemblGenomes-Gn; EBG00001180763.
DR   EnsemblGenomes-Gn; EBG00001180764.
DR   EnsemblGenomes-Gn; EBG00001180765.
DR   EnsemblGenomes-Gn; EBG00001180766.
DR   EnsemblGenomes-Gn; EBG00001180767.
DR   EnsemblGenomes-Gn; EBG00001180768.
DR   EnsemblGenomes-Gn; EBG00001180769.
DR   EnsemblGenomes-Gn; EBG00001180770.
DR   EnsemblGenomes-Gn; EBG00001180771.
DR   EnsemblGenomes-Gn; EBG00001180772.
DR   EnsemblGenomes-Gn; EBG00001180773.
DR   EnsemblGenomes-Gn; EBG00001180774.
DR   EnsemblGenomes-Gn; EBG00001180775.
DR   EnsemblGenomes-Gn; EBG00001180776.
DR   EnsemblGenomes-Gn; EBG00001180777.
DR   EnsemblGenomes-Gn; EBG00001180778.
DR   EnsemblGenomes-Gn; EBG00001180779.
DR   EnsemblGenomes-Gn; EBG00001180780.
DR   EnsemblGenomes-Gn; EBG00001180781.
DR   EnsemblGenomes-Gn; EBG00001180782.
DR   EnsemblGenomes-Gn; EBG00001180783.
DR   EnsemblGenomes-Gn; EBG00001180784.
DR   EnsemblGenomes-Gn; EBG00001180785.
DR   EnsemblGenomes-Gn; EBG00001180786.
DR   EnsemblGenomes-Gn; EBG00001180787.
DR   EnsemblGenomes-Gn; EBG00001180788.
DR   EnsemblGenomes-Gn; EBG00001180789.
DR   EnsemblGenomes-Gn; EBG00001180790.
DR   EnsemblGenomes-Gn; EBG00001180791.
DR   EnsemblGenomes-Gn; EBG00001180792.
DR   EnsemblGenomes-Gn; EBG00001180793.
DR   EnsemblGenomes-Gn; EBG00001180794.
DR   EnsemblGenomes-Gn; EBG00001180795.
DR   EnsemblGenomes-Gn; EBG00001180796.
DR   EnsemblGenomes-Gn; EBG00001180797.
DR   EnsemblGenomes-Gn; EBG00001180798.
DR   EnsemblGenomes-Gn; EBG00001180799.
DR   EnsemblGenomes-Gn; EBG00001180800.
DR   EnsemblGenomes-Gn; EBG00001180801.
DR   EnsemblGenomes-Gn; EBG00001180802.
DR   EnsemblGenomes-Gn; EBG00001180803.
DR   EnsemblGenomes-Gn; EBG00001180804.
DR   EnsemblGenomes-Gn; EBG00001180805.
DR   EnsemblGenomes-Gn; EBG00001180806.
DR   EnsemblGenomes-Gn; EBG00001180807.
DR   EnsemblGenomes-Gn; EBG00001180808.
DR   EnsemblGenomes-Gn; EBG00001180809.
DR   EnsemblGenomes-Gn; EBG00001180810.
DR   EnsemblGenomes-Gn; EBG00001180811.
DR   EnsemblGenomes-Gn; EBG00001180812.
DR   EnsemblGenomes-Gn; EBG00001180813.
DR   EnsemblGenomes-Gn; EBG00001180814.
DR   EnsemblGenomes-Gn; EBG00001180815.
DR   EnsemblGenomes-Gn; EBG00001180816.
DR   EnsemblGenomes-Gn; EBG00001180817.
DR   EnsemblGenomes-Gn; EBG00001180818.
DR   EnsemblGenomes-Gn; EBG00001180819.
DR   EnsemblGenomes-Gn; EBG00001180820.
DR   EnsemblGenomes-Gn; EBG00001180821.
DR   EnsemblGenomes-Gn; EBG00001180822.
DR   EnsemblGenomes-Gn; EBG00001180823.
DR   EnsemblGenomes-Gn; EBG00001180824.
DR   EnsemblGenomes-Gn; EBG00001180825.
DR   EnsemblGenomes-Gn; EBG00001180826.
DR   EnsemblGenomes-Gn; EBG00001180827.
DR   EnsemblGenomes-Gn; EBG00001180828.
DR   EnsemblGenomes-Gn; EBG00001180829.
DR   EnsemblGenomes-Gn; EBG00001180830.
DR   EnsemblGenomes-Gn; EBG00001180831.
DR   EnsemblGenomes-Gn; EBG00001180832.
DR   EnsemblGenomes-Gn; EBG00001180833.
DR   EnsemblGenomes-Gn; EBG00001180834.
DR   EnsemblGenomes-Gn; EBG00001180835.
DR   EnsemblGenomes-Gn; EBG00001180836.
DR   EnsemblGenomes-Gn; EBG00001180837.
DR   EnsemblGenomes-Gn; EBG00001180838.
DR   EnsemblGenomes-Gn; EBG00001180839.
DR   EnsemblGenomes-Gn; EBG00001180840.
DR   EnsemblGenomes-Gn; EBG00001180841.
DR   EnsemblGenomes-Gn; EBG00001180842.
DR   EnsemblGenomes-Gn; EBG00001180843.
DR   EnsemblGenomes-Gn; EBG00001180844.
DR   EnsemblGenomes-Gn; EBG00001180845.
DR   EnsemblGenomes-Gn; EBG00001180846.
DR   EnsemblGenomes-Gn; EBG00001180847.
DR   EnsemblGenomes-Gn; EBG00001180848.
DR   EnsemblGenomes-Gn; EBG00001180849.
DR   EnsemblGenomes-Gn; EBG00001180850.
DR   EnsemblGenomes-Gn; EBG00001180851.
DR   EnsemblGenomes-Gn; EBG00001180852.
DR   EnsemblGenomes-Gn; EBG00001180853.
DR   EnsemblGenomes-Gn; EBG00001180854.
DR   EnsemblGenomes-Gn; EBG00001180855.
DR   EnsemblGenomes-Gn; EBG00001180856.
DR   EnsemblGenomes-Gn; EBG00001180857.
DR   EnsemblGenomes-Gn; EBG00001180858.
DR   EnsemblGenomes-Gn; EBG00001180859.
DR   EnsemblGenomes-Gn; EBG00001180860.
DR   EnsemblGenomes-Gn; EBG00001180861.
DR   EnsemblGenomes-Gn; EBG00001180862.
DR   EnsemblGenomes-Gn; EBG00001180863.
DR   EnsemblGenomes-Gn; EBG00001180864.
DR   EnsemblGenomes-Gn; EBG00001180865.
DR   EnsemblGenomes-Gn; EBG00001180866.
DR   EnsemblGenomes-Gn; EBG00001180867.
DR   EnsemblGenomes-Gn; EBG00001180868.
DR   EnsemblGenomes-Gn; EBG00001180869.
DR   EnsemblGenomes-Gn; EBG00001180870.
DR   EnsemblGenomes-Gn; EBG00001180871.
DR   EnsemblGenomes-Gn; EBG00001180872.
DR   EnsemblGenomes-Gn; EBG00001180873.
DR   EnsemblGenomes-Gn; EBG00001180874.
DR   EnsemblGenomes-Gn; EBG00001180875.
DR   EnsemblGenomes-Gn; EBG00001180876.
DR   EnsemblGenomes-Gn; EBG00001180877.
DR   EnsemblGenomes-Gn; EBG00001180878.
DR   EnsemblGenomes-Gn; EBG00001180879.
DR   EnsemblGenomes-Gn; EBG00001180880.
DR   EnsemblGenomes-Gn; EBG00001180881.
DR   EnsemblGenomes-Gn; EBG00001180882.
DR   EnsemblGenomes-Gn; EBG00001180883.
DR   EnsemblGenomes-Gn; EBG00001180884.
DR   EnsemblGenomes-Gn; EBG00001180885.
DR   EnsemblGenomes-Gn; EBG00001180886.
DR   EnsemblGenomes-Gn; EBG00001180887.
DR   EnsemblGenomes-Gn; EBG00001180888.
DR   EnsemblGenomes-Gn; EBG00001180889.
DR   EnsemblGenomes-Gn; EBG00001180890.
DR   EnsemblGenomes-Gn; EBG00001180891.
DR   EnsemblGenomes-Gn; EBG00001180892.
DR   EnsemblGenomes-Gn; EBG00001180893.
DR   EnsemblGenomes-Gn; EBG00001180894.
DR   EnsemblGenomes-Gn; EBG00001180895.
DR   EnsemblGenomes-Gn; EBG00001180896.
DR   EnsemblGenomes-Gn; EBG00001180897.
DR   EnsemblGenomes-Gn; EBG00001180898.
DR   EnsemblGenomes-Gn; EBG00001180899.
DR   EnsemblGenomes-Gn; EBG00001180900.
DR   EnsemblGenomes-Gn; EBG00001180901.
DR   EnsemblGenomes-Gn; EBG00001180902.
DR   EnsemblGenomes-Gn; EBG00001180903.
DR   EnsemblGenomes-Gn; EBG00001180904.
DR   EnsemblGenomes-Gn; EBG00001180905.
DR   EnsemblGenomes-Gn; EBG00001180906.
DR   EnsemblGenomes-Gn; EBG00001180907.
DR   EnsemblGenomes-Gn; EBG00001180908.
DR   EnsemblGenomes-Gn; EBG00001180909.
DR   EnsemblGenomes-Gn; EBG00001180910.
DR   EnsemblGenomes-Gn; EBG00001180911.
DR   EnsemblGenomes-Gn; EBG00001180912.
DR   EnsemblGenomes-Gn; EBG00001180913.
DR   EnsemblGenomes-Gn; EBG00001180914.
DR   EnsemblGenomes-Gn; EBG00001180915.
DR   EnsemblGenomes-Gn; EBG00001180916.
DR   EnsemblGenomes-Gn; EBG00001180917.
DR   EnsemblGenomes-Gn; EBG00001180918.
DR   EnsemblGenomes-Gn; EBG00001180919.
DR   EnsemblGenomes-Gn; EBG00001180920.
DR   EnsemblGenomes-Gn; EBG00001180921.
DR   EnsemblGenomes-Gn; EBG00001180922.
DR   EnsemblGenomes-Gn; EBG00001180923.
DR   EnsemblGenomes-Gn; EBG00001180924.
DR   EnsemblGenomes-Gn; EBG00001180925.
DR   EnsemblGenomes-Gn; EBG00001180926.
DR   EnsemblGenomes-Gn; EBG00001180927.
DR   EnsemblGenomes-Gn; EBG00001180928.
DR   EnsemblGenomes-Gn; EBG00001180929.
DR   EnsemblGenomes-Gn; EBG00001180930.
DR   EnsemblGenomes-Gn; EBG00001180931.
DR   EnsemblGenomes-Gn; EBG00001180932.
DR   EnsemblGenomes-Gn; EBG00001180933.
DR   EnsemblGenomes-Gn; EBG00001180934.
DR   EnsemblGenomes-Gn; EBG00001180935.
DR   EnsemblGenomes-Gn; EBG00001180936.
DR   EnsemblGenomes-Gn; EBG00001180937.
DR   EnsemblGenomes-Gn; EBG00001180938.
DR   EnsemblGenomes-Gn; EBG00001180939.
DR   EnsemblGenomes-Gn; EBG00001180940.
DR   EnsemblGenomes-Gn; EBG00001180941.
DR   EnsemblGenomes-Gn; EBG00001180942.
DR   EnsemblGenomes-Gn; EBG00001180943.
DR   EnsemblGenomes-Gn; EBG00001180944.
DR   EnsemblGenomes-Gn; EBG00001180945.
DR   EnsemblGenomes-Gn; EBG00001180946.
DR   EnsemblGenomes-Gn; EBG00001180947.
DR   EnsemblGenomes-Gn; EBG00001180948.
DR   EnsemblGenomes-Gn; EBG00001180949.
DR   EnsemblGenomes-Gn; EBG00001180950.
DR   EnsemblGenomes-Gn; EBG00001180951.
DR   EnsemblGenomes-Gn; EBG00001180952.
DR   EnsemblGenomes-Gn; EBG00001180953.
DR   EnsemblGenomes-Tr; AHA_0024-1.
DR   EnsemblGenomes-Tr; AHA_0025-1.
DR   EnsemblGenomes-Tr; AHA_0026-1.
DR   EnsemblGenomes-Tr; AHA_0027-1.
DR   EnsemblGenomes-Tr; AHA_0077-1.
DR   EnsemblGenomes-Tr; AHA_0078-1.
DR   EnsemblGenomes-Tr; AHA_0079-1.
DR   EnsemblGenomes-Tr; AHA_0080-1.
DR   EnsemblGenomes-Tr; AHA_0081-1.
DR   EnsemblGenomes-Tr; AHA_0145-1.
DR   EnsemblGenomes-Tr; AHA_0146-1.
DR   EnsemblGenomes-Tr; AHA_0147-1.
DR   EnsemblGenomes-Tr; AHA_0148-1.
DR   EnsemblGenomes-Tr; AHA_0198-1.
DR   EnsemblGenomes-Tr; AHA_0199-1.
DR   EnsemblGenomes-Tr; AHA_0200-1.
DR   EnsemblGenomes-Tr; AHA_0201-1.
DR   EnsemblGenomes-Tr; AHA_0202-1.
DR   EnsemblGenomes-Tr; AHA_0203-1.
DR   EnsemblGenomes-Tr; AHA_0335-1.
DR   EnsemblGenomes-Tr; AHA_0336-1.
DR   EnsemblGenomes-Tr; AHA_0337-1.
DR   EnsemblGenomes-Tr; AHA_0338-1.
DR   EnsemblGenomes-Tr; AHA_0339-1.
DR   EnsemblGenomes-Tr; AHA_0752-1.
DR   EnsemblGenomes-Tr; AHA_0753-1.
DR   EnsemblGenomes-Tr; AHA_0754-1.
DR   EnsemblGenomes-Tr; AHA_0755-1.
DR   EnsemblGenomes-Tr; AHA_0756-1.
DR   EnsemblGenomes-Tr; AHA_0836-1.
DR   EnsemblGenomes-Tr; AHA_0865-1.
DR   EnsemblGenomes-Tr; AHA_0866-1.
DR   EnsemblGenomes-Tr; AHA_0867-1.
DR   EnsemblGenomes-Tr; AHA_0868-1.
DR   EnsemblGenomes-Tr; AHA_1026-1.
DR   EnsemblGenomes-Tr; AHA_1027-1.
DR   EnsemblGenomes-Tr; AHA_1028-1.
DR   EnsemblGenomes-Tr; AHA_1088-1.
DR   EnsemblGenomes-Tr; AHA_1116-1.
DR   EnsemblGenomes-Tr; AHA_1319-1.
DR   EnsemblGenomes-Tr; AHA_1343-1.
DR   EnsemblGenomes-Tr; AHA_1555-1.
DR   EnsemblGenomes-Tr; AHA_1556-1.
DR   EnsemblGenomes-Tr; AHA_1785-1.
DR   EnsemblGenomes-Tr; AHA_1825-1.
DR   EnsemblGenomes-Tr; AHA_1851-1.
DR   EnsemblGenomes-Tr; AHA_1852-1.
DR   EnsemblGenomes-Tr; AHA_1853-1.
DR   EnsemblGenomes-Tr; AHA_2108-1.
DR   EnsemblGenomes-Tr; AHA_2109-1.
DR   EnsemblGenomes-Tr; AHA_2110-1.
DR   EnsemblGenomes-Tr; AHA_2111-1.
DR   EnsemblGenomes-Tr; AHA_2112-1.
DR   EnsemblGenomes-Tr; AHA_2113-1.
DR   EnsemblGenomes-Tr; AHA_2387-1.
DR   EnsemblGenomes-Tr; AHA_2388-1.
DR   EnsemblGenomes-Tr; AHA_2389-1.
DR   EnsemblGenomes-Tr; AHA_2390-1.
DR   EnsemblGenomes-Tr; AHA_2391-1.
DR   EnsemblGenomes-Tr; AHA_2392-1.
DR   EnsemblGenomes-Tr; AHA_2393-1.
DR   EnsemblGenomes-Tr; AHA_2394-1.
DR   EnsemblGenomes-Tr; AHA_2449-1.
DR   EnsemblGenomes-Tr; AHA_2507-1.
DR   EnsemblGenomes-Tr; AHA_2539-1.
DR   EnsemblGenomes-Tr; AHA_2541-1.
DR   EnsemblGenomes-Tr; AHA_2542-1.
DR   EnsemblGenomes-Tr; AHA_2603-1.
DR   EnsemblGenomes-Tr; AHA_2673-1.
DR   EnsemblGenomes-Tr; AHA_2769-1.
DR   EnsemblGenomes-Tr; AHA_2770-1.
DR   EnsemblGenomes-Tr; AHA_2771-1.
DR   EnsemblGenomes-Tr; AHA_2815-1.
DR   EnsemblGenomes-Tr; AHA_3027-1.
DR   EnsemblGenomes-Tr; AHA_3028-1.
DR   EnsemblGenomes-Tr; AHA_3090-1.
DR   EnsemblGenomes-Tr; AHA_3091-1.
DR   EnsemblGenomes-Tr; AHA_3153-1.
DR   EnsemblGenomes-Tr; AHA_3158-1.
DR   EnsemblGenomes-Tr; AHA_3159-1.
DR   EnsemblGenomes-Tr; AHA_3160-1.
DR   EnsemblGenomes-Tr; AHA_3161-1.
DR   EnsemblGenomes-Tr; AHA_3162-1.
DR   EnsemblGenomes-Tr; AHA_3163-1.
DR   EnsemblGenomes-Tr; AHA_3164-1.
DR   EnsemblGenomes-Tr; AHA_3165-1.
DR   EnsemblGenomes-Tr; AHA_3306-1.
DR   EnsemblGenomes-Tr; AHA_3307-1.
DR   EnsemblGenomes-Tr; AHA_3442-1.
DR   EnsemblGenomes-Tr; AHA_3443-1.
DR   EnsemblGenomes-Tr; AHA_3444-1.
DR   EnsemblGenomes-Tr; AHA_3445-1.
DR   EnsemblGenomes-Tr; AHA_3446-1.
DR   EnsemblGenomes-Tr; AHA_3451-1.
DR   EnsemblGenomes-Tr; AHA_3452-1.
DR   EnsemblGenomes-Tr; AHA_3453-1.
DR   EnsemblGenomes-Tr; AHA_3454-1.
DR   EnsemblGenomes-Tr; AHA_3455-1.
DR   EnsemblGenomes-Tr; AHA_3456-1.
DR   EnsemblGenomes-Tr; AHA_3457-1.
DR   EnsemblGenomes-Tr; AHA_3458-1.
DR   EnsemblGenomes-Tr; AHA_3472-1.
DR   EnsemblGenomes-Tr; AHA_3473-1.
DR   EnsemblGenomes-Tr; AHA_3513-1.
DR   EnsemblGenomes-Tr; AHA_3514-1.
DR   EnsemblGenomes-Tr; AHA_3515-1.
DR   EnsemblGenomes-Tr; AHA_3516-1.
DR   EnsemblGenomes-Tr; AHA_3622-1.
DR   EnsemblGenomes-Tr; AHA_3623-1.
DR   EnsemblGenomes-Tr; AHA_3624-1.
DR   EnsemblGenomes-Tr; AHA_3625-1.
DR   EnsemblGenomes-Tr; AHA_3626-1.
DR   EnsemblGenomes-Tr; AHA_3627-1.
DR   EnsemblGenomes-Tr; AHA_3628-1.
DR   EnsemblGenomes-Tr; AHA_3629-1.
DR   EnsemblGenomes-Tr; AHA_3630-1.
DR   EnsemblGenomes-Tr; AHA_3631-1.
DR   EnsemblGenomes-Tr; AHA_3632-1.
DR   EnsemblGenomes-Tr; AHA_3633-1.
DR   EnsemblGenomes-Tr; AHA_3634-1.
DR   EnsemblGenomes-Tr; AHA_3635-1.
DR   EnsemblGenomes-Tr; AHA_3696-1.
DR   EnsemblGenomes-Tr; AHA_3706-1.
DR   EnsemblGenomes-Tr; AHA_3707-1.
DR   EnsemblGenomes-Tr; AHA_3708-1.
DR   EnsemblGenomes-Tr; AHA_3709-1.
DR   EnsemblGenomes-Tr; AHA_3710-1.
DR   EnsemblGenomes-Tr; AHA_3711-1.
DR   EnsemblGenomes-Tr; AHA_3805-1.
DR   EnsemblGenomes-Tr; AHA_3806-1.
DR   EnsemblGenomes-Tr; AHA_3807-1.
DR   EnsemblGenomes-Tr; AHA_3808-1.
DR   EnsemblGenomes-Tr; AHA_3809-1.
DR   EnsemblGenomes-Tr; AHA_3842-1.
DR   EnsemblGenomes-Tr; AHA_3843-1.
DR   EnsemblGenomes-Tr; AHA_3844-1.
DR   EnsemblGenomes-Tr; AHA_3845-1.
DR   EnsemblGenomes-Tr; AHA_3940-1.
DR   EnsemblGenomes-Tr; AHA_3941-1.
DR   EnsemblGenomes-Tr; AHA_3942-1.
DR   EnsemblGenomes-Tr; AHA_3943-1.
DR   EnsemblGenomes-Tr; AHA_3944-1.
DR   EnsemblGenomes-Tr; AHA_4011-1.
DR   EnsemblGenomes-Tr; AHA_4012-1.
DR   EnsemblGenomes-Tr; AHA_4013-1.
DR   EnsemblGenomes-Tr; AHA_4014-1.
DR   EnsemblGenomes-Tr; AHA_4015-1.
DR   EnsemblGenomes-Tr; AHA_4016-1.
DR   EnsemblGenomes-Tr; AHA_4035-1.
DR   EnsemblGenomes-Tr; AHA_4037-1.
DR   EnsemblGenomes-Tr; AHA_4038-1.
DR   EnsemblGenomes-Tr; AHA_4085-1.
DR   EnsemblGenomes-Tr; AHA_4132-1.
DR   EnsemblGenomes-Tr; AHA_4242-1.
DR   EnsemblGenomes-Tr; AHA_4243-1.
DR   EnsemblGenomes-Tr; AHA_4244-1.
DR   EnsemblGenomes-Tr; AHA_4245-1.
DR   EnsemblGenomes-Tr; AHA_4246-1.
DR   EnsemblGenomes-Tr; EBT00001759369.
DR   EnsemblGenomes-Tr; EBT00001759370.
DR   EnsemblGenomes-Tr; EBT00001759371.
DR   EnsemblGenomes-Tr; EBT00001759372.
DR   EnsemblGenomes-Tr; EBT00001759373.
DR   EnsemblGenomes-Tr; EBT00001759374.
DR   EnsemblGenomes-Tr; EBT00001759375.
DR   EnsemblGenomes-Tr; EBT00001759376.
DR   EnsemblGenomes-Tr; EBT00001759377.
DR   EnsemblGenomes-Tr; EBT00001759378.
DR   EnsemblGenomes-Tr; EBT00001759379.
DR   EnsemblGenomes-Tr; EBT00001759380.
DR   EnsemblGenomes-Tr; EBT00001759381.
DR   EnsemblGenomes-Tr; EBT00001759382.
DR   EnsemblGenomes-Tr; EBT00001759383.
DR   EnsemblGenomes-Tr; EBT00001759384.
DR   EnsemblGenomes-Tr; EBT00001759385.
DR   EnsemblGenomes-Tr; EBT00001759386.
DR   EnsemblGenomes-Tr; EBT00001759387.
DR   EnsemblGenomes-Tr; EBT00001759388.
DR   EnsemblGenomes-Tr; EBT00001759389.
DR   EnsemblGenomes-Tr; EBT00001759390.
DR   EnsemblGenomes-Tr; EBT00001759391.
DR   EnsemblGenomes-Tr; EBT00001759392.
DR   EnsemblGenomes-Tr; EBT00001759393.
DR   EnsemblGenomes-Tr; EBT00001759394.
DR   EnsemblGenomes-Tr; EBT00001759395.
DR   EnsemblGenomes-Tr; EBT00001759396.
DR   EnsemblGenomes-Tr; EBT00001759397.
DR   EnsemblGenomes-Tr; EBT00001759398.
DR   EnsemblGenomes-Tr; EBT00001759399.
DR   EnsemblGenomes-Tr; EBT00001759400.
DR   EnsemblGenomes-Tr; EBT00001759401.
DR   EnsemblGenomes-Tr; EBT00001759402.
DR   EnsemblGenomes-Tr; EBT00001759403.
DR   EnsemblGenomes-Tr; EBT00001759404.
DR   EnsemblGenomes-Tr; EBT00001759405.
DR   EnsemblGenomes-Tr; EBT00001759406.
DR   EnsemblGenomes-Tr; EBT00001759407.
DR   EnsemblGenomes-Tr; EBT00001759408.
DR   EnsemblGenomes-Tr; EBT00001759409.
DR   EnsemblGenomes-Tr; EBT00001759410.
DR   EnsemblGenomes-Tr; EBT00001759411.
DR   EnsemblGenomes-Tr; EBT00001759412.
DR   EnsemblGenomes-Tr; EBT00001759413.
DR   EnsemblGenomes-Tr; EBT00001759414.
DR   EnsemblGenomes-Tr; EBT00001759415.
DR   EnsemblGenomes-Tr; EBT00001759416.
DR   EnsemblGenomes-Tr; EBT00001759417.
DR   EnsemblGenomes-Tr; EBT00001759418.
DR   EnsemblGenomes-Tr; EBT00001759419.
DR   EnsemblGenomes-Tr; EBT00001759420.
DR   EnsemblGenomes-Tr; EBT00001759421.
DR   EnsemblGenomes-Tr; EBT00001759422.
DR   EnsemblGenomes-Tr; EBT00001759423.
DR   EnsemblGenomes-Tr; EBT00001759424.
DR   EnsemblGenomes-Tr; EBT00001759425.
DR   EnsemblGenomes-Tr; EBT00001759426.
DR   EnsemblGenomes-Tr; EBT00001759427.
DR   EnsemblGenomes-Tr; EBT00001759428.
DR   EnsemblGenomes-Tr; EBT00001759429.
DR   EnsemblGenomes-Tr; EBT00001759430.
DR   EnsemblGenomes-Tr; EBT00001759431.
DR   EnsemblGenomes-Tr; EBT00001759432.
DR   EnsemblGenomes-Tr; EBT00001759433.
DR   EnsemblGenomes-Tr; EBT00001759434.
DR   EnsemblGenomes-Tr; EBT00001759435.
DR   EnsemblGenomes-Tr; EBT00001759436.
DR   EnsemblGenomes-Tr; EBT00001759437.
DR   EnsemblGenomes-Tr; EBT00001759438.
DR   EnsemblGenomes-Tr; EBT00001759439.
DR   EnsemblGenomes-Tr; EBT00001759440.
DR   EnsemblGenomes-Tr; EBT00001759441.
DR   EnsemblGenomes-Tr; EBT00001759442.
DR   EnsemblGenomes-Tr; EBT00001759443.
DR   EnsemblGenomes-Tr; EBT00001759444.
DR   EnsemblGenomes-Tr; EBT00001759445.
DR   EnsemblGenomes-Tr; EBT00001759446.
DR   EnsemblGenomes-Tr; EBT00001759447.
DR   EnsemblGenomes-Tr; EBT00001759448.
DR   EnsemblGenomes-Tr; EBT00001759449.
DR   EnsemblGenomes-Tr; EBT00001759450.
DR   EnsemblGenomes-Tr; EBT00001759451.
DR   EnsemblGenomes-Tr; EBT00001759452.
DR   EnsemblGenomes-Tr; EBT00001759453.
DR   EnsemblGenomes-Tr; EBT00001759454.
DR   EnsemblGenomes-Tr; EBT00001759455.
DR   EnsemblGenomes-Tr; EBT00001759456.
DR   EnsemblGenomes-Tr; EBT00001759457.
DR   EnsemblGenomes-Tr; EBT00001759458.
DR   EnsemblGenomes-Tr; EBT00001759459.
DR   EnsemblGenomes-Tr; EBT00001759460.
DR   EnsemblGenomes-Tr; EBT00001759461.
DR   EnsemblGenomes-Tr; EBT00001759462.
DR   EnsemblGenomes-Tr; EBT00001759463.
DR   EnsemblGenomes-Tr; EBT00001759464.
DR   EnsemblGenomes-Tr; EBT00001759465.
DR   EnsemblGenomes-Tr; EBT00001759466.
DR   EnsemblGenomes-Tr; EBT00001759467.
DR   EnsemblGenomes-Tr; EBT00001759468.
DR   EnsemblGenomes-Tr; EBT00001759469.
DR   EnsemblGenomes-Tr; EBT00001759470.
DR   EnsemblGenomes-Tr; EBT00001759471.
DR   EnsemblGenomes-Tr; EBT00001759472.
DR   EnsemblGenomes-Tr; EBT00001759473.
DR   EnsemblGenomes-Tr; EBT00001759474.
DR   EnsemblGenomes-Tr; EBT00001759475.
DR   EnsemblGenomes-Tr; EBT00001759476.
DR   EnsemblGenomes-Tr; EBT00001759477.
DR   EnsemblGenomes-Tr; EBT00001759478.
DR   EnsemblGenomes-Tr; EBT00001759479.
DR   EnsemblGenomes-Tr; EBT00001759480.
DR   EnsemblGenomes-Tr; EBT00001759481.
DR   EnsemblGenomes-Tr; EBT00001759482.
DR   EnsemblGenomes-Tr; EBT00001759483.
DR   EnsemblGenomes-Tr; EBT00001759484.
DR   EnsemblGenomes-Tr; EBT00001759485.
DR   EnsemblGenomes-Tr; EBT00001759486.
DR   EnsemblGenomes-Tr; EBT00001759487.
DR   EnsemblGenomes-Tr; EBT00001759488.
DR   EnsemblGenomes-Tr; EBT00001759489.
DR   EnsemblGenomes-Tr; EBT00001759490.
DR   EnsemblGenomes-Tr; EBT00001759491.
DR   EnsemblGenomes-Tr; EBT00001759492.
DR   EnsemblGenomes-Tr; EBT00001759493.
DR   EnsemblGenomes-Tr; EBT00001759494.
DR   EnsemblGenomes-Tr; EBT00001759495.
DR   EnsemblGenomes-Tr; EBT00001759496.
DR   EnsemblGenomes-Tr; EBT00001759497.
DR   EnsemblGenomes-Tr; EBT00001759498.
DR   EnsemblGenomes-Tr; EBT00001759499.
DR   EnsemblGenomes-Tr; EBT00001759500.
DR   EnsemblGenomes-Tr; EBT00001759501.
DR   EnsemblGenomes-Tr; EBT00001759502.
DR   EnsemblGenomes-Tr; EBT00001759503.
DR   EnsemblGenomes-Tr; EBT00001759504.
DR   EnsemblGenomes-Tr; EBT00001759505.
DR   EnsemblGenomes-Tr; EBT00001759506.
DR   EnsemblGenomes-Tr; EBT00001759507.
DR   EnsemblGenomes-Tr; EBT00001759508.
DR   EnsemblGenomes-Tr; EBT00001759509.
DR   EnsemblGenomes-Tr; EBT00001759510.
DR   EnsemblGenomes-Tr; EBT00001759511.
DR   EnsemblGenomes-Tr; EBT00001759512.
DR   EnsemblGenomes-Tr; EBT00001759513.
DR   EnsemblGenomes-Tr; EBT00001759514.
DR   EnsemblGenomes-Tr; EBT00001759515.
DR   EnsemblGenomes-Tr; EBT00001759516.
DR   EnsemblGenomes-Tr; EBT00001759517.
DR   EnsemblGenomes-Tr; EBT00001759518.
DR   EnsemblGenomes-Tr; EBT00001759519.
DR   EnsemblGenomes-Tr; EBT00001759520.
DR   EnsemblGenomes-Tr; EBT00001759521.
DR   EnsemblGenomes-Tr; EBT00001759522.
DR   EnsemblGenomes-Tr; EBT00001759523.
DR   EnsemblGenomes-Tr; EBT00001759524.
DR   EnsemblGenomes-Tr; EBT00001759525.
DR   EnsemblGenomes-Tr; EBT00001759526.
DR   EnsemblGenomes-Tr; EBT00001759527.
DR   EnsemblGenomes-Tr; EBT00001759528.
DR   EnsemblGenomes-Tr; EBT00001759529.
DR   EnsemblGenomes-Tr; EBT00001759530.
DR   EnsemblGenomes-Tr; EBT00001759531.
DR   EnsemblGenomes-Tr; EBT00001759532.
DR   EnsemblGenomes-Tr; EBT00001759533.
DR   EnsemblGenomes-Tr; EBT00001759534.
DR   EnsemblGenomes-Tr; EBT00001759535.
DR   EnsemblGenomes-Tr; EBT00001759536.
DR   EnsemblGenomes-Tr; EBT00001759537.
DR   EnsemblGenomes-Tr; EBT00001759538.
DR   EnsemblGenomes-Tr; EBT00001759539.
DR   EnsemblGenomes-Tr; EBT00001759540.
DR   EnsemblGenomes-Tr; EBT00001759541.
DR   EnsemblGenomes-Tr; EBT00001759542.
DR   EnsemblGenomes-Tr; EBT00001759543.
DR   EnsemblGenomes-Tr; EBT00001759544.
DR   EnsemblGenomes-Tr; EBT00001759545.
DR   EnsemblGenomes-Tr; EBT00001759546.
DR   EnsemblGenomes-Tr; EBT00001759547.
DR   EnsemblGenomes-Tr; EBT00001759548.
DR   EnsemblGenomes-Tr; EBT00001759549.
DR   EnsemblGenomes-Tr; EBT00001759550.
DR   EnsemblGenomes-Tr; EBT00001759551.
DR   EnsemblGenomes-Tr; EBT00001759552.
DR   EnsemblGenomes-Tr; EBT00001759553.
DR   EnsemblGenomes-Tr; EBT00001759555.
DR   EnsemblGenomes-Tr; EBT00001759557.
DR   EnsemblGenomes-Tr; EBT00001759558.
DR   EnsemblGenomes-Tr; EBT00001759559.
DR   EnsemblGenomes-Tr; EBT00001759560.
DR   EnsemblGenomes-Tr; EBT00001759561.
DR   EnsemblGenomes-Tr; EBT00001759563.
DR   EnsemblGenomes-Tr; EBT00001759565.
DR   EuropePMC; PMC1698176; 16980456.
DR   EuropePMC; PMC2443923; 18458128.
DR   EuropePMC; PMC2805215; 19933350.
DR   EuropePMC; PMC2849387; 20124004.
DR   EuropePMC; PMC3416550; 22815437.
DR   EuropePMC; PMC3608246; 23406017.
DR   EuropePMC; PMC3638308; 23611906.
DR   EuropePMC; PMC4056299; 24926056.
DR   EuropePMC; PMC4068668; 24795370.
DR   EuropePMC; PMC4256179; 25477398.
DR   EuropePMC; PMC4334500; 25679227.
DR   EuropePMC; PMC4495220; 26025898.
DR   EuropePMC; PMC5444012; 28567445.
DR   EuropePMC; PMC5552941; 28127946.
DR   EuropePMC; PMC5756416; 29304740.
DR   EuropePMC; PMC5794944; 29437097.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00170; msr.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000462.
DR   SILVA-SSU; CP000462.
DR   StrainInfo; 37798; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4744448
FT                   /organism="Aeromonas hydrophila subsp. hydrophila ATCC
FT                   7966"
FT                   /sub_species="hydrophila"
FT                   /strain="ATCC 7966"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Aeromonas hydrophila subsp.
FT                   hydrophila ATCC 7966"
FT                   /db_xref="taxon:380703"
FT   gene            223..1593
FT                   /gene="dnaA-1"
FT                   /locus_tag="AHA_0001"
FT   CDS_pept        223..1593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA-1"
FT                   /locus_tag="AHA_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36302"
FT                   /db_xref="GOA:A0KEC3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEC3"
FT                   /protein_id="ABK36302.1"
FT                   /translation="MTASLWQQCLNRLQDELPSAEFSMWIRPLQAELSDNTLTLYAPNR
FT                   FVLDWVRDKYLIRVNGIINELCGVDGPTLRFDIGNRPHPVAVARAPARGADPVNNSQKS
FT                   WESKAEAKPEPNHKSNTNVNYTFENFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGT
FT                   GLGKTHLLHAVGNAIKERKQDAKVIYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALL
FT                   IDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTV
FT                   AIEPPELETRVAILMRKADENQIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTG
FT                   RAINIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKLADLLSKRRSRSVARPRQLA
FT                   MALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLKEESHDIKEDYSNLIRTLSS"
FT   gene            1677..2780
FT                   /gene="dnaN"
FT                   /locus_tag="AHA_0002"
FT   CDS_pept        1677..2780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="AHA_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37675"
FT                   /db_xref="GOA:A0KEE7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE7"
FT                   /protein_id="ABK37675.1"
FT                   /translation="MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSLT
FT                   GTDLEVEMIGQVYLNSDSQDGRTTVPARKLLDICRGLPEGADIRLNTEGERLIIRSGRS
FT                   RFNLSTLPATEYPNIEDWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLFESE
FT                   GHGLRTVATDGHRLATCRREVVTESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRS
FT                   NLRAALDGFIFTSKLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSNEKFRG
FT                   VRLNLQENLLRITANNPEQEEAEELLDVQYEAGEMEIGFNVSYVLDVLNTLKCDQIRIS
FT                   LSDSISSAIIEDFDSQDAQYVVMPMRI"
FT   gene            2783..3886
FT                   /gene="recF"
FT                   /locus_tag="AHA_0003"
FT   CDS_pept        2783..3886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="AHA_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37230"
FT                   /db_xref="GOA:A0KEE8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE8"
FT                   /protein_id="ABK37230.1"
FT                   /translation="MSLVKLQLSDFRNIQQASLALSPGLNILVGCNGSGKTSVLEAIHY
FT                   LGLGRSFRTHLTGRVIRQGERAFTLFAQCELEGRQVPIGLAKDKSGETQLKIAGAQAQR
FT                   LAELAELLPVQLIHPDGFNLLTGGPQARRAWLDWGVFHQEPTFFSLWGRVRRLLKQRNA
FT                   LLRQSSQYRQLAYWDQELVRLGGELAEFRASYCQAITPLIKEMTADFLPEFDISLGFYR
FT                   GWEKDTPLNALLEAGFERDRALGYTGVGPQKADVRLKANGVPAQDILSRGQLKLLVCAM
FT                   RLAQGLYLNQHSSRGCIFLIDDFASELDVDKRRLLAARLKQCASQVFITAIDTGQLADM
FT                   MDANDCKLFHVEQGKISETLEKAESKL"
FT   gene            3883..6294
FT                   /gene="gyrB"
FT                   /locus_tag="AHA_0004"
FT   CDS_pept        3883..6294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="AHA_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P06982; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37959"
FT                   /db_xref="GOA:A0KEE9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE9"
FT                   /protein_id="ABK37959.1"
FT                   /translation="MSENTYDSSNIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEVV
FT                   DNSIDEALAGYCSDIQVKIHSDGSVSVRDNGRGIPVDIHPEEGRSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSDKLLLTIRRNGHVYEQTYHLGEPQAPLKQIGDSTG
FT                   TGTEVRFWPSPTIFSDTLFHYEILAKRLRELSFLNSGVSIRLLDERDGREAHFCYEGGI
FT                   KAFVEYLNQNKTPIHPKVFHFTTEQDGIGVEVAMQWNDAYQEGVYCFTNNIPQRDGGTH
FT                   LVGFRTALTRTLNSYMDKEDYSKKAKSAASGDDVREGLIAVISVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVEQAMGEKLADFLLENPGDAKIVVNKIIDAARAREAARKARELTRRKGALD
FT                   IAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMISSQEVGTLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGAHIRTLLLTFFYRQ
FT                   MPEIIERGYVYIAQPPLYKVKKGKQEQYLKDEDALLQYQTAMALDGATLHVNESAPAIG
FT                   GEALERLVNQHRSVSHLITRMSRRAPEAVLTQLIYQPELNEALLSSESDLLAWCQSMEA
FT                   VLNESNHGIQYQMQVRHDEERRLFVPHAVVRQHGVDREYPLSYDFLQSSEYRQLVSLGK
FT                   EIANLIEEGGYIKRGEKVKPVASFVEAVEWLMGEGKRGIYIQRYKGLGEMNPDQLWETT
FT                   MDPEARRMLRVTIDDAVGADQLFSTLMGDAVEPRRDFIETNALRVANLDV"
FT   gene            complement(6409..6786)
FT                   /locus_tag="AHA_0005"
FT   CDS_pept        complement(6409..6786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0005"
FT                   /product="glyoxalase family protein superfamily"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38384"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF0"
FT                   /protein_id="ABK38384.1"
FT                   /translation="MLVPQFTILYVANPARSTLFYRELFGRPPVEESPTFAMFVFESGA
FT                   RLALWSSATVEPAVTQTAGAMELAFALPNDTAVDRQSAEWQARGLTLIQAPTRMEFGYT
FT                   CMALDPDGHRLRLYCPAPELG"
FT   gene            complement(6853..7557)
FT                   /locus_tag="AHA_0006"
FT   CDS_pept        complement(6853..7557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0006"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38199"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF1"
FT                   /protein_id="ABK38199.1"
FT                   /translation="MSRSERLLALLQLLRGHRYAITGSELASQLGISLRTLYRDIATLQ
FT                   AQGAHIEGEAGIGYVLRPGFMLPPLMFSEEELDALVLGSRWVAAHADHALSTAASSALA
FT                   KIEAVLPADYRQQLHANALLIGTSRGDSPVDEAPLRSAIRQQRKVTLNYRDLKEESSER
FT                   TVWPCALGYFDQVRVLVAWCELRQDFRHFRVDRISAMRLEAEPYPGNRGRLLKEWRASQ
FT                   QIPQPRFIADRN"
FT   gene            7792..8205
FT                   /locus_tag="AHA_0007"
FT   CDS_pept        7792..8205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0007"
FT                   /product="16 kDa heat shock protein A"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37772"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA5"
FT                   /protein_id="ABK37772.1"
FT                   /translation="MRSIDFSPLYRSAIGFDRLANLIESAASNGNAGYPPYNIEQLGDS
FT                   DYRISMAVAGFTQEELELSFQENLLTVKGNKQADTERNYLYQGIAERGFERRFQLADYV
FT                   RVKGADLKNGLLHIDLVREVPEAMKPRKIEING"
FT   gene            8298..8735
FT                   /locus_tag="AHA_0008"
FT   CDS_pept        8298..8735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0008"
FT                   /product="16 kDa heat shock protein A"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38558"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA7"
FT                   /protein_id="ABK38558.1"
FT                   /translation="MRNLDFSHLYSNAVGFERMARELEGLFEQKTAAYPPYNIEKRDQD
FT                   GYRITVAVAGFEREELELETENGTLKVKGRKAATDERQFLHQGIAERDFELAFKLSQHV
FT                   EVQGAKLEHGLLTIDLARELPEALKPRAIPIGKPEQLALPG"
FT   gene            complement(8809..10059)
FT                   /locus_tag="AHA_0009"
FT   CDS_pept        complement(8809..10059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0009"
FT                   /product="valine--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.66"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38117"
FT                   /db_xref="GOA:A0KEA8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA8"
FT                   /protein_id="ABK38117.1"
FT                   /translation="MEFSLFGEKFTRHAGITQLMDDLNQGLTNPDAIMLGGGNPAPIPA
FT                   MLERFQAEAKSLLDNGELVKAMANYDGPQGKDRFTKALAALLSKELGWDISARNIALTN
FT                   GSQNAFFYLFNLLAGEFADGRKKKVLFPLAPEYIGYADSALADDYFVAYKPTIEKLADG
FT                   QFKYHVDFESLQVGDDIGVICVSRPTNPTGNVLTDEEIEHLDQIARDKGIPLLIDNAYG
FT                   VPFPGIIFSEAKPFWNANTILCMSLSKLGLPGTRCGIVIADEKIIQAITNLSGIINLAP
FT                   GSLGPAITIPMIESGEIIALSEQVVKPFYRQKAELAVQLLREAIPDPRFHIHKPEGALF
FT                   LWLWFEGLPIHCQELYERLKAKNLLIVPGHYFFPGIDDPEWRHSQECIRLNYSQSEELV
FT                   RRGIAILADEINALYAG"
FT   gene            10343..10576
FT                   /locus_tag="AHA_0011"
FT   CDS_pept        10343..10576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0011"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36819"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA9"
FT                   /protein_id="ABK36819.1"
FT                   /translation="MKILIATLIASSLSLNVMADEYPRPELDSAKLAQEIAAQQQQASH
FT                   AVMEEAIHNLKPLALETLVVEASSADATHPES"
FT   gene            complement(10506..11330)
FT                   /locus_tag="AHA_0010"
FT   CDS_pept        complement(10506..11330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0010"
FT                   /product="transcriptional regulator, AraC/XylS family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38946"
FT                   /db_xref="GOA:A0KEB0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB0"
FT                   /protein_id="ABK38946.1"
FT                   /translation="MAFILPDHPFDPDQHDGSAIGIASALGWHDSGRHQHKRHQLLFAQ
FT                   AGCMTIELDDQVCLLPPTRAAWLPAGLPHRVLMRGVVAYRSLYFQPEPGLPTEMAVLAV
FT                   NPLLREIIERMAIWPWDKPAAEQHCTLALLQEELAQAPRESWQLPLPSDPRLAGWLQEV
FT                   KRGDTLPDRLNRLAERVGASDKTIGRIFMRETGMSYQAWRQQWRLLRALELLAEAEPIS
FT                   RVAATLEFASDSAFISFFRQHTGQTPLRYLNSRGESHRPSSPPPPGSPAPAA"
FT   gene            11423..12550
FT                   /locus_tag="AHA_0012"
FT   CDS_pept        11423..12550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0012"
FT                   /product="multidrug resistance protein D"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36141"
FT                   /db_xref="GOA:A0KEA6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA6"
FT                   /protein_id="ABK36141.1"
FT                   /translation="MNNKLPPLWLVVGLMMFPQIVETIYSPVLTHIASQFRVSEGQASQ
FT                   TLSVYFLAFAAGVVCWGRLCDLVGRRPAMLAGLMTYGAGTLLALLATQFETLLLARVIA
FT                   AFGAAVGSVVTQTMLRDSYQGSELARVFSVMGIALSLSPVLGLVSGGQLASGFGYLGVF
FT                   SALLVLAVGLLLVTCWQLPETRPAITQRVALWPLAQRMVRDAALWRSAALVALFNTMLF
FT                   GYYSLAPFLFAGLGLSAGEFGYSGILLALATLGGSLLNKRLLGRGWSPASLIRLAAALA
FT                   LGSGWLVWASQASLWFLLPMMGVVVAFGLAIPNVLSQALLAYREVAGSAGALFGLGYYL
FT                   LLSLGLAVAASLQDLGLLLGGCGLLALCCGWRRST"
FT   gene            complement(12555..13238)
FT                   /locus_tag="AHA_0013"
FT   CDS_pept        complement(12555..13238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0013"
FT                   /product="KDP operon transcriptional regulatory protein
FT                   KdpE"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37687"
FT                   /db_xref="GOA:A0KED1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED1"
FT                   /protein_id="ABK37687.1"
FT                   /translation="MAHILVIDDEAAIRRFLRISLIAEGHQVSEAVGVNEGLAQYRHLN
FT                   PDLVILDLGLPDGDGIQVLQAIREHHQHPVLVLSARDSEQEKVRLLDAGANDYMSKPFG
FT                   IGEMMARIRVLLRQRAGVSSGEQRHFPQCGLTLDSSSHRVTLGEEEVPLSRKEFALLQA
FT                   LVCHPGKLVLQTQLLNDIWGPSHKEDTHYLRIVIASLRKKLGDNPQQPTLIETESGIGY
FT                   RFIGS"
FT   gene            complement(13269..15857)
FT                   /locus_tag="AHA_0014"
FT   CDS_pept        complement(13269..15857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0014"
FT                   /product="sensory kinase in two-component regulatory system
FT                   wtih KdpE"
FT                   /note="regulates high-affinity potassium transport system;
FT                   identified by match to protein family HMM PF00512; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   PF02702"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36570"
FT                   /db_xref="GOA:A0KED2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED2"
FT                   /protein_id="ABK36570.1"
FT                   /translation="MRDEVRADALLASLEQEHRGKLKVFLGAAPGVGKTYAMLQAVREQ
FT                   AKEGVDILIGVVETHGRQETLALLDKLAIQPRKLHLHRQQRLEEMDLDGLLARKPAIAV
FT                   VDELAHSNAPGSRHEKRWQDVEELLGAGIDVYTTLNVQHLESLNDLVWQLTGVRVKETL
FT                   PDQVLLEADSLVLIDLPPKELLGRLKEGKVYVPHQAKAALQSFFSLNNLTALRELAMQT
FT                   AASHVEGDLQLQWQAAGKTTLPLRGKLMVCLGDQHGAALVRYGHRFAQRRQLPWLVVHI
FT                   DSKGQRSVELEQALALASQLGAKVLTLSSPAVADTLLETAEQQQVSQLLLGKPHKAPWR
FT                   RSLVQHLLKQAQGLEITLVDTEKRKPSLGLKPLHPKDIRQSLLAVAIMGTTSAAVWGLS
FT                   HWLPPASLPMLFVLGVLATALTTSLMPAILAAVLGFVGHNLLFTAPYFSLSVASHSDLL
FT                   TLFVLLIVGITAGRLASRQRQQLIGLRETQQLGNALLSLSQGLATASSPEEVLRQGSQA
FT                   ISLALGQPVFALDQHYQHRAGSTQHKPGQTDKAAIDWCLAQKQSAGAHTATLNAAEAQY
FT                   HHLSDELVLGIVLANPLASSAEHQLQALLTDIRAALARIDLNERLADSQLQAETDRMRA
FT                   ALLSSVSHDLKTPLATIMGAGSTLLEYGDRISSEDRSELLHSVQDEARRLHSYVQNLLD
FT                   MTRIGSPDFQLKRDWVDLADLVENARRRLDSSWRQHKLLVHFDQQIPRLYVHGALIEQV
FT                   LVNILDNASRYSPAGTPIEFKVMLADPDLILDIIDIGVGIAESDRDKIFNLFYTQPVGD
FT                   CGSRGTGLGLAISRAMIEAHGGRIWAFSGPNGNGTCMRISLPLALNAAAA"
FT   gene            complement(15961..16488)
FT                   /gene="kdpC"
FT                   /locus_tag="AHA_0015"
FT   CDS_pept        complement(15961..16488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="AHA_0015"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF02669;
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37221"
FT                   /db_xref="GOA:A0KED3"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED3"
FT                   /protein_id="ABK37221.1"
FT                   /translation="MIAIRTLLTLTLLLGVAYPLAVTGLAQLLFPWQANGSLLTNAKQQ
FT                   VVGSALLAQKFERADYFHSRPSASDFATIGGGASNLGMSSPLRAEFAAAAARAQPEARV
FT                   PALLTRSASGLDPHLPLAAALAQVERVAGQRGLDPVQLTEQVKSAAQAGILGPQVVNIL
FT                   QLNLQLDHQKGA"
FT   gene            complement(16549..18606)
FT                   /gene="kdpB"
FT                   /locus_tag="AHA_0016"
FT   CDS_pept        complement(16549..18606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="AHA_0016"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01497"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36770"
FT                   /db_xref="GOA:A0KED4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED4"
FT                   /protein_id="ABK36770.1"
FT                   /translation="MSKSASMSTDTIQVKGKKQKSQILQAMVEALYRFNPRALFGSPIL
FT                   FTLWLAAVMATLESLLGQPLSGVAPSLAWQLTAWLWLTLWFANFAETLAEGRGKARADS
FT                   LKAGMSQLKARRVTSPQDDKGEWVPATSLLKGDLVLVRSGEMIPADGEVVAGIASVNEA
FT                   AITGESAPVIRESGTDRSGVTGNTTVVSDQIWVHISNNPGESTLDRMIALVEGAKRQKT
FT                   PNEMALDALLVGLTLIFLLVVATLPWFLDYNGTQVPRLYLLALFITLIPTTIGGLLSAI
FT                   GIAGMDRLVKLNVIAKSGRAVEAAGDVRTLLLDKTGTITFGNRMADELIPAPGVDPSLL
FT                   AQAAMLASIGDNTPEGKSILTLAGKSHTRPSQLESDIIIPFSAETRLSGLDRNGHHYRK
FT                   GAVDAVLRYLSLDRKAVPELILKSVDNIARQGGTPLLVCTHEKLLGVVFLKDIIKPGIK
FT                   ARFQILRHMGIRTVMITGDNPLTAAAIAAEAGVDDFIAEATPEKKLAYIRQEQADGRLV
FT                   AMCGDGANDAPALAQADVGLAMNEGTQAAKEAGNLVDLDSNPTKLLDVVLVGKQLLVTR
FT                   GALTTFSIANDVAKYFAILPALFIAAYPQLGVLNLMQLGSPESAILSAIIFNALIIVAL
FT                   VPLALRGVSLQGSAASLLRRNLLIYGVGGLIVPFIGIKLIDLVITGLGLV"
FT   gene            complement(18662..20344)
FT                   /gene="kdpA"
FT                   /locus_tag="AHA_0017"
FT   CDS_pept        complement(18662..20344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="AHA_0017"
FT                   /product="K+-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF03814;
FT                   match to protein family HMM TIGR00680"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38073"
FT                   /db_xref="GOA:A0KED5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED5"
FT                   /protein_id="ABK38073.1"
FT                   /translation="MWQEIIYPVAFVLLVLLPAPLLGNYLYRVFEGKSRWLAPLERATL
FT                   ACCGTDGREQDWKSYALSLLAFNGAGFGLLFLILLAQGLLPLNPQQLPGLNWQLAFNTA
FT                   VSFMTNTNWQAYSGEASLSYFSQMVGLTTQNFVSAATGAAVAIALFRGIARQQTTHLGN
FT                   FWQDLVRFCLYVLLPMALILALLLVWQGVPQSLSAYLPFHALEGQEQLLPLGPAASQIA
FT                   IKQLGSNGGGFFGINSAHPFENPTALSNWLEMVALLTLAAAMVCTLGRYVKDLAHSRAI
FT                   LIAMTIMLVLGLCLAIGQELQPDPALAHLTSEAGNWEGKESRFGPVLSSIWEVATTAAS
FT                   NGSVNAMHDSFAPLAGMVAMINMLLGEVVFGGVGAGIYGMMLFVLLTVFLCGLMVGRTP
FT                   TYLGKRLGITEMKWVVASMLVMPVGVLVIGGITLLMPDSATVIGHDGPHGLSRLIYAYA
FT                   SAAGNNGSAFAGFAAADSWQCIAIGLAMLLGRFGYIIPVLAIAGQLARAPRQERSEGDF
FT                   PVSGPLFITLLIVTVLLMGGLSFLPVLALGPVAEHLSLLGGAF"
FT   gene            complement(20355..20432)
FT                   /locus_tag="AHA_0018"
FT   CDS_pept        complement(20355..20432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0018"
FT                   /product="putative K+-transporting ATPase, F subunit KdpF"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37445"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR15"
FT                   /protein_id="ABK37445.1"
FT                   /translation="MNWLYLLLVLALAGYLLRALARTHE"
FT   gene            complement(20671..22020)
FT                   /gene="gor"
FT                   /locus_tag="AHA_0019"
FT   CDS_pept        complement(20671..22020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="AHA_0019"
FT                   /product="glutathione-disulfide reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01421"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37668"
FT                   /db_xref="GOA:A0KR16"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR16"
FT                   /protein_id="ABK37668.1"
FT                   /translation="MAQHFDYIAIGGGSGGIASANRAAMYGKKVALIEAKELGGTCVNV
FT                   GCVPKKAMWYAGQIADALKYGADYGFDTTLNHFNWAKLVESRQAYIGRIHQSYQNVLGK
FT                   NQITVIKGFARFVSSNTIEVNGEQYSADHILIATGGRPEVPAIPGAELGIDSDGFFELQ
FT                   SQPKRVAVVGAGYIAVEIAGVMQALGSETHLVVRKHAPLRNFDPMIHETLVEIMAQEGP
FT                   KLHTHAIPKAVVKNADESLTLQLEDGRHLTVDCLIWAIGRVPATDNLNLAAAGIELDEQ
FT                   GFIPTDKFQNTAVANVYAVGDNTGRIQLTPVAVAAGRRLSERLFNNKPGEHLNYDLVPT
FT                   VVFSHPPIGTIGLTEPEAIAEYGEGQVKVYRSQFTAMYSALTQHRQPTRMKLVCVGPEE
FT                   KVVGLHGIGFAMDEILQGFGVAMKMGATKADFDNCVAIHPTSAEEFVTMR"
FT   gene            complement(22097..24094)
FT                   /locus_tag="AHA_0020"
FT   CDS_pept        complement(22097..24094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0020"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38225"
FT                   /db_xref="GOA:A0KR18"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033414"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR18"
FT                   /protein_id="ABK38225.1"
FT                   /translation="MAIYPDRKDAMSGLFSKTAKAVGRNGLSYRLLSYILVCSTVLAMI
FT                   ITVLQLAWDYRKDVAVIEDSIGQIEASFLQPIAASLWNLDEEQVKVQIEGIMNLPNMQF
FT                   VMVKEMLGNSEVPLLTQGVERESYDISREFNLTYQGEVVGKLFVAASLEQIYQRLIEKS
FT                   VLIMVSQTIKTLVVSFCILIIIYYLVVRHLNRIANYAQKFNLDRLAIELTLEGRPLPRK
FT                   KPDELDTLVATLNQMRTRLNDEFAARHQAAEQLQQERDFSATLINSANMVICCMEPDLN
FT                   IASINPAAILLTGYHQQEILQHNWLDLFVSKAQRDELAATLADHGSIEDKEVIMHDQQG
FT                   HELVLQWTFAPFYEGPNLKYLIGFGYDITRLKKVEREIIQLNEQLEGKVVERTRSLSDA
FT                   NDQLGKAYDDLKQAQQTLVESEKMASLGSLVAGVAHEINTPIGISVTASSYLQERVADF
FT                   KQHIDSKQLSRSYLTEFTVNLDESMQLLQGNLRRASELIASFKQVAVDQSSEARYNFSL
FT                   ADNLHQVVVSLGHKLKKAQCEVDIQCDPKLSIFSFPGSFTQIYSNLILNSINHGFDNWD
FT                   KPKKITIKVEQQGEELLIDYSDNGRGIPPEILPRIFDPFVTSKRGQGGSGLGTHIIYNL
FT                   VVQLLRGRINCVSEPDNGAQFHIRLPIQHN"
FT   gene            complement(24187..27267)
FT                   /locus_tag="AHA_0021"
FT   CDS_pept        complement(24187..27267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0021"
FT                   /product="acriflavin resistance plasma membrane protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38722"
FT                   /db_xref="GOA:A0KR19"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR19"
FT                   /protein_id="ABK38722.1"
FT                   /translation="MRFTDIFIKRPILAISISFLIALLGVQAVFKMQVREYPEMTNTVV
FT                   TVSTSYYGASADLIQGFITQPLEQAIAQADNIDFMTSSTQLGSSTITAYMKLNTNPNAA
FT                   LSDILAKVNSVRSQLPKESEDPSVTMSTGSTTAVLYIGFTSPELNASQITDYLERVIKP
FT                   QLFTVGGVSKVDMYGGTKYALRVWLDPAKMAAFNLTAADVMSVLNSNNYQSATGQATGY
FT                   FTLYNGNAETQVNTTEELERLVVATRDGKVIRLADIAKVSLEKSHDTYRATANGREAVV
FT                   LAINAAPTANPINIAHDVLEMLPSLKSNMPSTMEANVLYDSTVAINESISEVIKTIAEA
FT                   AAIVLVVITLFLGSFRAVIIPIITIPLSLIGVVMVMQMFGFSINLMTLLAMVLAIGLVV
FT                   DDAIVVLENVDRHVKEGEEPFRAAIIGTREIAVPVIAMTVTLAAVYAPIALMGGITGSL
FT                   FKEFALTLAGAVFVSGIIALTLSPMMCAKMLKANEEPGKFESKVHHLLDRMTVRYDAML
FT                   HAVMQKRIVVVLFAVIVFASLPMLFKFIPSELAPNEDKGVMAVLGTAPSNVNLDYIQGT
FT                   MEQVNKVLDEQPEVAFSQVFSGVFNANQAFGIASMVPWSQREASQKEVLERVGKLVENV
FT                   PGMSITTFQFPELPGASSGLPIQFVITTPNNFESLYQVASEILTAAQGSGRFVYSELDL
FT                   QYDSATMKIKIDKDKAGAYGITMQDIGITLGTMMSDGYVNRIDLDGRSYEVIPQVERKY
FT                   RLNPESIKGYYVRAADGQSIPLGSLISIEVVGEPRALPHFNQLNSATIGAVLMPGTTMG
FT                   NAIAWLDATASEKLPQGYRYDYMGEARQFVTEGSALYATFALALAIIFLVLAIQFESAR
FT                   DPLVIMVSVPLAISGALIALAWGAATMNIYSQVGLITLVGLITKHGILICEVAKEEQLL
FT                   HGRNRMEAVMAAAKVRLRPILMTTAAMIAGLIPLLYATGAGAAQRFSIGIVIVAGLAIG
FT                   TLFTLFVLPVIYTYLASEHKPLPVFDESIPPKAKGSH"
FT   gene            complement(27283..28389)
FT                   /locus_tag="AHA_0022"
FT   CDS_pept        complement(27283..28389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0022"
FT                   /product="RND transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family, MFP subunit"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36358"
FT                   /db_xref="GOA:A0KR20"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR20"
FT                   /protein_id="ABK36358.1"
FT                   /translation="MKKWMSIMLLIALALFGSVIGFNLFKQKMIANYMANMPEPEFPVT
FT                   THKVETRDWVPTIEAIGFIEPNQGVTLSTEQSGTIDSISFESGDTVKPDQLLLSLDASV
FT                   EKANLRASMAKLPAAKAKFDRYQNLFTKGSISRDQLDDTEATYRSLEADIESLKSTIAR
FT                   REVRAPFAGVVGLRNVFLGQYLQPGTDIVRLEDTSVMRLRFTVPQTDISRIRLNQDILI
FT                   NVDSYPHRQFKGHISAIEPAVNYQSGLIQVQADIPNNDGQLRSGMFARASILLPAQKDQ
FT                   IVLPQTAITFTLYGENVYLVKEKDGVKRVEQVVVKVSERKGNDAHVVSGIKAGDEVVMS
FT                   GQVRLSNGAKVKIVQDQGLKVPDQVPML"
FT   gene            complement(28422..29045)
FT                   /locus_tag="AHA_0023"
FT   CDS_pept        complement(28422..29045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0023"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39904"
FT                   /db_xref="GOA:A0KR17"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR032551"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR17"
FT                   /protein_id="ABK39904.1"
FT                   /translation="MPQSPPRMNERSFSRCDHPVMNKKERIFDAAHEVLGEQGFHGLSI
FT                   AVVAKKARVAAGTIYRYFSDKDDLIRQLYRHTILQCHPLVMEGVQTEEVSFEQFRRLWL
FT                   NIHAIFVDEPNALKCKLQYETSPLGAELEQDPVIKAAWAPLDRFFERGLEQGLFIDLPV
FT                   RVLQVLSLDCVANMALQSQVHQFELTQDQLEAVIRACWRAILTP"
FT   gene            29246..29322
FT                   /locus_tag="AHA_0024"
FT   tRNA            29246..29322
FT                   /locus_tag="AHA_0024"
FT                   /product="tRNA-Arg"
FT   gene            29373..29448
FT                   /locus_tag="AHA_0025"
FT   tRNA            29373..29448
FT                   /locus_tag="AHA_0025"
FT                   /product="tRNA-His"
FT   gene            29469..29554
FT                   /locus_tag="AHA_0026"
FT   tRNA            29469..29554
FT                   /locus_tag="AHA_0026"
FT                   /product="tRNA-Leu"
FT   gene            29628..29704
FT                   /locus_tag="AHA_0027"
FT   tRNA            29628..29704
FT                   /locus_tag="AHA_0027"
FT                   /product="tRNA-Pro"
FT   gene            29998..30399
FT                   /locus_tag="AHA_0028"
FT   CDS_pept        29998..30399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0028"
FT                   /product="ricin-type beta-trefoil lectin domain, putative"
FT                   /note="identified by match to protein family HMM PF00652"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35934"
FT                   /db_xref="GOA:A0KED0"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED0"
FT                   /protein_id="ABK35934.1"
FT                   /translation="MQSTATSALVTDAGFCVALNDHNQLITQPCDQTVRQQFSWDAGAL
FT                   QLDQRCLVAKGVSELTMAECQDESRQWQWQEDRLFNSKADRCLDVAGRRHKPGTPLRLA
FT                   DCFGGANQSFAWQNKSSMFDKLNLKSLIW"
FT   gene            complement(30404..31483)
FT                   /gene="pyk-1"
FT                   /locus_tag="AHA_0029"
FT   CDS_pept        complement(30404..31483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk-1"
FT                   /locus_tag="AHA_0029"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36375"
FT                   /db_xref="GOA:A0KR09"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR09"
FT                   /protein_id="ABK36375.1"
FT                   /translation="MRKTKIIATLGPASSSAAMVEQLIQAGANVFRLNFSHGSPEQHLA
FT                   LAARIRACAARLDREIGILADLQGPKIRIASFADGCIRLQPGDPFTIDAGLDSHQGDQS
FT                   RVGTDYPALAGELQTGNVVLLDDGRIQLCVEQVIDERIETRVLVGGTLSSRKGINVLGG
FT                   GLSAPALTDKDKADILTARLLEADYIAVSFPRSAADLEEARTLIRASGSRAAIVAKVER
FT                   AEVVASVAAMDELIHAADLIMVARGDLGVEIGDARLPGVQKRLIRRCRALGRPVITATQ
FT                   MMESMIASPMPTRAEVMDVANAVMDGSDAVMLSAESATGRYPVEAVAAMARIALAAEQE
FT                   MEPAGHGLAASHGELARLA"
FT   gene            complement(31551..32888)
FT                   /locus_tag="AHA_0030"
FT   CDS_pept        complement(31551..32888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0030"
FT                   /product="sugar phosphate permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36462"
FT                   /db_xref="GOA:A0KR11"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR11"
FT                   /protein_id="ABK36462.1"
FT                   /translation="MFNFFKTRADLPVMEASPDKIRSIYRKYQWQVFLGLVLGYAMFYV
FT                   VRMSLNVVKKPMLDSGVVTLEELGVIGSAFLFTYAVGKFSNGFLSDYANIGRFMSVSLG
FT                   LSSICTILMGMNTATFFLVLMWGLNGWFQSVGSAPSCVSIFQWFSPKQRGSVYSIWGGS
FT                   RNIGEGISWILTATIVSYFGWKAGFIGAGIASLIAALCMYLVLKDRPQTYALPEPAVAF
FT                   GETPEIAKKVDPAEIRRAQLFVLKQPAVWLIAAACACMYMSRYAMSSWAVLYLQEQKGY
FT                   SLIDAGFAMSAYPIAGFLGAILAGIISDKLFNANRHIPTLLYGLANVAGMCLMFWGPQS
FT                   RMMDAVALALIGYAIGGLVVFLAGLTACDLMPKTAVGAVKGFIGLCSYIAASIQELVSA
FT                   ALIKTSEIDGVTHYDFSSAQYFWLGASVVSMLLAMTVWNAKKVVNH"
FT   gene            33247..34461
FT                   /locus_tag="AHA_0031"
FT   CDS_pept        33247..34461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0031"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38931"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR12"
FT                   /protein_id="ABK38931.1"
FT                   /translation="MLPFSTLQAASLTVLTSFSEAPVKAVIEGFAEQYPGVRIEVIYRR
FT                   TIPSLRLLTEAGAPKVDIIMSSSPTFFNTLDKAGLLAALPNETMPPKWLTPHTLGLGNK
FT                   VAVVGYSSSGIMYNRHYLAKYQLPLPTTWQQLASPLFMGHVMMSSPSQSGTTHMMVESV
FT                   LQQYGWQQGWALLMRLGGNLSAITARSFGVSDGISRGLAGAGLVIDSYALNSQARFDHV
FT                   GFNIMPDSVILPTYLGVARHSTQPASAALFIQYLLSDSGQAIIATPGMAKATLSQPRLA
FT                   RQTRYVTDKALLYRRAGLLKALFEQTITQQRPRLKMTWQGINGLNTHGEPWRVALLEQA
FT                   VAKASTPPLSEQEAQDPALLALFDGLYDREQGNPQAERVMHQWRQATEARLHEAQRLVE
FT                   QAARP"
FT   gene            34458..36890
FT                   /locus_tag="AHA_0032"
FT   CDS_pept        34458..36890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0032"
FT                   /product="hypothetical phosphoglycerate transport
FT                   regulatory protein PgtB"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36282"
FT                   /db_xref="GOA:A0KR13"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017116"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR13"
FT                   /protein_id="ABK36282.1"
FT                   /translation="MSRLGRMLAMPRTLGRRLILAFVTITALTGAMGMAAYVMWDRLGR
FT                   QIHLIVEESLPAIDGAYQLERASSRLLLLLAQLRDTRDPVQYQRLSNAVSTTLRDIQRA
FT                   YLLGTPGDQTPSQRQAFEELGALVADHGRYLKPQIDHAETLQQLQKRSNWLHQDLVDDA
FT                   APLLQEVEWHLTSMVASPDDMSEFGNVIKEFSALQDLTFKENELQSLVGEVIAQRYQQD
FT                   LESAFLFIGYKIDEIDALTSRLAEYPSTVSYRQILQDIITLVKPDGPLHRLLLADVLTH
FT                   QQLTALRPRLDDAVSRYHQRVSLMVSDANRSLSALGEDSSQLVATGKLVILVVLALTLL
FT                   LSIFVLVVLIGRRLIKRLDLLGQELDRVAAGRLDVPVSTCGRDEIGRLGDSLRHFSLQL
FT                   QQMERANALNLINNTQACLITCHPDGTIESVNPSALTLFQQTGVEPGQPLWQAFPAEAG
FT                   VVLADQFRAGQPLHRFGHSECTLACGLGEAPRFLHLNLRRFEQGRGYRFIITITDVTRQ
FT                   ELTARELSLRVAERTRELTENNRLLAEEVVQRLQAERTLLQTQDELIQAAKMAVVGQAM
FT                   TSLAHELNQPLSAMMTYLYTSRTALATGQLQALDQDLGRLDKLGRRMSRIINALRHFAR
FT                   KSPAEEVRVRLALGALAEQAMLLLETRAKRDGCILCNELPDGLWLETDPVLLEQVLVNL
FT                   LVNGLDAVAGLTRREIRLQLLERSEARLRLAVVDSGAGFSEAILPRLFTPFTTSKEVGL
FT                   GLGLTICRSLLARCGGEIMLGSALTGGAMVIMEFALADPAGSVAHQNEENAIDAVAR"
FT   gene            36874..38151
FT                   /locus_tag="AHA_0033"
FT   CDS_pept        36874..38151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0033"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein DctD"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36763"
FT                   /db_xref="GOA:A0KR14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR14"
FT                   /protein_id="ABK36763.1"
FT                   /translation="MLLPANRPANVLLVDDDEDVLESYCHLLRLSGYHPRATTSPHEAL
FT                   ALLADQWPGVLVSDIYMPAMNGMDLLASVQALDAEIPVIMITGHGDIPLAVRAVKQGAF
FT                   DFLEKPLNPQDLLGLLERACRQRSAVLARRSEIQATVDDELIGSSPQIVTLRSQLNQLA
FT                   QTDKDLLLEGPAGSGRHTLARLLHRISARREQAFQLHDCVSAPSLAEVQASLAQAGQGT
FT                   LVLQSPARLSADCQRWLGNHLLDQERKGSKSLRAIGLFDESPEALVERQQLMPELYYFL
FT                   SQVRLKLPRLVERSCDIIPLFRAFLRQGCKRIGRPVPAVDRAYLETLKRHQWPGNLREL
FT                   RNVAELYAVGIVKLAGAEQVIPLASGKEPLDDLVEEFERRVIEDTLFLFSGRVTDAAQY
FT                   LGIPRKKLYLRMKKHQLDKDRFKPAT"
FT   gene            38203..38517
FT                   /locus_tag="AHA_0034"
FT   CDS_pept        38203..38517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37253"
FT                   /db_xref="GOA:A0KR10"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR10"
FT                   /protein_id="ABK37253.1"
FT                   /translation="MRCPHCMSEGVARIEDERVKRACALGLGAAGGYACAATLARMGAA
FT                   TGSVLGGVGTVVGALAGALGGAVLGGLMGGGLGWWLGRTLDRRLSRHYRCGVCGHRFSR
FT                   "
FT   gene            complement(38565..39377)
FT                   /locus_tag="AHA_0035"
FT   CDS_pept        complement(38565..39377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0035"
FT                   /product="hydrolase, Cof family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37704"
FT                   /db_xref="GOA:A0KR21"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR21"
FT                   /protein_id="ABK37704.1"
FT                   /translation="MYKVVVSDLDGTLLNGQHQISPRTRDTLHRLVDQGIKFVVATGRH
FT                   HVDVRSIRDTLGLDIYLITSNGAVVHDKQDQLIFNQALPDGVAAELIALERDPSIHINL
FT                   YYGDEWLVEEEMPWLLQFHHESGFSYRLTDLASHPLDKVNKVFYIGEHEKLLQIEAELN
FT                   QRYGDRLNVTFSLPDCLEVMHAGVHKGNAVRAVLEQHGLEMSQAVAFGDGMNDFEMLSM
FT                   VGRGVVMGNAHDRLKLALANHEQTLSSDEDGVAVYLEQLFALQGVNVA"
FT   gene            complement(39471..40511)
FT                   /locus_tag="AHA_0036"
FT   CDS_pept        complement(39471..40511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0036"
FT                   /product="lysophospholipase L2"
FT                   /EC_number="3.1.1.5"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38149"
FT                   /db_xref="GOA:A0KR22"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR22"
FT                   /protein_id="ABK38149.1"
FT                   /translation="MNLLSPALLALTLFSAGALAVNNPYQLTPEADVATLHQQTLPDFW
FT                   RQHAVESAFKGKDGITIRYAALRQAKVDRAILIVNGRVESYLKYQELAWDLWRQGYSLY
FT                   LIDHRGQGLSDRLLADQEKGYVDQFDDYVLDLKQFHDEVIAQDQPAKLFLLAHSMGGAI
FT                   SARYLERWPDDIEAAVLSSPMMGINLGGLPKWLAKGLAATIGTVGGWLGEPPYGPGQGP
FT                   YESHDFADNGLSHSEARYQAFRELYEQRPQIKLGGATAHWIYQGLTGADAAVAEAGAIK
FT                   TPLLLLQAGDDGVVDNAAQDAFCALARCEGGKPLRIEGAWHELFMEADPQRQAALNATL
FT                   AFFARY"
FT   gene            complement(40508..41173)
FT                   /locus_tag="AHA_0037"
FT   CDS_pept        complement(40508..41173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0037"
FT                   /product="chloramphenicol acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38526"
FT                   /db_xref="GOA:A0KR24"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR24"
FT                   /protein_id="ABK38526.1"
FT                   /translation="MENPFGSWLESQVIRDHLTNPNIEAGEYSYYSGYYHGKPFEDHCV
FT                   RYLLGDGSMRESWDSGQWGKEVDRLIIGKFCSIASGATFMLAGNQGHRLDWVSTFPFDA
FT                   ARFGDGVQDGFLRKGDTRIGNDVWIGSEAMIMPGITIGDGAVIATRAVVTKNVAPYTIV
FT                   GGNPAQPIRRRFGEEQIAMLQEMQWWDWPLQHLQAAMPLLCSGDIQALYRHWQQECTS"
FT   gene            complement(41173..41934)
FT                   /locus_tag="AHA_0038"
FT   CDS_pept        complement(41173..41934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0038"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39812"
FT                   /db_xref="GOA:A0KR25"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR25"
FT                   /protein_id="ABK39812.1"
FT                   /translation="MHTPHDIETDMTPERFKRITDMLAQRQLDLTVCMEEVHKPHNLAA
FT                   IVRTADAIGIHRVHAVWPKTWIHKRKGTARGSQNWVDVKLHPDIGSAVAELKASGMQIL
FT                   ATHLSDSSVDFRAIDYTKPTAILVGQEKHGIGEEALALADHHIVIPMVGMVQSLNVSVA
FT                   AAAILYEAQRQRELAGCYQRGCPLDLEEQNSILFEGGYPIYAQLCKEKEMPYPQLGPAG
FT                   EILADEQWWQQMQLTRKGWAAQQEEDEWQDQ"
FT   gene            complement(42129..44246)
FT                   /locus_tag="AHA_0039"
FT   CDS_pept        complement(42129..44246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0039"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase ((ppGpp)ase)"
FT                   /EC_number="3.1.7.2"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM PF02824; match to protein family HMM PF04607;
FT                   match to protein family HMM TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39363"
FT                   /db_xref="GOA:A0KR26"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR26"
FT                   /protein_id="ABK39363.1"
FT                   /translation="MYLFENLKEIASSYLPPEQVEKLRQAYVVARDAHQGQMRSSGEPY
FT                   ITHPVAVARILGDMRLDHETLMAAVLHDVIEDTPVTKADLAELFGDAVAELVAGVSKLD
FT                   KLKFRDRKEAQAENFRKMVMAMTQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIFAPIANRLGIHTMKNELEELGFEALYPMRSRVLRESVRRARGNRREIIDSIQSEIEG
FT                   RLREAGIESQVSGREKNLFSIYNKMEKKELQFHEVMDIYAFRVRVKDIDTCYRVLGQMH
FT                   SLYKPRPGRFKDYIAIPKTNGYQSLHTSLVGPHGVPVEVQIRTEFMDQMADKGVAAHWA
FT                   YKQDGDSSGTTAQIRAQRWMQSLLELQQSAGSSFEFIEGVKTDLFPDEIYVFTPEGRIM
FT                   ELPAGATPVDFAYTVHTDIGHACVGSRVDRHPYPLSSPLHSGQTVEIITAPGARPNAAW
FT                   LNFVVTTKARSKIRQFLKNLRTEESVVLGRRLLNHALGAKNIEDIPEPRIKQVLADTKH
FT                   ENLQGLLADVGLGNAMSVMVARRMLGDELPPEEQPKSSSKKMPIKGADGMLVTFANCCR
FT                   PIPGDAIIAHISPGKGLVIHQEACRNIKGYSKEPDKYLPVQWEVDKEQEQEFRTGISIE
FT                   IVNHQGALAELANVIAATGANIHAISTEEKDGRVYLVTLLITTKSRIHLANIMRKIRVM
FT                   PNVLKVSRQKN"
FT   gene            complement(44384..44659)
FT                   /gene="rpoZ"
FT                   /locus_tag="AHA_0040"
FT   CDS_pept        complement(44384..44659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="AHA_0040"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37121"
FT                   /db_xref="GOA:A0KR23"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KR23"
FT                   /protein_id="ABK37121.1"
FT                   /translation="MARVTVEDAVKQVGNRFDLVLVAARRARQIAVQGKDPLVDEENDK
FT                   PTVIALREIELGLVNNQVMDTQDRYEQQEQEAAELAAVAAIAEGRG"
FT   gene            complement(44739..45593)
FT                   /locus_tag="AHA_0041"
FT   CDS_pept        complement(44739..45593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0041"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36516"
FT                   /db_xref="GOA:A0KEC4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC4"
FT                   /protein_id="ABK36516.1"
FT                   /translation="MAADVGDAPAASYEYFDRLEYDSGRFFIRHLLLKFAAFTSLSIQE
FT                   FSAFRIWLSPFRAQDGGLCYNQNTVSLKGTDMAQQGTLYIISSPSGAGKSSLLNALLTQ
FT                   HNSAGKMQLSVSHTTRATRPGEEHGVHYHFVKVEEFKALIERGDFLEWAEVFGNYYGTS
FT                   RAAIEACLAQGIDVFLDIDWQGARQIREQMPTKSIFILPPSREELERRLIGRGQDSAEV
FT                   IKGRMEKAIAEMVHYDEYDYVIINEDFEQALFQLRAVIECQRLELRQQQQAQQNLLQQL
FT                   LAE"
FT   gene            complement(45637..46719)
FT                   /locus_tag="AHA_0042"
FT   CDS_pept        complement(45637..46719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0042"
FT                   /product="lipopolysaccharide heptosyltransferase"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37994"
FT                   /db_xref="GOA:A0KEC6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC6"
FT                   /protein_id="ABK37994.1"
FT                   /translation="MPLFQTPPSSICILRLSAIGDCCHALALVRVIQRTWPTTRITWIT
FT                   GKIEATLFADLPGVEVIAFDKSKGWRGYRDLWQTLRGRQFDALLHLQAAMRASIATLGI
FT                   RAKVKLGFDRERASDGQWLFTNHKVPSPASPHVLDGFLAFAKELGIQDLTPDWQLPISA
FT                   EHQAWAKEKIDGKPTLLICAAASKAFKNWTAAGYAALADHAAGKGFQVYLCGGPAKLER
FT                   DLAADIQRLSHSKPVDLVGQTNLKQLLALIKEASLVLAPDTGPTHMAALVGTPVLGLYA
FT                   HHNPDRTGPYLCRDYAVSVYQELVEQETGKPLAELGWRTRLKDPDAMSKITRERVIAAF
FT                   DRLCADRQLPAGKQLGISEQ"
FT   gene            46888..47601
FT                   /gene="kdkA"
FT                   /locus_tag="AHA_0043"
FT   CDS_pept        46888..47601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdkA"
FT                   /locus_tag="AHA_0043"
FT                   /product="3-deoxy-D-manno-octulosonic acid kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:O86224; match to
FT                   protein family HMM PF01163; match to protein family HMM
FT                   PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37483"
FT                   /db_xref="GOA:A0KEC7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC7"
FT                   /protein_id="ABK37483.1"
FT                   /translation="MQIQTEHNQICWYAEGAFRDPSPELFDPAWWQTHRQVVGSSIGRG
FT                   VTWFVKDESRHLVLRHYYRGGMVGKVVRDRFWFEGVESSRAMAEYTLLAKLSAQGLPVP
FT                   RPFAARMAKQGPFYRADILIERIRGAKDLVALLKQGPIAGEVWHKVGQTVRRLHDAGVY
FT                   HADLNSHNLLLDKEGKVWVIDFDKGAIRSPGNWQQANLERLLRSFNKESQLHTSFHFVP
FT                   ENWQALMNGYQGKAS"
FT   gene            47729..48535
FT                   /locus_tag="AHA_0044"
FT   CDS_pept        47729..48535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0044"
FT                   /product="sensory box/GGDEF family protein, putative"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38895"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC8"
FT                   /protein_id="ABK38895.1"
FT                   /translation="MADAIALLEAGLWSWSPQQGVQRDLSCLRLLGLNEAGLDDLGWLE
FT                   RVHPDDVGNLQEALTACQSGRVAQIRLEYRILHHDGHYVRLEERARRDVHGQVLGVVCL
FT                   LDSQTLPVEERNGTDPLTGLESRSHFELLLDERLASESGSFSLLQFSVDHRAKIQQLFG
FT                   EVACDAMLAKLARIVRHELRREDPFARWDEDGFILMLSQTDRLSGLEIAERLRLEIADA
FT                   SLLPQRPVTVSIGLVQSQAGEQIDHLLARLATCHGQARREHNTVVG"
FT   gene            complement(48543..49397)
FT                   /locus_tag="AHA_0045"
FT   CDS_pept        complement(48543..49397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0045"
FT                   /product="hypothetical membrane protein YigM"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38323"
FT                   /db_xref="GOA:A0KEC9"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC9"
FT                   /protein_id="ABK38323.1"
FT                   /translation="MNYLIGVTLLWSFSFSLIGVYLAGQVDAYFSVLTRIVLASLVFLP
FT                   FLRRRWLRPDLVAKLMALGATQLGIMYLFYYHSFLLLTVPEVLVFTIFTPIYVTLIHDL
FT                   LERRFKPTYLWGALLAVLGAAVIRFDGLTESYVLGFLVVQGANICFAIGQVGYKVLLAR
FT                   EKEQPPQLAVFGCFYLGALVVALPAWLLLGTPQYPTSTLQWGILLWLGIGASGLGYFLW
FT                   NKGATQVSSGVLAIMNNALIPAGLLVNLLLWGKDTDLLRLTLGGLLMLASLWVCQRHGV
FT                   SER"
FT   gene            49441..49899
FT                   /locus_tag="AHA_0046"
FT   CDS_pept        49441..49899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39790"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC5"
FT                   /protein_id="ABK39790.1"
FT                   /translation="MAEIEALIQRLWRQLPQIGAFAFTASNAEGSATDWCGSGEGEVVV
FT                   TDHQGGWLFAEQGRYTTPHGRVLAMHNRFWWQRGEQGIRLSHLRYEQPVVLFELLPQAD
FT                   GCWLTAEPHLCGQDHYSAELTPSGDGFLLGWQITGPRKNERLSYRYQE"
FT   gene            complement(50054..50215)
FT                   /locus_tag="AHA_0047"
FT   CDS_pept        complement(50054..50215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39188"
FT                   /db_xref="GOA:A0KR06"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR06"
FT                   /protein_id="ABK39188.1"
FT                   /translation="MSGILTTLCGGLVVIAGWQYRQRLMGLLGLLMVLLPWLFDSKLQA
FT                   MLSYALSA"
FT   gene            complement(50200..51129)
FT                   /locus_tag="AHA_0048"
FT   CDS_pept        complement(50200..51129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0048"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38459"
FT                   /db_xref="GOA:A0KR07"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR07"
FT                   /protein_id="ABK38459.1"
FT                   /translation="MRRRITSEIKMRSYLLLLAIGLLWGSQFIFMHQAVTELPPIMVAA
FT                   GRALCGSLTLGLLCLFMRLKSEHTPWRTYMLIALLDATLPFIMVAWGQQYVDSAIAAVV
FT                   MGCIPFVTILMAPLLVSGEKITKGGLVSVVIGFVGVLVLFWPKLTSGMNAGLLGAMAIL
FT                   FGASCFAIGLLMIKRFAKDHPVVVARNILISSAIQLLLAAPFVTDLSALTMPSQHAIGA
FT                   VAVLGVFCTGLVYFLYMALIQKAGPTFASFSNYLVPLFGVMLGALFLGEKIQSTTGVAL
FT                   ALILGSVALNQWAQQRRVQREAALCQAS"
FT   gene            51191..52165
FT                   /locus_tag="AHA_0050"
FT   CDS_pept        51191..52165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0050"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38266"
FT                   /db_xref="GOA:A0KR08"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR08"
FT                   /protein_id="ABK38266.1"
FT                   /translation="MELPLSRLDLNLLTVFDMLMQERNVTRAAERLHLSQSTVSHALGR
FT                   LRTALDDPLFVMSRREMMPTERAKALAGPVRQALAMLEQGLRQAKGFDPASARRIFRIA
FT                   TPGSVEHGLVPALVERLHRHAPHCRLEVCELADSDYERELEKGELDLVIGFADANHLSP
FT                   RLWREPWFNNPLVCLSPLGSELPDVLGPDDLVSRPHIHTSSWGHSQAMVDLWLARFGVE
FT                   RELGVRLPSFMAVPPLMATGRYLVVVPEMIGRHFCRYYPLRLHQLDPDIPIVYLMAGHP
FT                   LTAHDEAIGWFKGLLHRLAFERYGADALGSPAQRGADQFNPAK"
FT   gene            complement(52144..53157)
FT                   /gene="trpS-1"
FT                   /locus_tag="AHA_0049"
FT   CDS_pept        complement(52144..53157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS-1"
FT                   /locus_tag="AHA_0049"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38825"
FT                   /db_xref="GOA:A0KR04"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR04"
FT                   /protein_id="ABK38825.1"
FT                   /translation="MHNPVILTGDRPTGKLHIGHYVGSLRQRVEAQHHYRQFVMIADLQ
FT                   ALTDNGHNPAKVTDHVLEVMADYLAAGLDPTKTTFCLQSALPALAELTTYYLNLVSVAR
FT                   LERNPTVKAEIQQKGFERSLPAGFLIYPVSQAADITAFRATHVPVGEDQLPMLEQTNEI
FT                   VRRFNTLVGKEVLTECQPILSDTGRLPGIDGKAKMSKSLGNTIELGMSAEEIKQAVFAM
FT                   YTDPNHLKVSDPGQVEGNTVFAYLDAFHPDKALVAEMKAHYQRGGLGDMRCKQVLNDCL
FT                   QTLLAPMRERREAAIADKHQLLRLLQQGTEQARALTDEVLAEVKGAMGLDYFAGLN"
FT   gene            complement(53349..53783)
FT                   /locus_tag="AHA_0051"
FT   CDS_pept        complement(53349..53783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0051"
FT                   /product="universal stress protein A"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35943"
FT                   /db_xref="GOA:A0KR05"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR05"
FT                   /protein_id="ABK35943.1"
FT                   /translation="MNGTYYKHILAAIDLSEDNRKVIEKAVDRARSNGAKLSVIHVDVD
FT                   LKDLYTEMIDIDIDNVQDQVIAEAKEKLEAFLASVDYPIEKKLVICGDLSERVNQAVRD
FT                   YQIDLLVCGHRQSFWSLLTSSARQLMNTVPCDLLVVPLQK"
FT   gene            54250..55437
FT                   /locus_tag="AHA_0052"
FT   CDS_pept        54250..55437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0052"
FT                   /product="trans-2-enoyl-CoA reductase"
FT                   /EC_number="1.3.1.44"
FT                   /note="identified by match to protein family HMM PF07055"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37443"
FT                   /db_xref="GOA:A0KEB7"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB7"
FT                   /protein_id="ABK37443.1"
FT                   /translation="MIIHPQIQGCVARNCHPIGCRAAVLQQIASVRAAGSFNGPKRVLV
FT                   LGASSGFGLASRIALTFGAGADTVGVSFERGPSDKGPGSAGWYNNIWFRKEAEQTGRIA
FT                   INLIGDAFSIGMRQQAIDTIRQQLGQVDLVIYSLASGIRVLPDGTQVRSVLKTTSQPFS
FT                   GWGLDLEHDTLVQQSLDPATPEEIRDTVSVMGGEDWQLWLQALQQADCLAPGAQTVAYS
FT                   YIGPESTYPLYRDGTIGYAKEHLHATAETINLQLAELGGHAWVSVCKALVTKASAYIPV
FT                   LPVYLGLLMGVMKERGVHEGCIEQMQRLFATKMYGPQGVVADGNRLIRMDDHELDPAIQ
FT                   AAVSALWSKVTPDNFHALGDFAGLRQDFMQLNGFELPGVDYGAPVDLASLTELLP"
FT   gene            complement(55453..57243)
FT                   /locus_tag="AHA_0053"
FT   CDS_pept        complement(55453..57243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0053"
FT                   /product="tetratricopeptide repeat family"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM PF07721; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37133"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB8"
FT                   /protein_id="ABK37133.1"
FT                   /translation="MALALLWMTQLQATPSLLKEAELQAARDPVGYLQRLDANPQQDME
FT                   QFYARALAQAALGRYPQALLDNARARGLASAQQETLRLLDFRLQQIALTLDTEAPDQAL
FT                   TLLEQLKPAVAGHPQQTSEWHALNGLALYRTQQLSAAIAELKTAFRLKQTIPDSTLASL
FT                   QCARLLMTLGNLYADLNLAREAESYYLEALQRMVQLDEPNSQTIIRANMARLYIDTDRP
FT                   AQARRLLDNLLSNPALAPDYRAIILGYQAMALNAERDWAGALRALDEAQALYQQLGYPE
FT                   AGVRLLETRARALQGSGEKQLALQLLTSQGPAGAGSKALQASLLADQGRYPEAYQALNE
FT                   YVNDYKQHFNQTLSQHASAFQAEMDLARSEASNRVLQQENENKRQQLLHQQSARHYQLA
FT                   LVGLLASALLLLGVTTHRLHRSSRHLYKLATFDQLTELPNRRALLERLATQWQQEGPLT
FT                   LLIIDIDHFKQINDRHGHQAGDRAIQRLARELRSWAPDLQLVGRWGGEEFLVAVPLPAA
FT                   DCWYLAEQLRQRIGQIDKPRMTISIGVAGRSAADDGLGQLIHRADMAMYQAKRQGRNQT
FT                   ILAAEPLNPEQPEALASSVA"
FT   gene            57348..57977
FT                   /locus_tag="AHA_0054"
FT   CDS_pept        57348..57977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0054"
FT                   /product="ferritin"
FT                   /note="identified by match to protein family HMM PF00210"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37728"
FT                   /db_xref="GOA:A0KEB9"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB9"
FT                   /protein_id="ABK37728.1"
FT                   /translation="MRRKAVTTESSGSGIWLLHNETVATIVTKSQWRIIMLAKAMIEKL
FT                   NEQINLEFYSSNLYLQMSAWCEDKGFEGAANFLRQHAVEERQHMERLFTYVSETGAMPL
FT                   LGAIDAPPHEFKSLGDIFRTTLEHEYHITKCINGLAHVAFTTQDYSTFNFLQWYVAEQH
FT                   EEEKLFKSIVDRLSLVGEDGKGLYFIDKELAELAKGAPASIMDGNA"
FT   gene            58135..59322
FT                   /locus_tag="AHA_0055"
FT   CDS_pept        58135..59322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39782"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC0"
FT                   /protein_id="ABK39782.1"
FT                   /translation="MMKQFDVVVIGAGAAGLMCAAQAGYRGRSVLVLDNAKKPGRKILI
FT                   SGGGRCNFTNHQAGPHAFLSANPHFCKSALARYTQQDFIDLVDRHGLRYHEKTLGQLFC
FT                   DESAKEIVDILLTECDWAGVALQFQTEILTVSKTDDGFMLTTSQGEISCHSLVVATGGL
FT                   SMPKLGATPYGFKLAEQFGLKVLPTRAGLVPFTLHQAEKEAFVDLAGVSLPVAVTAEDG
FT                   TCFKEAMLFTHRGLSGPAILQISSFWLAGEKIHINLLPELDIAATLREWAQAHPAQELK
FT                   TVLGRELPKRFVDKLVELGQLVSKPMRQYNERELEAVATLLGDWQILPNGTEGYRTAEV
FT                   TLGGVDTNELSSKTMEARKVAGLYFIGEVVDVTGWLGGYNFQWAWSSGWVAGQYC"
FT   gene            complement(59510..60730)
FT                   /locus_tag="AHA_0056"
FT   CDS_pept        complement(59510..60730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0056"
FT                   /product="fosmidomycin resistance protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39174"
FT                   /db_xref="GOA:A0KEC2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC2"
FT                   /protein_id="ABK39174.1"
FT                   /translation="MEKSLSTDQPLAAATAHDALNRTTYPVIAAISFSHLLNDMMQSVL
FT                   LAIYPLLKLGLNLSFAQIGLITLTYQFTGSLLQPLIGLYTDRRPMPYSLPFGMGFTMIG
FT                   LLSLSQAASFGAVLLSAMLIGIGSSVFHPESSRVARMAAGSQPGLAQSLFQIGGNLGSA
FT                   IGPLLAALIIVPQGQGSAAWFSLFALVGVIVLSLVGRWSSHHAANFHKRMKAHLGHGLS
FT                   RRQIGWSLATLGLLMFSKFFYMASLSSYYTFYLMDKFSLSLDSAQLYLFAFLFAVAAGT
FT                   VLGGPIGDRIGRKRVIWISILGVAPFTLLLPHVDLFWTSVLSVIIGLILASAFSAILVY
FT                   AQELVPGKVGTISGLFFGFAFGMGGIGAALLGQLADATSIETVYQVCAYLPLIGLLTAF
FT                   LPTLRKG"
FT   gene            60918..61556
FT                   /locus_tag="AHA_0057"
FT   CDS_pept        60918..61556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0057"
FT                   /product="lysine exporter protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39777"
FT                   /db_xref="GOA:A0KEC1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC1"
FT                   /protein_id="ABK39777.1"
FT                   /translation="MFESLGVINVWTYLVGLFFIIIAPGPNSIYVLRTGASRGVGPGYQ
FT                   AALGVFVGDAILIFCAYLGIASLIRTTPLLFTLVRYLGALYLLYLGVKILHANFIARRE
FT                   GQASVVEHGERYFSKALTLSLTNPKAILFYVSFFVQFVDFNYAHTWVSYLVLASMLEAM
FT                   SFVYLTLLIFGGTLMARFFARKVRLARLGNGLIGLFFMGFAARLATLSS"
FT   gene            complement(61600..62346)
FT                   /locus_tag="AHA_0058"
FT   CDS_pept        complement(61600..62346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39511"
FT                   /db_xref="GOA:A0KED6"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED6"
FT                   /protein_id="ABK39511.1"
FT                   /translation="MGRGSTAKRYHYHQRNLALTMKNDMHRILWFLLAGTLSSQAMAID
FT                   IGAMTIAMAPNEEFIARTVTNNSGSPKVYEVQMEKISNPTATGTSVPTVPGELLFAPKR
FT                   FTLHAKRMQNVKLYYKGPADGQERYYRITFTESPAAQLDESGQARRRGALEMKLALQST
FT                   LVVRPRQVRFQYQLDPARSSITNTGNTYFEFMVKRGCLQADSEADSKYLLPGETYQNPT
FT                   IGQAGNQKLIVYQSRFIRVGKDCWPD"
FT   gene            complement(62289..63905)
FT                   /locus_tag="AHA_0059"
FT   CDS_pept        complement(62289..63905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED7"
FT                   /protein_id="ABK37902.1"
FT                   /translation="MNPAYKWLLAMVIATSWASQASAAVIKYNLVDADLRHFLFIENQE
FT                   DHNLFITPTDYLDPRLTGGNAWTTDSRQVSLAYADNGHNYTVTNYNIDMWENGPVKYPY
FT                   INQRCIKSWAGCDPQTAEAMNKPASVNETGFFGLMKAATGYAHAKLSSAFFGYLRTMPA
FT                   GGILNREMNLCMTTRIYDAAAGERCINQDSGTWYVKRTQHKKAGHLRFIQTNAISEVIV
FT                   DSNGAPYVLPGSQGCENYRLGTRDGVLCRFLDYDFNQDGSQSFSDPYIYTNIKNAALNS
FT                   AIVGGDVQMSANLTNWALKGADYNVSYLRGQSSIYLFLSSNFFKQVVRLGLQEQLTRNL
FT                   INFNMRNIKAPESGFYEFSGTTEIIIKPRDFSVSILSSEGVSNPYREGNVGKDILSFSY
FT                   NISDSGPISADMLEITVSQDIGAPYQGLCTFYPAGQAVPEQAVPIPTRLVFDSTNHGTA
FT                   SRHAVRCDQTPLDIRTLGIQDSQPPQEWNDPVSGKSITRFYKLALEFDLTDPMVQRTIG
FT                   NDLWEGEVQQSGTITIKGTWR"
FT   gene            complement(63908..66385)
FT                   /locus_tag="AHA_0060"
FT   CDS_pept        complement(63908..66385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36686"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED8"
FT                   /protein_id="ABK36686.1"
FT                   /translation="MPKSETMVRDMLKKTCLLPLSLLMVVSASANSAAPLKIANVIIPA
FT                   SFAQALAEGLAVPVRLQYTDEKNRLDTLTDNPIGNATLLLQDGKLHLLHIDFGAGQQQG
FT                   LLNDQLTAMLASEEKRTFSAEGSLQIDANASMQLDLVAMLLTIRVSRDAFGQARQPDNR
FT                   VTLTPTVDTLTGVHRYNLGYSFNSNRQNGHSDSNFLQLDSTVGMGAHHMALDASLYNLG
FT                   EPEQSGDIYRAMYERDLDDRRIAAGMVSTWDLQTLGVVTGLSTGRIYGASYGNQAQSRK
FT                   QKADTSTTPVQVFMPANGEVRVYREDRLISLQNLAIGNQNIDTSAFPSGVYNVTVEVYV
FT                   DGRLTSTTTQRVTKLGGSLGFTQEWGWQWWGGMMEGAQNNGDSPLLGVSLARSLDTLEL
FT                   ATTTYAFKDAAVGEARANWQATDRVSAQLQTMLASDQSWRFASSLALQAHDNASLWLSQ
FT                   EKLETGSALTVSNAELYSAGITLNLGGWVSGLGQLTFNTLHDRQMNSDRSYADYYQHLY
FT                   AGKYGNLSLRASLQSDSGTLNGFNNKSITLDYSIPFDNLFSFGMSSNEQGQTTANVNYQ
FT                   KRMDGVINLASFNASRMMHGSDEHNMALSGTLGFENRVIGGTMTLGRGHGGDMNGNLIA
FT                   RGALVTTEDALVASSRSSSGAGLIINTGIDRQGQMLAKVNGQDYPLHGEQTFLALPPYG
FT                   EYEIELLNSKRGKDSYDINTGKQRYTLFPGNVATLDASSTIKEMVTVFGILRAEDGSLL
FT                   ANARIDNHIGTTVTNEEGEFSLDVDKANPMLTFRQGNDFCEAELDLEKYSGAAWVGIIT
FT                   CQGLPTYAMVREY"
FT   gene            complement(66437..67102)
FT                   /locus_tag="AHA_0061"
FT   CDS_pept        complement(66437..67102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39283"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED9"
FT                   /protein_id="ABK39283.1"
FT                   /translation="MNLKMLLAWMLFIPGVSQAINVGSVTTFIDAGSQDVAKEIENGSA
FT                   QARLVTISVSRISSPEEGGQEIPMEVAGELMLSPSRLMLPAHAKNNVRFFYKGPQDGKE
FT                   RYYRIRWLDTALSMDDQSNNRRQAVATTSAQIGTILVVTPRQQHFAYNLQNGMLSNQGN
FT                   ASYRTVAYGPCLDRKAQAQCKETYYDLPGKQRRFKKVDMQDPQSHLGLWLGQEFVVVK"
FT   gene            complement(67162..67737)
FT                   /gene="matB"
FT                   /locus_tag="AHA_0062"
FT   CDS_pept        complement(67162..67737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matB"
FT                   /locus_tag="AHA_0062"
FT                   /product="fimbrillin MatB"
FT                   /note="identified by similarity to GB:AAK01671.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36009"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE0"
FT                   /protein_id="ABK36009.1"
FT                   /translation="MKKTLIALTVAGLGFAAAAQAAVEATPAIATWKATAKKDTESALV
FT                   VTPLDSLSFQYAEGIKGFNTVNGLFDVAIKGDASATDFTLKAKKLSGTLNHLSGGSTVD
FT                   VGVLWQGAPVSTTAYTTLIDTAAGITGGNLSPLASSFKDDTQRSTAQGSFTFNIESATV
FT                   NGTEAAFETLPDGLWSGEVNVEFVANWS"
FT   gene            68337..68960
FT                   /gene="evgA"
FT                   /locus_tag="AHA_0063"
FT   CDS_pept        68337..68960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="evgA"
FT                   /locus_tag="AHA_0063"
FT                   /product="positive transcription regulator EvgA"
FT                   /note="identified by similarity to SP:P30854; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36068"
FT                   /db_xref="GOA:A0KEB1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB1"
FT                   /protein_id="ABK36068.1"
FT                   /translation="MAKILVVDDHPAIRMAVNILLQQDDHHIVAEVDNGVDAVLMARKY
FT                   QPDMVVLDIGIPRLDGIEVIKRLKEMDADIKVVILSAQATHHIMVRCLQAGANGFISKL
FT                   DDLSLLKTVLVKIGKGQLYFPRDVIAGAKNAHEVDRKDLLSALSDREMSVLLQICQGQT
FT                   NKQIAESMLLSEKTVSTYKSRLMQKLNVTTMVDLISLAKRQELL"
FT   gene            68963..72550
FT                   /locus_tag="AHA_0064"
FT   CDS_pept        68963..72550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0064"
FT                   /product="virulence sensor protein BvgS"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36911"
FT                   /db_xref="GOA:A0KEB2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB2"
FT                   /protein_id="ABK36911.1"
FT                   /translation="MRHWFAALLVCCCASWASAHELAAPYLHVYARNDSEYLEKQTLPL
FT                   HAEDWLWLRNRGRLVLGVPMPDNPPMDITLRANAYEGVTADIVGMLSHLLRVEIVVKNL
FT                   PSRAAAIAALKRGEVDLLSTSNAYEEEQQLLLTDKYMPDDPAIYKNIHVKERDIRTVAV
FT                   PEYYLPALDVMRYLPKVQIKMYSSRYSALSAVAYGQVDAVMLDMISGNFIVNKFYQDSI
FT                   QLLKPLYIDTHGFSFSLERKNQRLKKIINIALDEILEGKREEIAKRWNGGGLSIGASKV
FT                   ELTSEQWAWLGQQKKIRMAVNSGVPPLSFLDINDTLHGVVADLLQVLRAKLGVEIEVVP
FT                   VKTPGQMLQLLDGGQVDIAVLSPSEERRSRYLFSRAFVLDPLAYVVGVRHEATAPETLL
FT                   KTGTVAIIKDFISEQAIEEEYGKLTTRKFERIEDALRCVASETCDVTVLPLRVAKYYIN
FT                   SKFPDSLLITGELFDSIPIGAAFAVSPKQHMLRDILDRVIAIIPPDELEGLSNRWRVST
FT                   QQEAITWQELVREFGGIIALIMLLTIWIGLWGLSLHKQVRQRRAAEVALSAQLKFIEDL
FT                   VDGTPHPIYARDREDRLVLCNSTYASFFGEDKSRLLGSTMAEDVQRWPFLAPLFEDLST
FT                   ARTVRCARQGDHRLSMATGSVAVYHWVQPYYDLEGNVQGGIGGWIDVSERLRLLEELAL
FT                   ASQDAQEANRAKSTFLATMSHEIRTPMNAIIGLLELTLRRDRLHEEDKTSLSIAHGSAK
FT                   DLLSLIGDILDISKIESGRLELRPEPHEITALTASVVTVFTALARQKNLQLELAAGEPR
FT                   WVQIDGICYKQILSNLISNAIKYTEQGAVRVELQSKTSDGWCTLQLVIRDTGIGIAPAE
FT                   QARLFQPFGQARQPEHIQRSGTGLGLMISRSLCESMGGSLLLESEPGHGTCISIEMKVP
FT                   LASAVESVTPVALGTMTGHHRRLRVMIVDDHPTNRLLVSQQLAYLGHDATAAESGREAL
FT                   ALFANTPFDVMITDFNMPGMSGFELTRQYRALELSRGTHRCLILGLTADARQEQVSEGL
FT                   TAGMDDCLFKPVGLEELERCLCRHMQHEEQREIERCVQEIKQCLGPLTGNQPALMLPLL
FT                   HEFVRASDDDLRGLQQAAEGGELARFLDYVHRLKGGARIMGAMKLVAVCSETESAGIGP
FT                   QGLPRALQPLQHAYGIVRQAIMQMQAEPE"
FT   gene            complement(72586..73026)
FT                   /locus_tag="AHA_0065"
FT   CDS_pept        complement(72586..73026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37460"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB3"
FT                   /protein_id="ABK37460.1"
FT                   /translation="MSQKGVLVALLAGCCAIAAQAGTQTYQLNWPATASKSTGMEISLT
FT                   HPGQQPVNSVSTSSPVQTEAINLSNPDFNTTYQLQARTLYASLPEQAGTDFKLVLNGQP
FT                   LPQHHALPLTQATRYFLSYLAPAAKPDQTGEAAYELLVYWHG"
FT   gene            73217..74872
FT                   /locus_tag="AHA_0066"
FT   CDS_pept        73217..74872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0066"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF06580; match to protein
FT                   family HMM PF07694"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38252"
FT                   /db_xref="GOA:A0KEB4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB4"
FT                   /protein_id="ABK38252.1"
FT                   /translation="MLLAVFERAALMLMTLFFLTRTRPFQRLFQKRDHTPAELVLVAAI
FT                   FCLFAVFSTYTGIPVEGALINVRIIAIISGGILFGPWVGIPAGVISGLHRYLIDMDGHT
FT                   SIPCLIASIIAGLLATWLHLRCRKSRLWLYGILAGMLCEGLTMLLIWLLTEPHAVGVEI
FT                   VSHIAYPMIAGALCIGLIIKLVQDLDDEKELIAAKQAKLALDIANKTLPFFQNIDRHSL
FT                   SQVCGIIRSEISADAVAITDTRDVLAYVGVGKDYYELDEHHAISDMTQRAVLLDQIIIN
FT                   NDLRQYHLSDFHSVIIIPLRENGSVSGTLKIYYRRTHSITSSLKEMAVGLSQLISTQME
FT                   VSRIEQLKEMTRKAEFTALQSKINPHFLFNALNAISSLIRIRPQQARQLIANLADYLRY
FT                   NLNKGDTLIDIQEELQQVRDYVAIEQARFGDKLEVVFEVDDVHIQVPSLLLQPLVENAI
FT                   LHGIQPRSAPGRVTIEVKQLAGGIRVAVRDTGYGISQAVIDGVAAGRVESRSIGLMNVH
FT                   QRVKLLYGDGLHLKRLEPGTEVSFYLPDQESMPC"
FT   gene            75002..75733
FT                   /locus_tag="AHA_0067"
FT   CDS_pept        75002..75733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0067"
FT                   /product="response regulator receiver domain"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38388"
FT                   /db_xref="GOA:A0KEB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB6"
FT                   /protein_id="ABK38388.1"
FT                   /translation="MLKAIIVEDEYLAREELAYLVGQHSTIEIVASFEDGLEAFKYLQD
FT                   HEVDVVFLDIQIPSIDGLLLAKNLHKSSHPPHIVFVTAYKEFAVEAFELEAFDYILKPY
FT                   NEPRLISLLQKLELAGKSQTGQGSEPGTPHNRTVNLVKGERIIVTPCEQIYYAEADEKL
FT                   TYVYTRDDRYVMTMTLSEFVSRLPAEGFFRCHRSYCVNINKIREIVPWFNSTYLIRLHD
FT                   LPFEVPVSRSNIKAFRQLMRL"
FT   gene            75855..77033
FT                   /locus_tag="AHA_0068"
FT   CDS_pept        75855..77033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0068"
FT                   /product="inner membrane protein YhjX"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38455"
FT                   /db_xref="GOA:A0KEB5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB5"
FT                   /protein_id="ABK38455.1"
FT                   /translation="MNRTRYLTLLGTIITQFALGSVYTWSLFNAQLSDKLDEPVSQVAF
FT                   AFGLLSLSLAVASSLAGKLQERFGVRNVTLGAGVLLGIGFFLTAHASNLAMLYLCAGIL
FT                   VGFADGTGYLMTLSNCVKWFPERKGLISACSIGAYGLGSLGFKYINLLLLSSNGLETTF
FT                   QLWGLIAMSMVLVGGMLMKDAPKQAAAVQQSESRDFTLAEAMRKPQYWMLALMFLTACM
FT                   SGLYVIGVAKDIGENMVGLPAVVAANAVAIIAMANLGGRLVLGILSDKMSRIRVITIAQ
FT                   LITLAGMALLLFVPLNANLFFVAVACVAFSFGGTITVYPSLVSDFFGLNNLTKNYGVIY
FT                   LGFGLGSIIGSIVASLFGGFMATFNLILVLLVVALVLSLTIRLPAPVSVERA"
FT   gene            complement(77107..78231)
FT                   /gene="purK"
FT                   /locus_tag="AHA_0069"
FT   CDS_pept        complement(77107..78231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="AHA_0069"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37904"
FT                   /db_xref="GOA:A0KEE1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE1"
FT                   /protein_id="ABK37904.1"
FT                   /translation="MILPPATLGMLGGGQLGRYFVMAAHRLGYKVVVLDPDPASIAGAA
FT                   ADHHIVAAYDDPTALHDLASRCAAVTCEFENVPATALALLEQYQPVRPAAGAVRICQDR
FT                   REEKAFLSRAGIPVAPNQTLLPGEPLPALPASLFPAILKTAREGYDGKGQWTIQAADQL
FT                   PAALAASGVPCVLEQRLALEGEFSLTLARSPSGAIGALPLVQNWHSGGILDQTRSPANV
FT                   PALEADARRIAEQLIAALDYVGVLTVELFLVAGKLLVNELAPRPHNSGHPSLDNAECSQ
FT                   FELQVRALCDLPLPSRIAVRPAMLLNLLGDLWQAGTPDWAALLALPGVHLHLYGKGEPR
FT                   PGRKMGHVTITAADWPTVEETCQRVRQLLGLPPR"
FT   gene            complement(78228..78737)
FT                   /gene="purE-1"
FT                   /locus_tag="AHA_0070"
FT   CDS_pept        complement(78228..78737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE-1"
FT                   /locus_tag="AHA_0070"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37859"
FT                   /db_xref="GOA:A0KEE2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE2"
FT                   /protein_id="ABK37859.1"
FT                   /translation="MNTPPLIGLVMGSDSDWPVMQAAARILKEHGVPYEARVVSAHRTP
FT                   DLLFEYAASARERGLRAIIAGAGGAAHLPGMVAAKTTIPVLGVPIPTRQLKGMDSLLSI
FT                   VQMPKGVPVATFAIGEAGAANAGLFAVSLLSVAQDGDAPRYQQQLDGFRANERDRVLAL
FT                   TLEDPA"
FT   gene            complement(78800..79102)
FT                   /locus_tag="AHA_0071"
FT   CDS_pept        complement(78800..79102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37283"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE4"
FT                   /protein_id="ABK37283.1"
FT                   /translation="MQTEIRTLLTVITEANLEPTLLRTLTREGLRGYTITDARGRGDHG
FT                   ERNASWSESGNIRLEAICSREQAERLLAHLQSRYYPDYAMVAFLQPVEIVRPEKF"
FT   gene            complement(79107..80180)
FT                   /locus_tag="AHA_0072"
FT   CDS_pept        complement(79107..80180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0072"
FT                   /product="sodium bicarbonate cotransporter"
FT                   /note="identified by match to protein family HMM PF05982"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36235"
FT                   /db_xref="GOA:A0KEE3"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE3"
FT                   /protein_id="ABK36235.1"
FT                   /translation="MPEVIELFVVEHRAPYQFLPNNHQSKSDFIETSCTLACNHPVNCL
FT                   LRTPMLDVVVLFFLFGLLAGLVRSELKLPPALYDTLSLFLLLAIGLKGGVGLAQQSLQP
FT                   LLPQLALVILLGMLQTLAGFAVLRLKMNRVDAAATAAHYGSVSVATFAVGVNWLTERGI
FT                   SFESQLSIFLAVMEIPAILVGIVLAQGISRQTRWRRLAHETFLGKGVTLLLGGMAIGYL
FT                   AGPDGIAPLKPLFVDLFKGALALFLLEMGLIVARQCQDLRRHGLFLLGFALLMPLASAG
FT                   LGLVIGQLVGLSLGGLTLLATLAASASYIAVPATMRIAVPQANPGLSLSAVLGVTFPFN
FT                   IMLGIPLYHSWARHFTE"
FT   gene            80145..81047
FT                   /locus_tag="AHA_0073"
FT   CDS_pept        80145..81047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0073"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39794"
FT                   /db_xref="GOA:A0KEE5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE5"
FT                   /protein_id="ABK39794.1"
FT                   /translation="MLNYKQLYYFWHVARSGSVTRAAEQLHLTPQTVSGQVAELELSLG
FT                   VALFNRVGRRLALTTAGRQALEQAGAIFSLGADLEHTLRHASQELTMQVGIADSVPRTL
FT                   AFELLAPAMALATPLRLVCHEERAEQLFSELASHKLDMVLIDRPLPPDSGVRGYNHELG
FT                   RSPLALFASPELAARARQGFPASLEGLPLLIPGEKSATHDSLLAWYRQQGIHPHLVGQF
FT                   DDSTLMKSFGKAGMGIFPAPLAMADEIARLYGVERIATLAEVTLSYYLVSAGRHLSHPG
FT                   VQAVMEGAKQRLAALGGNK"
FT   gene            81312..83147
FT                   /locus_tag="AHA_0074"
FT   CDS_pept        81312..83147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0074"
FT                   /product="vitamin B12 transporter BtuB"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39619"
FT                   /db_xref="GOA:A0KEE6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE6"
FT                   /protein_id="ABK39619.1"
FT                   /translation="MSKKLLAAALLPTAAFAQTTIPVNPTLVITANRVEQPISSVLAPV
FT                   VVIDRAEIESRQVQSLPALLKTLPGVQITTLGGRGHMSSLFIRGTNSNHSLVLMNGRPI
FT                   AAMVAGTPDLSQIPLGNIERIEYIRGPRAAVYGSDAIGGVINLITKTSAKNGSETHLKG
FT                   GVGSNGYGQGQLRTVQALGQQTDMNMMIGYERTDGFDVVANAQQPDRDGFDSLNGQFGL
FT                   SHAFNDAWSADFNAQGYDNQTEMDDAYQSADQSRVQAFQYDGGLKYQSGALSSRLEASY
FT                   GENKLKSWLESKGESSAEPIHTGLTRFSWINSWSGVEGLNLTGGADWQQEQLKSDTRSY
FT                   GQAFNAPDRDNTGLFVVGSYRWQALLWELSGRTDDNKQYGRHNTWSAASGLDLDDNHNV
FT                   RLSYGTAFKAPTFLDLYYPGYENPALKPEESKNLELGFSGRYTGWDWSLNLYRNQIQNL
FT                   IACQSASSTCRPDNTDAEIRGVEVALGLETGPLRHDLSFDYTRAEDKNDGDQQLLRRAK
FT                   QKASWLTQVQLGPVDLSTELLYVGKRDDKNFSSFPAERVELGSYTLINLGASYGVTPQF
FT                   TLGGRIDNLFDRDYAPAYGYASAGTEFKLTADYRL"
FT   gene            83265..84059
FT                   /gene="murI"
FT                   /locus_tag="AHA_0075"
FT   CDS_pept        83265..84059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="AHA_0075"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00067"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39043"
FT                   /db_xref="GOA:A0KEF2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF2"
FT                   /protein_id="ABK39043.1"
FT                   /translation="MANILVFDSGMGGLTIYREIRRALPAHNYFYCFDNANFPYGELSE
FT                   AALTEVCTRLVSHMVVEHDIDLVVIACNTASTIALPSLRAAMTVPVVGVVPAIKPAAAL
FT                   TRNGCIGLLATPGTVSREYTHELIAQFAPGKRVLLKGATELVVEAEHKLAGLPVNMALL
FT                   REVLADWLEGEEHPDTLVLGCTHFPLLDEEIRQLMPACQLVDSGSAVAKRVAHLLAGLV
FT                   TTPTRLEDVGGKAYCTRLDAQTQKLTAPLQAWGLSSLEEVRF"
FT   gene            complement(84078..84569)
FT                   /locus_tag="AHA_0076"
FT   CDS_pept        complement(84078..84569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0076"
FT                   /product="RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00076"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38944"
FT                   /db_xref="GOA:A0KEF3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF3"
FT                   /protein_id="ABK38944.1"
FT                   /translation="MNLSKFPVYVQAAILALVLALVGYLVAQALQFSLKAEVIFAVGLA
FT                   IGGFVVPLFLNRAPAGVAELASSQETCTLYVGNLPYRANEIAVRELFAEQGQVISVRLM
FT                   KDKATGKRRGFGFVEMPAADAAKAIAALNDKEYQQRTLKVREANDKRDKDEREGSEVDA
FT                   "
FT   gene            85180..86716
FT                   /gene="rrsA"
FT                   /locus_tag="AHA_0077"
FT   rRNA            85180..86716
FT                   /gene="rrsA"
FT                   /locus_tag="AHA_0077"
FT                   /product="16S ribosomal RNA"
FT   gene            86944..87019
FT                   /locus_tag="AHA_0078"
FT   tRNA            86944..87019
FT                   /locus_tag="AHA_0078"
FT                   /product="tRNA-Glu"
FT   gene            87251..90146
FT                   /gene="rrlA"
FT                   /locus_tag="AHA_0079"
FT   rRNA            87251..90146
FT                   /gene="rrlA"
FT                   /locus_tag="AHA_0079"
FT                   /product="23S ribosomal RNA"
FT   gene            90264..90381
FT                   /gene="rrfA"
FT                   /locus_tag="AHA_0080"
FT   rRNA            90264..90381
FT                   /gene="rrfA"
FT                   /locus_tag="AHA_0080"
FT                   /product="5S ribosomal RNA"
FT   gene            90487..90562
FT                   /locus_tag="AHA_0081"
FT   tRNA            90487..90562
FT                   /locus_tag="AHA_0081"
FT                   /product="tRNA-Thr"
FT   gene            90960..92225
FT                   /gene="codA"
FT                   /locus_tag="AHA_0082"
FT   CDS_pept        90960..92225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="AHA_0082"
FT                   /product="cytosine deaminase"
FT                   /EC_number="3.5.4.1"
FT                   /note="identified by similarity to SP:P25524; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38390"
FT                   /db_xref="GOA:A0KEF4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF4"
FT                   /protein_id="ABK38390.1"
FT                   /translation="MLIKNLRLVGREGMWQILCQDGLIRAIEPMSTHLLAAHELDGEEG
FT                   LAIAPFIEPHIHLDTTQTAGEPSWNLSGTLFEGIERWAERKALLTHEDVKQRVIQTLKW
FT                   QIANGIQFVRTHVDVSDPNLVALKAMLEVREEMKEWVELQIVAFPQEGILSYPNGKALL
FT                   EEALKLGADVIGAIPHFEFTREYGVESLHYVFDLAEKYQVLVDVHCDEIDDEQSRFIET
FT                   LATLAYERGMGHRVTASHTTAMHSYNGAYASRLFRLLKMADINFVANPLVNIHLQGRFD
FT                   SYPKRRGITRVKEMLEANINVCFGHDDVFDPWYPMGTANLLQVLHMGLHVCQIMGYEQI
FT                   NDSLKLISSHSARTLNVQDRYGIEVGKPANLLILPAENGFDAVRRQVAVRYSIRHGRVI
FT                   AQTTPSRTSIHLAQVEPVDFRR"
FT   gene            92274..92690
FT                   /gene="crcB"
FT                   /locus_tag="AHA_0083"
FT   CDS_pept        92274..92690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="AHA_0083"
FT                   /product="CrcB protein"
FT                   /note="identified by match to protein family HMM PF02537;
FT                   match to protein family HMM TIGR00494"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37803"
FT                   /db_xref="GOA:A0KEF5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF5"
FT                   /protein_id="ABK37803.1"
FT                   /translation="MHNVGPILWRHAPMQTWLYVAAGGAIGACLRFGIAELMALLLGRH
FT                   FPYGTLMVNVVGSFIMGIAFALISHGHVVEHPLKPLLMVGILGALTTFSSFALDTVVLA
FT                   QQGAYLKAALNIGLNLFLCLAMVVLGMQLVASRV"
FT   gene            92756..93508
FT                   /locus_tag="AHA_0084"
FT   CDS_pept        92756..93508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0084"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36304"
FT                   /db_xref="GOA:A0KEF6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF6"
FT                   /protein_id="ABK36304.1"
FT                   /translation="MSEQTTTTHFGFKTVASTEKETLVAGVFHSVAAKYDLMNDLMSFG
FT                   IHRLWKRFTIDCSGVRKGQKVLDLAGGTGDLTAKFSRIVGETGQVVLADINDSMLKVGR
FT                   DKLRNLGVANNVSYVQANAEALPFPDNHFDVITIGFGLRNVTDKDKALASMFRVLKPGG
FT                   RLLVLEFSKPVSEVIAKLYDLYSFKLLPKMGEIVANDSESYKYLAESIRMHPDQQTLAG
FT                   MMENVGFEQVEFYNLTQGVVALHRGYKF"
FT   gene            93517..94125
FT                   /locus_tag="AHA_0085"
FT   CDS_pept        93517..94125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC58359.1; match to
FT                   protein family HMM PF06843"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38896"
FT                   /db_xref="GOA:A0KEF7"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF7"
FT                   /protein_id="ABK38896.1"
FT                   /translation="MPMDAMVTAVIETSLNQLLRLDKQSPERLRKLTGKVLKLELRELK
FT                   PLWFVFSERRLDVLAKFEGEADAVLSLSLTALGLLKDPSALTRYIREEKLDLSGDPQLV
FT                   QAFSVLLGELNIDWEEELSRYTGDVLAHTLLRGASQARRLLGRELCRSQRQLAEYLTEE
FT                   IRLAPGPLEVASFNDDVELLAQQMKAVELRLARFEQQVA"
FT   gene            94125..95765
FT                   /gene="ubiB"
FT                   /locus_tag="AHA_0086"
FT   CDS_pept        94125..95765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="AHA_0086"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF03109;
FT                   match to protein family HMM TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38880"
FT                   /db_xref="GOA:A0KEF8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEF8"
FT                   /protein_id="ABK38880.1"
FT                   /translation="MTPKEFKRLYRIISILLEQGIDELVPARYQPWPGRLARRSLFWLK
FT                   NKRQGLNRGARIRLAFEALGPIFIKFGQMLSTRRDLLPPDIAEELALLQDRVPPFCGQA
FT                   ARRQIEASLGCTIETLFDDFDETPLASASIAQVHTARLKENGREIVIKVIRPDIEPVIE
FT                   ADLRLMQALARLVARFVPQSGRLRPIEVVEEYRKTILDELNLMREAANAIQLRRNFTGS
FT                   EALYVPEVFTEHCREQVLVMERIYGIPVSDIAALEANGTNMKLLAERGVEVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPENPLWIGIDCGIVGTLNREDKRYLAENFLAFFNRDYRRVA
FT                   ELHVESGWVPPDTKVDEFEFAIRTVLEPIFEKPLSEISFGHVLLNLFNTARRFNMQVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWQTAKPYLENWMYQQVGPKAVWNAIKEKAPFWAE
FT                   KLPELPELVYETLRQTRHQQRHFDQMFADFRRHSRRQGQARYLLGVGASLLLAGVFLLT
FT                   QKQHIEWGQISLAGAGLCWLLGWLRTRSH"
FT   gene            95806..96054
FT                   /gene="tatA"
FT                   /locus_tag="AHA_0087"
FT   CDS_pept        95806..96054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="AHA_0087"
FT                   /product="twin arginine-targeting protein translocase TatA"
FT                   /note="identified by similarity to SP:P69428; match to
FT                   protein family HMM PF02416; match to protein family HMM
FT                   TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39575"
FT                   /db_xref="GOA:A0KEF9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF9"
FT                   /protein_id="ABK39575.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTKKLRGIGGDLGAAVKGFKKALSD
FT                   EPETKSEQKDAEFPPKQLNEAAGQPSDAAKQKDKDQA"
FT   gene            96058..96501
FT                   /gene="tatB"
FT                   /locus_tag="AHA_0088"
FT   CDS_pept        96058..96501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="AHA_0088"
FT                   /product="twin arginine-targeting protein translocase TatB"
FT                   /note="identified by similarity to SP:P69425; match to
FT                   protein family HMM PF02416; match to protein family HMM
FT                   TIGR01410"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38093"
FT                   /db_xref="GOA:A0KEG0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEG0"
FT                   /protein_id="ABK38093.1"
FT                   /translation="MFDIGFWELVVIGVVALVVLGPERLPVAIRTASHWIRLIRSTANS
FT                   VKAELEQELKLQDLHNDLKKAEQLQMNNLSPELQESIEQLKTAAQSVTRPYEQQNTIQP
FT                   ASAVAEVKEEPVAPISVATPDEEPTVIPAARAQPSAEQGEVKP"
FT   gene            96498..97253
FT                   /gene="tatC"
FT                   /locus_tag="AHA_0089"
FT   CDS_pept        96498..97253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="AHA_0089"
FT                   /product="twin arginine-targeting protein translocase TatC"
FT                   /note="identified by similarity to SP:P69423; match to
FT                   protein family HMM PF00902; match to protein family HMM
FT                   TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38683"
FT                   /db_xref="GOA:A0KEG1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG1"
FT                   /protein_id="ABK38683.1"
FT                   /translation="MSQAEQPLISHLVELRTRLLRSISAILLVFIALIYFSNNIYDFVA
FT                   QPLLSQLPEGTSMIATDVATPFLTPIKLTLVVSFFVAIPYLLYQAWAFIAPGLYQHERR
FT                   LIMPLVASSAVLFYAGMAFAYYVVFPLVFGFFTSTAPAGVTVATDIASYLDFVLTLFFA
FT                   FGVAFEIPVATILLCWTGVTSPKSLREKRPYVIVGVFVVGMLLTPPDVFSQTLLAIPMW
FT                   GLWEIGLFFARFYVKEESEEKQEQTEEGS"
FT   gene            97365..98150
FT                   /locus_tag="AHA_0090"
FT   CDS_pept        97365..98150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0090"
FT                   /product="deoxyribonuclease TatD"
FT                   /EC_number="3.1.21.-"
FT                   /note="identified by match to protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38917"
FT                   /db_xref="GOA:A0KEG2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG2"
FT                   /protein_id="ABK38917.1"
FT                   /translation="MIDIGVNLTSSQFADEQADLVARARAVGVEALILTGTDLVGSRES
FT                   ATLAARWPGYCFSTAGVHPHDAKSVDEATLPALRELAALPQVVAIGECGLDYNRDFSPR
FT                   PVQDAVFDAQLALAAELGMPVFLHCRDAHARFIEILRPWLPKLPGAVLHCFTGSDEELD
FT                   QCLALGLHIGVTGWLCDERRGQLLREQVARIPAGRLMIETDAPYLVPRDLKPRPKRNEP
FT                   AFLPHIAQVVAACRGEAPEALLAHTRATSAAFFQLPLQE"
FT   gene            98154..99173
FT                   /gene="hemB"
FT                   /locus_tag="AHA_0091"
FT   CDS_pept        98154..99173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="AHA_0091"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by match to protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39315"
FT                   /db_xref="GOA:A0KEG3"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG3"
FT                   /protein_id="ABK39315.1"
FT                   /translation="MATTLPGAFPGRRLRRVRKHDFSRRLVRENVLTANDLIYPVFVLE
FT                   GENRREAVTSMPGVDRLSIDLLLKEAAELVALGVPAIALFPVTPLEQKSLLAEEAYNPD
FT                   GLAQRATRALKVSFPELGVITDVALDPFTTHGQDGIIDDEGYVLNDITTEILVKQALSH
FT                   AAAGVDIVAPSDMMDGRIGAIRAALEENGFINTQIMAYSAKYASCYYGPFRDAVGSAGN
FT                   LGKSNKATYQMDPANSNEALHEVALDIKEGADSVMVKPGMPYLDVIRQVKDQFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLKEKESIMESLLCFKRAGADGILTYFAKRAAQWLQEDARR"
FT   gene            99396..101438
FT                   /gene="prlC"
FT                   /locus_tag="AHA_0092"
FT   CDS_pept        99396..101438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="AHA_0092"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="identified by similarity to SP:P27298; match to
FT                   protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38002"
FT                   /db_xref="GOA:A0KEG4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG4"
FT                   /protein_id="ABK38002.1"
FT                   /translation="MNNPLLTMDSLPPFSQIQPDQVQPAVTQAIADCKQKISDVLAQRD
FT                   PHTWDSLIAPLEEVNDRLARIWSPVSHLNSVLNSEALRAAHDACLPLLSEFQTYVGQHE
FT                   GLYQAYRELAESDDFPLLSGAQRKEIQNTLRDFRLSGIGLPAEAQQRYGEIQARLSELA
FT                   SRFSNNVLDATQGWNKLVTDEAELAGLPQSAQAAARQLAELKGKEGWLFTLDIPSYLPV
FT                   MMYADNRALRAELYEAFTTRASDQGPNAGKWDNSAIMTELLALRRELAQLLGFANYAEL
FT                   SLATKMADKPEQVVNFLTDLAAKSLPQGKAELEEIRAFAAEQHGQGELAAWDLAYYAEK
FT                   LKQHKFSISDEQLRPYFPASKVVKGLFEVVKRVFGMKVRERLGIDTWHPDVRFYDIFDA
FT                   EDELRGSFYLDLYAREHKQGGAWMDVCLGRRYRQDGSLQKPVAYLTCNFNGPVDGKPAL
FT                   FTHNEVVTLFHEFGHGIHHMLTRIDVAGVAGINGVAWDAVELPSQFLENWCWESEALAF
FT                   ISGHHETGEPLPADLLEKMLTARNFQAAMQMLRQLEFALFDFRLHQEFDPASTDQIPAL
FT                   LDEVRSQVAVMTPPAFNRFQHSFSHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGIFN
FT                   PATGQSFLKNILEKGGSKEPMELFRAFRGREPQVDALLRHSGIAA"
FT   gene            101643..104186
FT                   /locus_tag="AHA_0093"
FT   CDS_pept        101643..104186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0093"
FT                   /product="MorA"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF00990; match to protein family HMM TIGR00229;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36087"
FT                   /db_xref="GOA:A0KEG5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG5"
FT                   /protein_id="ABK36087.1"
FT                   /translation="MRRALESVYQIISSLSHSSGQGYFDTFVSEIAAAVGADFVLISGR
FT                   DQAGLSFKVHAAHPASLDITNFSFPVSATLREITLQEGETWFSDRVQQLFPHAAVLQAW
FT                   HIQAYAGIALKSAQGETVGICSVLFKRPLTNMDKVMGLLRLLAPLAGRELALMLQQPAP
FT                   PQPEYHDFLHTMMSHAPVGIGKLDLNGKILWTNPAIEKMLGYSQSELLHRTAAELNHPE
FT                   DWLRSAACYEELKRGERTAFTQEKRYLHRDGQVLWGRVTVTLVRDDQLQPDYLMVVLEN
FT                   IDPLKRHAEQLKLSHRVYDNLSEAILVCDADSRIISVNPAFEQITGYSEEEVCGQRPSM
FT                   LKSGLHDQAFYADMYHALERVGVWRGEVWNKRKNGKLYPQQLMISTLREGGRISQYIAI
FT                   FSDLSQTKLAEQKIAAQANYDNLTGLPNRWLFGRCLSRFCERGERFALMVLDLNNFKAV
FT                   NNSMDHHAGDALLREVSDRLVSRVRTEDLVARIGGDEFAFLVPGIVNRRQAEVFAKQVI
FT                   GGFARPFMLANQHLYVTATIGITLCPGDGLESDELLRNAEQALFAAKRQGRLLGSYCAS
FT                   MREEVRQRHQMQQDLAEAIKLEQLTMAYQPIWDNRSGRVAKLEALVRWYHPHWGQVSPA
FT                   DFIPLAEEAGLIQGLGALVLWQSCRDLARLQQSGFPDLQMSINRSTLEFQTIDPEASEW
FT                   LKVIHHFGLDPADIVIEITESLLMETSDQHRVRIDALREAGCKLAIDDFGTGYSALNYL
FT                   RNFPVDLVKIDRAFVRHIPFNEQDRLLLDGIINIVHNLGMQVVIEGVETREQLNFLCQK
FT                   GCAFTQGYLLSRPLAYDDLTEYLQLNDKSMFLQTS"
FT   gene            104281..105027
FT                   /locus_tag="AHA_0094"
FT   CDS_pept        104281..105027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04445"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36028"
FT                   /db_xref="GOA:A0KEG6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEG6"
FT                   /protein_id="ABK36028.1"
FT                   /translation="MQILLEDPAKAPQAEALASQLGQTDLPQFALVFTAARLELRKLDE
FT                   PKLGAVYVDFVEGAVAHRRKFGGGRGQSIAKAVGLKAGAMPRVVDATAGLGRDAFVLAS
FT                   LGCKVTMIERSPVVAALLQDGLARAALDPEIGPWVRERMQLRHGPAVETLLGLTERPDV
FT                   IYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADALLPAALAMADKRVVVKRPDYAGWL
FT                   NEHKPSMAIETKSNRFDVYVMAALAG"
FT   gene            complement(105382..106371)
FT                   /locus_tag="AHA_0095"
FT   CDS_pept        complement(105382..106371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36472"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG7"
FT                   /protein_id="ABK36472.1"
FT                   /translation="MDAMKPLTLIGLTALLTACGGGGGGDNNSPQQAQLSLAFSDAPVD
FT                   AVSKVCIAVANISIHPVAGTEQSWTTASFLTSTQDDGCTPSGETIPLDSAGRPLFTYID
FT                   LLHYQGSVSRPLLASQSVEPGDYSQMRLRVLDGREVANQFLDGTPYSYVKRDDGVIKPL
FT                   EVPSSELKLDAFTIAANGLSAFTTEFDLRQAMVLPGHEQYYKLKPRGVRLVNNTQVTTV
FT                   KGTVAAGLCGGQLTDKAFVYFYQPRSDDNYPDMADSDNGFYASAPVLPQSGGGFGYELG
FT                   FVNLGSYDLALVCNGNEDDPALAGDPLQLEQVQQAQAVVAPATSINFQ"
FT   gene            complement(106568..108058)
FT                   /locus_tag="AHA_0096"
FT   CDS_pept        complement(106568..108058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0096"
FT                   /product="guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="identified by match to protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39541"
FT                   /db_xref="GOA:A0KEG8"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEG8"
FT                   /protein_id="ABK39541.1"
FT                   /translation="MHNSPLYAAIDLGSNSFHMLVVREVAGALRTVTKVKRKVRLAAGL
FT                   DPEFRLSRAAMERGWDCLRLFSEQLQDIPADNIRVVGTATLRLATNVDEFLSEAERVLN
FT                   HSIEIISGEEEAKTIYEGVSWTSAGEGNRLVIDIGGASTELVIGEHSEAKLLNSLHMGC
FT                   VTWLNNHFGDGELSEARFKQAIAAAKAVLEKVAEDYRALGWRTCVGASGTVQALQEIML
FT                   AQGKSERVTLPKLQELMGQAIACGKLDQLQLEGLAAERLTVFPSGLAILIAIFETLGIE
FT                   SMTLAGGALREGLIYGLLGNNHDCDARDRTADSLINRYQLDKEHAERVRDTAVEAFNQL
FT                   QPAWRLSKRYGRPILRYAALLHEIGLCIEYKKAPQHAAYIIDNIDMPGFTPAQKKLLSA
FT                   LLFNQRDEFKLEPLEKQGAVTGRQAIRLARILRIALILCMRRTQGTVPRFTLEADEDAL
FT                   TLTLPSGWLDEHYLRASELRFEVERQQKMGWPTRLLEA"
FT   gene            complement(108073..109362)
FT                   /locus_tag="AHA_0097"
FT   CDS_pept        complement(108073..109362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0097"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39109"
FT                   /db_xref="GOA:A0KEG9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEG9"
FT                   /protein_id="ABK39109.1"
FT                   /translation="MSKTHLTTDKFAQMGLEPEVLAGLESKGFHYCTPIQALSLPLLVE
FT                   GHDLAGQAQTGTGKTLAFLAATFNYLLTHPLTKPRLINQPRAIIMAPTRELAVQIYNDA
FT                   ESMSASTGLKLGLAYGGEGYDKQLAVLEQGVDILIGTTGRIIDYFKSKVIDLSNIQVVV
FT                   LDEADRMFDLGFIKDIRFLFRRMPPATERLSMLFSATLSLRVQELAYEHMNHPEHVQIE
FT                   PEQMTGVRIKEELFYPSNEDKMLLLLSLMEEEWPEKAIVFANTKHVCEDVHAWLENDGH
FT                   RVGLLTGDVPQKKRMKILEDFTKGTVDILVATDVAARGLHIPDVTHVFNYDLPDDAEDY
FT                   VHRIGRTGRAGKSGHSISLACEDYAFNLPAIEEYIHHPIPVSKYDREALLDDVTAPKRV
FT                   FRNRQPVNRNMRDRQGGGNSNNRRRPPRKS"
FT   gene            109476..109802
FT                   /gene="trx"
FT                   /locus_tag="AHA_0098"
FT   CDS_pept        109476..109802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="AHA_0098"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36091"
FT                   /db_xref="GOA:A0KEH0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH0"
FT                   /protein_id="ABK36091.1"
FT                   /translation="MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILNE
FT                   VAQEYAGRVTVAKLNIDHNADTPPKYGIRGIPTLLLFKNGEVAATKVGALSKTQLKEFL
FT                   DGNL"
FT   gene            110010..111275
FT                   /gene="rho"
FT                   /locus_tag="AHA_0099"
FT   CDS_pept        110010..111275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="AHA_0099"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM PF08206;
FT                   match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39781"
FT                   /db_xref="GOA:A0KEH1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH1"
FT                   /protein_id="ABK39781.1"
FT                   /translation="MNLTELKNTPVSELVQLGESMGLENLARAHKKDIIFAILKAHAKG
FT                   GEDIFGDGVLEILTDGFGFLRSADGSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDRPENSRNKILFENLTPLHANERLRMERGNGSTEDITARVLD
FT                   LASPIGKGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCELIVLLIDERPEEVTEMQRM
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVYPAIDITRSGTRKEELLTTGDELQKMWILRKIVHPMGEIDGIEFL
FT                   IDKLAMTKTNDEFFDAMRRQQK"
FT   gene            111589..112389
FT                   /locus_tag="AHA_0100"
FT   CDS_pept        111589..112389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0100"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37722"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH2"
FT                   /protein_id="ABK37722.1"
FT                   /translation="MCQLLATLNSQPRATSPQLLAWVRAQSFKAPSWLVDKEVDGFLVQ
FT                   QPAYDFAAAARQVLSRWQQQAWQDNYRQQLEEGTFEFKQIYNSRNPDLAQQQQALLTVL
FT                   DRQPLPLLQREAHTLAAMSIFLPDNRLLRLLAERTGDSALYQKLWHQPVDHDSVAALAS
FT                   VGRFHQGQAASDLLIAASRNARLKLPALQQLSQLSPLPDTAQQFLLAELGNRQYSGQVA
FT                   SLLLQMDEPRLLAQLADRLTRQEKRHASPVMLPDSGTPAARPGL"
FT   gene            112420..113889
FT                   /locus_tag="AHA_0101"
FT   CDS_pept        112420..113889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0101"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /note="identified by match to protein family HMM PF01977;
FT                   match to protein family HMM TIGR00148"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39084"
FT                   /db_xref="GOA:A0KEH3"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEH3"
FT                   /protein_id="ABK39084.1"
FT                   /translation="MKYKDLRDFIAQLEQSGQLKRISREIDPYLEMTEISDRTLRAGGP
FT                   ALLFENPKGYTMPVLTNLFGTPDRVAMGMGQPNVAALRQVGIWLSYLKEPEPPRGFKEL
FT                   MEKLPIFKQVLNMPTKRLSSAPCQQRVLEGEAVDLDQIPIQHCWPGDVAPLVTWGLTIT
FT                   RGPYKKRQNLGIYRQQKIGKNKLIMRWLDHRGGAIDFREWQEAHPGERFPVVVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSRTEVVKAVSCDLEVPASAEIVLEGYLEPGEMAP
FT                   EGPYGDHTGYYNEVDEFPVFTITHMTMRKDAIYHSTYTGRPPDEPAVLGVALNEVFVPL
FT                   LQKQFPEIVDFYLPPEGCSYRMAVVTIKKRYPGHAKRVMLGVWSFLRQFMYTKFVIVCD
FT                   DDINARDWKDVIWAITTRMDPARDTTLIEHTPIDYLDFASPVSGLGSKMGLDATNKWPG
FT                   ETNREWGQPIVQDEAVKQKIDALWDELNILG"
FT   gene            114058..114756
FT                   /locus_tag="AHA_0102"
FT   CDS_pept        114058..114756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0102"
FT                   /product="NAD(P)H-flavin reductase (FMN reductase)"
FT                   /EC_number="1.16.1.3"
FT                   /note="Aquacobalamin reductase; NAD(P)H:flavin
FT                   oxidoreductase; identified by match to protein family HMM
FT                   PF00175; match to protein family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37410"
FT                   /db_xref="GOA:A0KEH4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH4"
FT                   /protein_id="ABK37410.1"
FT                   /translation="MQRIKCRVEELREYVDTIWHVALTPLQEVSFKPGQYLLVVMSDSD
FT                   KRPFSIANSPTRPGMLELQIGATPENAYAGQVLARMREQGEIEIELAAGKAFLREESPR
FT                   PLILMAGGTGFSYARSILEYLIDTGSKRPVFFYWGVRQAHWLYEQEQMQQWERDYAPLT
FT                   FIPVVQEPEVDWTGKTGLVHKAIMDDFVSLHDYDIYVAGRFEMAGAAREEFKILGAEPE
FT                   RIFGDAYEFI"
FT   gene            complement(114886..115143)
FT                   /locus_tag="AHA_0103"
FT   CDS_pept        complement(114886..115143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04380"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37642"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH5"
FT                   /protein_id="ABK37642.1"
FT                   /translation="MIDPKKLEEIAKQVHNSLPPGIRSMGEEVEKKIRQVLQSQLGKLD
FT                   LVSREEFDVQTKVLLRTREKLTALEAKLAQLEQQLGAKGE"
FT   gene            115445..117862
FT                   /locus_tag="AHA_0104"
FT   CDS_pept        115445..117862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0104"
FT                   /product="extracellular lipase"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37277"
FT                   /db_xref="GOA:A0KEH6"
FT                   /db_xref="InterPro:IPR020009"
FT                   /db_xref="InterPro:IPR025920"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH6"
FT                   /protein_id="ABK37277.1"
FT                   /translation="MKKKLIYAAVVSAMLAGCGGSDDNKGDTSSYLDYLLTGSNAVRPS
FT                   ALAARASDGTLKFSTETADLSNPVSAMSTLDGWSTTQAIQIVPVTSSGIQVQAPAAAEF
FT                   AASVAPLYLLELSFDSAALRPNGVKKVLTYGVDFVVAAAAGKLNLVPLKPLNPSSYYMI
FT                   VATDSLKDSSGNAVKAGNDYGNYKNNVGSNAQEQTINGLIALQEGLFKAATGVSTDHVI
FT                   FSDWFGTQSGADVLVAVKGAAASVLKSPTLDAAALWKQDAKGNTSLPGTYTLSVTGSNA
FT                   FLTQLDAEQFLPQEQKDAIATAFGPGAPLNPIAQATKVYTGTVKLPYFLASPATAGSWD
FT                   KAKTQSWHGAIPSLYAIANALKASDSEVIAGLVGAGVDPALLATLIADPTRQAELLAEA
FT                   SKLIGVTLTSGGKPLDAEQNIGRFNPLPMLEEVQSVPMRVFAKDALNTITDVIIYQHGV
FT                   TSVKENAYALALGQIYAGMQAGKKVALVVIDHPLHGERGFALSGSMATVTTSDNPTPYL
FT                   NLSYLTVARDNLKQSVADLLGLRLAVGLANAKGAIGTAGSLKVHFLGHSLGAISGTNLL
FT                   AVANQPIGNAQADALFKFDTGGLAMPGGGIAPLLLNSPTFGPTIKMGVLTSGSAELKAG
FT                   FTAYAPNCKTAVPTCFVNEFLPSLSTTQQAAAASTLQSYSFAAQSVLDSADPINLGRGI
FT                   QSSFPLFATEIVGDGALSLSDQVIPNSIASAPLGGTEPLFKVLALQPLTATGAASHNAA
FT                   RFLAGGHSSLLAPDENFDPSGDVTTEMQSQFASFFMSGGTAVKVTNGSLLKQ"
FT   gene            complement(118002..118835)
FT                   /locus_tag="AHA_0105"
FT   CDS_pept        complement(118002..118835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0105"
FT                   /product="GlpG protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36722"
FT                   /db_xref="GOA:A0KEH7"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH7"
FT                   /protein_id="ABK36722.1"
FT                   /translation="MIQLLVLDNARMAQALVDYLSTLGISCELTQSELGVSVWLADEQR
FT                   LAQAQLEVKRFLAEPTHPRYMEASWQSGRADARIDYSKGMTDPVTDFLHQAGPLTLVVI
FT                   IACLAIYGLDAIGLPIFDELAFHPTLAQFTDWQAWRYFTPAFIHFSVLHLVFNLLWWWY
FT                   LGGQIEQRLGSGKLLILLLVGAALPNLAEFFASGPLFGGLSGVVYALLGYCWLRSKLQP
FT                   ACGLTLPPALMGFMLFWLALGFFDLLGTRTANMAHLAGLLVGLLQGWLDRHHQPA"
FT   gene            complement(118832..119155)
FT                   /locus_tag="AHA_0106"
FT   CDS_pept        complement(118832..119155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0106"
FT                   /product="thiosulfate sulfurtransferase GlpE"
FT                   /EC_number="2.8.1.1"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36237"
FT                   /db_xref="GOA:A0KEH8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEH8"
FT                   /protein_id="ABK36237.1"
FT                   /translation="MDQFAHISAHDAHQKLAAGAARLVDIRDPQSFETAHAVGAFHLTN
FT                   GTLVRFMNEVDFDTPVIVMCYHGNSSQGAAQYLLQQGYDEVYSLDGGFEAWRREFPIQA
FT                   GDA"
FT   gene            119226..119912
FT                   /locus_tag="AHA_0108"
FT   CDS_pept        119226..119912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0108"
FT                   /product="efflux protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37718"
FT                   /db_xref="GOA:A0KEH9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH9"
FT                   /protein_id="ABK37718.1"
FT                   /translation="MSGYCRDRSQFPSIPGAGCRLGWGLLLLLRALFMETSLLLSMAGF
FT                   ALAMSITPGPVNLVALGSGARHGFAASLRHVVGATLGFILLLLLMGLGLGATLLQWPLA
FT                   AELLRWAGVIFLGWMAWQLLVDSGRVEGVDGVAPSFWYGALMQWLNPKAWLAASMGMGA
FT                   YGSAGGVGQVALFSGLYLVICLGSIACWAYAGSRLQGVLLAPQRLRWFNRAMALLLLLC
FT                   AAYLVR"
FT   gene            complement(119909..120742)
FT                   /locus_tag="AHA_0107"
FT   CDS_pept        complement(119909..120742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0107"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37003"
FT                   /db_xref="GOA:A0KEI0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI0"
FT                   /protein_id="ABK37003.1"
FT                   /translation="MSRADTAPDHHSFWHDPALPFIEARAVQDGRRVCYDKHSHPHFSI
FT                   GAITGGHSHYLNQRSRQEVGRGHLVLMNPEEVHACNPVADEPWSYLMFYLNTGWLQRQQ
FT                   EEAGLGDTFRPFDMTASQDPLLYQGLCRLHRQLWQEQDPLAREVACHQFSRQLLARLTP
FT                   ASWDDRPPQHLQRAAELMQDDCSSPLTLAQLSAVAGLTPSHFVRSFSRHYGMTPHAYLL
FT                   DQRIRHARTLLKRGEPLAEVALASGFADQAHFQRQFKRRVAATPGHYRNQLTRLG"
FT   gene            complement(120746..121447)
FT                   /locus_tag="AHA_0109"
FT   CDS_pept        complement(120746..121447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0109"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, ATP-binding protein LivF"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38514"
FT                   /db_xref="GOA:A0KEI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI1"
FT                   /protein_id="ABK38514.1"
FT                   /translation="MLELRNVSTHYGKIQALHDVSVQVKEGEIVTLIGANGAGKTTLLM
FT                   TLCGEPKPSSGSIWFEGEQIDSLSTARIMRKDIAVVPEGRRIFARLTVEENLLMGAFFV
FT                   DKAEQRGLLDQIFTLFPRLHERLEQRAGTMSGGEQQMLAIGRALMSKPRLLLLDEPSLG
FT                   LAPIVIQQIFDTIEQLRRDGMTIFLVEQNANQALKLADRGYVLENGHVVLQDTGAALLA
FT                   NPAVRQAYLGG"
FT   gene            complement(121458..122231)
FT                   /locus_tag="AHA_0110"
FT   CDS_pept        complement(121458..122231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0110"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, ATP-binding protein LivG"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37976"
FT                   /db_xref="GOA:A0KEI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI2"
FT                   /protein_id="ABK37976.1"
FT                   /translation="MSANQKLMEVSDLSMRFGGLLAVNGVKLDVDKGEVISIIGPNGAG
FT                   KTTVFNCLTGFYRPSGGIIRYKGEEIQGLPGHLIARKGIVRTFQHVRLFKDMTAVENLL
FT                   VAQHRHLNTGFLAGLFKTPAFRRAEREGLEQSAFWLEKVGLKDLANRAAGNLAYGQQRR
FT                   LEIARCMATRPELLMLDEPAAGLNPHETDELNELISNLRDEFGVSVLLIEHDMKLVMEI
FT                   SNRIFVVNQGTPLAHGKPDEIRSNPAVIKAYLGES"
FT   gene            complement(122228..123499)
FT                   /locus_tag="AHA_0111"
FT   CDS_pept        complement(122228..123499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0111"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, permease protein LivM"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39456"
FT                   /db_xref="GOA:A0KEI3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI3"
FT                   /protein_id="ABK39456.1"
FT                   /translation="MMKRQLVHACIASLVLLVLSFWLLGFKLETDGTRLLVTSRLDVSL
FT                   AWLLGGATLVFWFQLLRGQISRLFQASISGFSVGFTKLVLPSQEEAPRLYNITAVLVLL
FT                   FAVSWPFMASRGAIDLATLALIYIMLGLGLNVVVGLAGLLDLGYVGFYAVGAYSYALLN
FT                   TYFGLSFWECLPIAGLTAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLNNMTSLT
FT                   GGPNGISGIPKPTLGGLEFNRTVKDGGFETFHEFFGIAYNANHKVIFLYLMALVLVIAT
FT                   LFVINRLLRMPLGRAWEALREDEIACKSLGLNPTIIKLTAFTIGACFAGFAGSFFASRQ
FT                   GFISPESFVFIESAIVLAIVVLGGMGSQIGVVLAAIVMTVLPELAREFNEYRMLMFGLL
FT                   MVFMMIWRPQGLLPMTRPHLELKK"
FT   gene            complement(123496..124422)
FT                   /locus_tag="AHA_0112"
FT   CDS_pept        complement(123496..124422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0112"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system permeaseprotein LivH"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36338"
FT                   /db_xref="GOA:A0KEI4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI4"
FT                   /protein_id="ABK36338.1"
FT                   /translation="MSEHFLYLVQQLLNGLTIGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMIGSYVAFMVMAGLMMMGIDSTFLLLGGAFLVSIVITGTYGWTIERVAYRPLRGGNR
FT                   LIPLISAIGMSIFLQNMMRMAQGSRDIAMPTLISGGWTLGEADGFQASLSWMQLIIFVV
FT                   TFITMLALTQFIGRSRMGRACRACSEDIKMANLLGIDTHVVISITFVLGATLAAVAGVL
FT                   LGMYYGVINPYLGFMAGLKAFTAAVLGGIGSIPGAVLGGLLLGVVEALTAGYLSTEYKD
FT                   VMAFALLIGVLLFMPTGILGRPEVEKV"
FT   gene            complement(124487..125590)
FT                   /locus_tag="AHA_0113"
FT   CDS_pept        complement(124487..125590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0113"
FT                   /product="Leu/Ile/Val-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38195"
FT                   /db_xref="GOA:A0KEI5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI5"
FT                   /protein_id="ABK38195.1"
FT                   /translation="MAVRTAVSMALFGSVSLVHAADTIKIGIAGPVTGPVAQYGDMQFT
FT                   GGKMAVEQINKAGGIKGKQIEAVIYDDACDPKQAVAVANKVINDGVKFVVGHLCSDNTL
FT                   PASDIYEDEGVLMVTPASTNPKITERGYQLVLRTIGLDSDQGPTAAKYIIEQVKPKRVA
FT                   VIHDKKQYGEGIASSVKAALDKAGVKVVAFEGITAGDKDFSALIAKLQKENVDFVYYGG
FT                   YHPELGLILRQAGEKGLKAKFMGPEGVGNKDISAIGGPASEGLLVTLPNKYDLVPANAP
FT                   LVAAFKAKGQDSSGPFVWTTYAAVQTLAAGIAKAGEDDPAAVAAAIKAAPIDTVMGTLS
FT                   WAPSGDLKGFEFGVFQWHADGTSTQVK"
FT   gene            126044..127048
FT                   /locus_tag="AHA_0114"
FT   CDS_pept        126044..127048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0114"
FT                   /product="ribose operon repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37528"
FT                   /db_xref="GOA:A0KEI6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI6"
FT                   /protein_id="ABK37528.1"
FT                   /translation="MATIKDVASRAGVSISTVSHVLNHTRRVSEDATQKVLEAVAELNY
FT                   APNSVARSLKINSTKTIGMLVTTSANPFFAEVVQGVEAYCFEQGYSLILCNTENQPPRQ
FT                   QHYLRMLMEKRVDGLLVLGTDIDTPLRDMLRIHKNVPQVVLDWGTECDFANVINDNARI
FT                   GARLAVRHLLEQGHRDIVCITGQLAKPTTQQRLDGVRDALGEQGLTLKDEQIFEGDYES
FT                   QSGFDAMQRILALKPRPTAVFAFDDPMAIGAICAAWEAGVKVPDDISMIGYDDVEMARF
FT                   SSPPLTTIRHPKAELGLLAVQQLVSRIRNKELEVESMTVQPELIVRRSVKSLR"
FT   gene            complement(127118..128437)
FT                   /locus_tag="AHA_0115"
FT   CDS_pept        complement(127118..128437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0115"
FT                   /product="maltose-6'-phosphate glucosidase"
FT                   /EC_number="3.2.1.122"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39393"
FT                   /db_xref="GOA:A0KEI7"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI7"
FT                   /protein_id="ABK39393.1"
FT                   /translation="MKKFSVVIAGGGSTFTPGIVLMLLENQHRFPLREIKFYDNDGARQ
FT                   EVIAEACRVLLREQAPDIAFSYGTDPKAAFSGVDFVMAHIRVGKYPMRELDEKIPLRHG
FT                   VVGQETCGPGGIAYGMRSIGGVLALVDYMEQYSPDAWMLNYSNPAAIVAEATRRLRPHA
FT                   RILNICDMPIGIEGQMAQIAGLPSRKEMRVRYYGLNHFGWWTRIEDLAGNDLMPAIKAH
FT                   VAKHGYVPKQAGHAEASWNDTFAKAKDVWALDPDTLPNTYLKYYLYPDYVVAHSNPEHT
FT                   RANEVMEHREKHVFSACRAIVAAGNAAAGELEIDEHASYIVDLATAIAFNTQERMLLIV
FT                   PNRGAIPNFDPEAMVEIPCLVGSSGPEPLQVGNIPLFQQGMMGQQVAVEKLVVEAWIER
FT                   SYQKLWQAITLSKTVPSASVAKAILDDLIAANKEYWPPLQ"
FT   gene            complement(128440..130026)
FT                   /locus_tag="AHA_0116"
FT   CDS_pept        complement(128440..130026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0116"
FT                   /product="pts system maltose-specific eiicb component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR00852; match to protein family HMM TIGR02005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38672"
FT                   /db_xref="GOA:A0KEI8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010975"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI8"
FT                   /protein_id="ABK38672.1"
FT                   /translation="MLSQIQRFGGAMFTPVLLFPFAGMVVGIAIMLKNPMFVGETLANP
FT                   QGLFFQIVHIIEEGGWTVFRNMPLIFAIGLPIGLANKAQARACLSVLVSFMTWNYFINA
FT                   MGMTWGDYFGVDFNQAVGGESGLAMVAGIKTLDTSIIGAIAISGIVTALHNRLFDRQLP
FT                   VFLGIFQGSSFVTIVAFFVMIPCAWLTLQGWPKVQMGIASLQEFMLVSGPLGVWVYTFL
FT                   ERILIPTGLHHFIYGPFIFGPAAVEGGIQLYWAQHMLEFSQSTRPLIELFPQGGFALHG
FT                   NSKIFGAMGIALAIYATAAKENKAKVAGLLIPATLTAMLVGITEPLEFTFLFISPLLFA
FT                   IHALLAATMATVMYLFGVVGNMGGGLLDQFLPQNWIPMFHNHAGMMFTQIAIGLTFTGI
FT                   WFLIFRTLILKFNLKTPGRDESEIKLYSKADYQAAKKQRGYDIAGHILAALGGAENINS
FT                   LNNCATRLRISLRDASLVAPDDAFKQLGAHGVVRHGDSIQIIIGLHVPQLRENMESLMN
FT                   NPSSSSFVTES"
FT   gene            130311..131018
FT                   /locus_tag="AHA_0117"
FT   CDS_pept        130311..131018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0117"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36363"
FT                   /db_xref="GOA:A0KEI9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI9"
FT                   /protein_id="ABK36363.1"
FT                   /translation="MIYKSVADRLRIRVNGADCRVGDVLPSEKTLASQFGVSRMTVRKA
FT                   VDMLIEWGLVERRHGSGTYVTKKDVQHETKGLSGFTELMREQGRSLTSEVLEFRTMPAP
FT                   PAIASQLRIKVNEPVYFSNRVRSVDGRALLVEESYMPVRLFRTLSVAHLEGSKFAYIEN
FT                   ECQLPIAGNYESFSAVLADRRMAELLHIEQGAPILRLTSLSYGENGEFLNYSIMFRNAN
FT                   DYHVDYHLRRARG"
FT   gene            complement(131099..132625)
FT                   /locus_tag="AHA_0118"
FT   CDS_pept        complement(131099..132625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0118"
FT                   /product="anaerobic nitric oxide reductase transcription
FT                   regulator NorR"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF01590"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35919"
FT                   /db_xref="GOA:A0KEJ0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023944"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEJ0"
FT                   /protein_id="ABK35919.1"
FT                   /translation="MISTDSLARIALDLQLGISHQDRFHRLIQSVRSLLNSDASALLRY
FT                   EGGQFIPLAIDGLMQDVLGRRFALKDHPRMEAIARAGDVVRFPADSSLPDPYDGLLPDH
FT                   DDFKVHACVGLPLFSDQALIGALTIDGMNPTQFDAISDEELRLVGALAAAALNNALLLE
FT                   RLARQSSEPLVPGTRPGPEQPEMIGQSPAMARLRHEIEVVANSELNVLILGETGVGKEL
FT                   IAKAVHRGSQRAKAPLVYLNCAALPESVAESELFGHVKGAFTGAIHNRAGKFELADQGT
FT                   LFLDEIGELSLPLQAKLLRVLQYGDLQRIGDDTPLKVNVRILAATNRDLKQAVVEGQFR
FT                   ADLYHRLSVFPIHAPALRERPGDIPLLAGYFCERCRLSLGLEQLRIQPQALQLLERHDW
FT                   PGNVRELEHAIHRAAVLARAEQGSQTPTLASHHFNLAAGPLPPSTSPAMAPMTPLPGGL
FT                   GLRAATDAFQLALIEQTLAAHNGNWAATARALELDSGNLHRLAKRLGLKA"
FT   gene            132796..134283
FT                   /gene="norV"
FT                   /locus_tag="AHA_0119"
FT   CDS_pept        132796..134283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norV"
FT                   /locus_tag="AHA_0119"
FT                   /product="anaerobic nitric oxide reductase flavorubredoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF00301; match to protein
FT                   family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35983"
FT                   /db_xref="GOA:A0KEJ1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR023957"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEJ1"
FT                   /protein_id="ABK35983.1"
FT                   /translation="MSIHVKNNIHWVGQRDWEVRDFHGTEYKTHKGTSYNSYLIREGKN
FT                   VLIDTVDHKFSREFVQNLAAEIDLATIDYVVINHAEEDHAGALTELMARIPGTPIYCTH
FT                   NAIDSITGHHHHPEWNFHPVKTGDSLDIGNGKQLVFIETPMLHWPDSMMTYMTEDAVLF
FT                   SNDAFGQHYCDEHLFNDEVDQTELMEQCQRYYANILTPFSPLVTAKIKEVLGFNLPVSM
FT                   VATSHGIVWREDPTQIILKYLEWADHYQEDRITLFYDSMSNNTRMMADAIAQGIHEVDP
FT                   GVAVKIYNVARHDKNEILTQVFRSKGILVGSSTMNNVMMPKVAGMLEEITGLRFRNKRA
FT                   SAFGSYGWTGGAVDRIQTRLMDAGFDISISLKAKWRPDGSALAECREHGRQLARQWALH
FT                   PLDAPRPLATTQATPAPEMPAAVTAAPKATAAAAEWDDDQAMLCTVCQWVYDPAQGEPD
FT                   QLVAPGTPWAQVPDSFLCPGCGIGKEVFEPCAVEACV"
FT   gene            134280..135446
FT                   /gene="norW"
FT                   /locus_tag="AHA_0120"
FT   CDS_pept        134280..135446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norW"
FT                   /locus_tag="AHA_0120"
FT                   /product="nitric oxide reductase FlRd-NAD(+) reductase"
FT                   /EC_number="1.18.1.-"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37047"
FT                   /db_xref="GOA:A0KEJ2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR023961"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEJ2"
FT                   /protein_id="ABK37047.1"
FT                   /translation="MSTTTQSDAGISREIVVIGSGFAAQQLVKSLRKLDAEQPIRLITA
FT                   DSGDEYNKPDLSHVVSRGCAAAAMTRQSGSDFAEQQRIALLPHCPVLGIDPVRRLVLTE
FT                   QGEFPYGQLVLATGASAVRPELPGSEHLVTLNSQQEYAAVEGAIQQARRILVLGAGLIG
FT                   CELAMDMASDGREVTLLDLADSPLSALLPATLTQPLQQALRSQGVSLQFGTGLARIDGQ
FT                   PGDGWRVTLTDGRTSEQDLVIAAIGLRPNLALARGAGLAVERGILVGDRLQTSDPHIFA
FT                   LGDCVQWQGQLLPFLQPIVLGANALARTLLGTPTPLALPPMLVKVKTPRYPLQLAGRTQ
FT                   GEDLAWQCRWNSHGMVAEARDQAGELCGFVVGGDQMSAAFPLLRQLPR"
FT   gene            135498..135839
FT                   /locus_tag="AHA_0121"
FT   CDS_pept        135498..135839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0121"
FT                   /product="tellurite resistance protein TehB"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38137"
FT                   /db_xref="InterPro:IPR014510"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ3"
FT                   /protein_id="ABK38137.1"
FT                   /translation="MAMQLIPSHWVVRRSTPFFTRQNVPQALLTHHNTAAGVFGQLCVM
FT                   EGTVTYHGFADEQAEEPEISLVIRAGEFATSPPQYWHRVELSEDARFNIHFWAEQAESD
FT                   QPLFNSRKA"
FT   gene            135961..137178
FT                   /locus_tag="AHA_0122"
FT   CDS_pept        135961..137178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0122"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38976"
FT                   /db_xref="GOA:A0KEJ4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ4"
FT                   /protein_id="ABK38976.1"
FT                   /translation="MSVIEAVTMAAGLAYLVLLAWQARSGWQWRLALGLLLMLWLLAAD
FT                   SLLWLGVGLVAAVLVFWHQRRPLPALEALDSQWLRTRTRQLLLLCWGLVTLQYGLHVWQ
FT                   LGQGMSPWLVRPDVVDGFLPIAGGLGLRAWLGQGLVDPHHPAATVTVLVLSLSALLLGR
FT                   VFCAWFCPLGLVGEWLHGLRSRWITGEWTPPRWLDVVLRGQKFLVLAFLLFIVLIAVPG
FT                   AALPGYFTSPYHQAADMKMGAFFFNLTLISALCLGWVLLLTATFRQGFCRYLCPYGAWL
FT                   ALLGLLTPLRIRRDPARCLRSAGHDCDKCSRACPSRIQVHQLIAVRSLECTSCLSCVAA
FT                   CPKRADALHLGTQGRRLAPRQLLGLLCLLLLVLPLLAYGLLGIWVSLTPLADRAQLLQL
FT                   LPQLTH"
FT   gene            137466..138692
FT                   /locus_tag="AHA_0123"
FT   CDS_pept        137466..138692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0123"
FT                   /product="Low affinity tryptophan permease"
FT                   /note="identified by match to protein family HMM PF03222;
FT                   match to protein family HMM TIGR00837"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39280"
FT                   /db_xref="GOA:A0KEJ5"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ5"
FT                   /protein_id="ABK39280.1"
FT                   /translation="MGQKPSLVGGACIIAGVCVGAGMLGLPSAGAGAWTIWSVLAITLT
FT                   MIVMTLSGWMLLESYQGYPLRVSFDTVTRELLGEKLNALNNLTVYFVGGILLYAYITSA
FT                   GLIIDGMTGIGSQWGSVLFTLGFSGLVWHSTRAVDRISVVLVIAMGLSFVFGISGLSLN
FT                   IKPTLLFDTLSEHASYAPYALAMLPVALTSFGYHHSVSSMRAYYGEERRARYAILGGTA
FT                   IALLFYLIWLVSVFGNLPRSEFGPVVAQGGNVDVLLKALASVIESEAVASALNLFSMAA
FT                   ILSSFIGVGLGVFDYLADLFKFDNGRGGRAKSWAATFLPPLLLSLLFPFGFLMAIGYAG
FT                   AVATLWTCIIPALLAWKVRAGKGKQGDKQGGFRAPGGMPMIAGVFLFGVLTAAFHLLNM
FT                   AGLLPVYTG"
FT   gene            complement(138783..139262)
FT                   /locus_tag="AHA_0124"
FT   CDS_pept        complement(138783..139262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0124"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36568"
FT                   /db_xref="GOA:A0KEJ6"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ6"
FT                   /protein_id="ABK36568.1"
FT                   /translation="MQLKTLALLLASHLLVGAAGFAAGIYTLPILIAPPAPANEQVAAR
FT                   QAQASFHGTFRRDLQDSDRLHWGEGQVSIGPDAISLMGKLAPGPDYQLYLSPVFVETEA
FT                   DFARLKEKMVKIGPVKTFDNFIVPLPADVNPADYDSVIIWCETFGQFITAARYRQ"
FT   gene            complement(139376..139780)
FT                   /locus_tag="AHA_0125"
FT   CDS_pept        complement(139376..139780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P76002"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35905"
FT                   /db_xref="PDB:4DZG"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ7"
FT                   /protein_id="ABK35905.1"
FT                   /translation="MKRAIQAALLAITMVAGAQAADKITTVPVQFAKGAHSAQLKGSFT
FT                   GYDTIHYTLVAKAGQTMTVKIGGSSNANFNVFAPGAQPGQAEAIGRNDGDGQWQGALPA
FT                   SGKYLIQVYQMRASARRGEQVPHTLAVSIQ"
FT   gene            140006..140512
FT                   /locus_tag="AHA_0126"
FT   CDS_pept        140006..140512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0126"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37508"
FT                   /db_xref="GOA:A0KEJ8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ8"
FT                   /protein_id="ABK37508.1"
FT                   /translation="MLIIFSGLPGSGKSTIARALAQRLGAVYLRIDTIEQAIRDAERTA
FT                   EEMGPAGYFVAYGLARENLKLGSTVITDSVNPIQLTRDAYHDIARSVGVPCLDVEVVCS
FT                   NSKLHRERVENRTVDIEGLALPDWQAVIDRDYQPWNSERLVLDSATLSVTQSVEKIVAA
FT                   LGKPL"
FT   gene            complement(141378..143447)
FT                   /gene="glyS"
FT                   /locus_tag="AHA_0127"
FT   CDS_pept        complement(141378..143447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="AHA_0127"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37089"
FT                   /db_xref="GOA:A0KEJ9"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEJ9"
FT                   /protein_id="ABK37089.1"
FT                   /translation="MAQHTFLVEIGTAELPPKALRSLAEAFADNLKSELTKADLAFGDV
FT                   EWFASPRRLALKVSELAGEQPSKSVEKRGPAVAQAFDAEGKPTKAAEGWARGNGITVEQ
FT                   AERLVTDKGEWLVHTAKVEGRPAKDLLGELVSQALAKLPIPKMMRWGDKTIQFVRPVFT
FT                   VTLLLDGELVPAHILGIDSARTLRGHRFMGESEFTIDNASQYPQILQERGMVIADFMAR
FT                   KVKIKADAEAAAAAFGGVADLDDALLEEVTALVEWPVVLTANFEEKFLAVPAEALVHTM
FT                   KGDQKYFPVYDKNGKLLPKFIFVTNIESKDPSQIISGNEKVVRPRLSDAEFFFKTDLKQ
FT                   TLASRLPRLETVLFQQQLGTVKAKVERIETVAGFIAERIGADVAQAKRAGLLSKCDLMT
FT                   NMVGEFTDTQGVMGMHYARHDGEDEAVAVALNEQYMPRFAGDALPSGLVACAVALADKF
FT                   DTLAGIFGIGMLPKGDKDPFALRRAAIGALRIMTEKQLDLDLVELVEEAVRVYGDKLTN
FT                   KTVVTDVVDFMLGRFRAAYQDEGIGADVVLAVLARRPTRPLDFDRRVKAVSHFRSLDAA
FT                   LALAAANKRVSNILAKVEGELPTAVKPELLVDAAEKALATQVAELQAELAPLFAAGDYQ
FT                   AALTRLAALREPVDTFFNEVMVMADDEALKANRLALLNNLRNLFLQVADISLLQ"
FT   gene            complement(143457..144380)
FT                   /gene="glyQ"
FT                   /locus_tag="AHA_0128"
FT   CDS_pept        complement(143457..144380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="AHA_0128"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36453"
FT                   /db_xref="GOA:A0KEK0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEK0"
FT                   /protein_id="ABK36453.1"
FT                   /translation="MQKFDVKTFQGLILQLQDYWSRQGCTIIQPLDMEVGAGTSHPMTC
FT                   LRALGPEPIACAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKE
FT                   LGMDPEIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHADVEFLFHC
FT                   FEQYEKEAQNLLALEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCQRSENKQG"
FT   gene            144590..145171
FT                   /locus_tag="AHA_0129"
FT   CDS_pept        144590..145171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0129"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="identified by match to protein family HMM PF03352;
FT                   match to protein family HMM TIGR00624"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35891"
FT                   /db_xref="GOA:A0KEK1"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK1"
FT                   /protein_id="ABK35891.1"
FT                   /translation="MELRCAWVTKDPEYIEYHDKQWGRPVHDSRELFAKLCLDGQQAGL
FT                   SWITILKRTESYHRAYADFDPVRIAQFDEQDVERLMQDTGIIRNRLKVQSIIKNARAYL
FT                   ALGAEGVDFVDYLWGFVGGAPIVNQRQGNGDIPATSAESDAMSKALKKRGFTFVGSTIC
FT                   YAFMQAVGMVNDHLVTCPCHAECQQGPARQ"
FT   gene            complement(145248..147284)
FT                   /locus_tag="AHA_0130"
FT   CDS_pept        complement(145248..147284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0130"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF01814; match to protein family HMM TIGR02481"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37502"
FT                   /db_xref="GOA:A0KEK2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK2"
FT                   /protein_id="ABK37502.1"
FT                   /translation="MSALLRNVSIRHLLLSASLVILITMALAGLWRSSLTARLGELPNQ
FT                   LIVSANEQIALQELRYHTTQVQQFLTDAAVSGEMDSIGEAEQHAQAARQLLERLPQLKA
FT                   PLTPLLARQLEIGKRMVDIYLKEGREAGNQLMKQPTEGFDALTDNIASQVEAVLEQQQH
FT                   QFQQREQDIRGQSEALQHQDMLQLAVSLAIILLMLLLIYFKTVGPLQHLMGQLVELANH
FT                   SHNLTFRLHSQGKDEFAYLAEVFNRFLGNIDSLIGTVQQVSRKTHDKMALLMSHSGSTL
FT                   SSMQQAQQNTDMLATAINEMTATVHNIEHNTEQASQDTLLTQQQAHDGQRQVSQTISLI
FT                   RQVADHIEQSAGEVTQLDQESTQIGNILQVIRTISEQTNLLALNAAIEAARAGEQGRGF
FT                   AVVADEVRQLATRTQAATVDIQQRIEALQHNTRHAVTTMHTTRNVSEQAVSQAAGTGET
FT                   LTAIVEAITRVNDMNGHIATAAGQQAQVTEETNRNVMEVASIARECLELARQSRSHTRD
FT                   MNQANEEIGLISDQFDVSKAGSATQDQELLHWNEAFMVQVSSMDNQHLGLFEAMNRLYQ
FT                   AVLDKSPAQLRKQRLDELLKLATQHFADEERVMEQAGYPELRRHKQEHARLLAELDTLM
FT                   QRNGTDDEEFNMELLVFLKNWLLNHISKVDKQYSGTLRQAGIA"
FT   gene            147537..148193
FT                   /locus_tag="AHA_0131"
FT   CDS_pept        147537..148193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0131"
FT                   /product="inner membrane lipoprotein YiaD"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM PF05433"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38550"
FT                   /db_xref="GOA:A0KEK3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK3"
FT                   /protein_id="ABK38550.1"
FT                   /translation="MHFKTLVPAVALLVALTGCTTNPYTGESQTSKGAWGALAGAATGA
FT                   AVGALSSSKGDRKKGILTGVAAGAALGGGIGYYMDVQEAKLREKLQGTGVSVTRNGDQL
FT                   ILNMPNNVTFDSSSAQLKAAGANTLSGVAMVVGEFDKTRLNVVGHTDSTGSRELNMKLS
FT                   AQRADAVAAQLIGQGVTGSRISTSGVGPDQPVATNSTAEGKAQNRRVTITLTPTA"
FT   gene            complement(148461..148808)
FT                   /locus_tag="AHA_0132"
FT   CDS_pept        complement(148461..148808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0132"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37096"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK4"
FT                   /protein_id="ABK37096.1"
FT                   /translation="MPAITRIGTTQRWSDVVIHNGTLYVVEVPATDTADIHQQTREVLE
FT                   SLQRLLEANGSGVDKILMANIYLKDIANIAAFNEQWDAWIPAGTAPVRACVQARLAHEG
FT                   YKVEVQLTAAV"
FT   gene            complement(148830..149078)
FT                   /locus_tag="AHA_0133"
FT   CDS_pept        complement(148830..149078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37411"
FT                   /db_xref="GOA:A0KEK5"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEK5"
FT                   /protein_id="ABK37411.1"
FT                   /translation="MMSALFCDATHELDAIGLRCPEPVMMVRKKVRLMADGETLLVSAD
FT                   DPSTTRDIPSFCRFMDHTLVASETEQAPYRYLIRKGQ"
FT   gene            149247..149438
FT                   /locus_tag="AHA_0134"
FT   CDS_pept        149247..149438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37233"
FT                   /db_xref="GOA:A0KEK6"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK6"
FT                   /protein_id="ABK37233.1"
FT                   /translation="MQVSYGRLQAYAGMGFLSFAMIVMGSPIGNTGTWFGSMVMIGLGL
FT                   WIELSDYYDEDEDENDQS"
FT   gene            complement(149511..150749)
FT                   /locus_tag="AHA_0135"
FT   CDS_pept        complement(149511..150749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0135"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37806"
FT                   /db_xref="GOA:A0KEK7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK7"
FT                   /protein_id="ABK37806.1"
FT                   /translation="MKWLSFSLIALLSLPVGASQVEVLHWWTSGGEARAVEVLKSEWTE
FT                   QGNQWNDFAVQGGGGKSAMTVLKSRALAANPPEAAHLKGFELREWAGLGFLRDLTPMAE
FT                   HLGWYPQLPPMVRETLSQNGALMAVPTGIHRVNWLWLNRKIFERNKLTPPTSWAQFVTV
FT                   ADRLKQQGITPLAIGNEPWQLAVLFETVALGEGGKAFYRKAFVEQDSATLTGPDMVRVL
FT                   TRFQQLRGYVPEKYAGLKWHQATNLLESGGAAMQIMGDWVKGELSAGNYRPGEDIECLP
FT                   SPGSANLFSYNLDSIAMFKQRDPAQLQAQGELAQLLMTPRFQQEFNRVKGSIPALTKPD
FT                   MSKFDRCAIRSYQDFLLAEREGNLLPSMAEGMATPTNMRQAIMDVLSNFFNDPRANPQQ
FT                   TALHLERAMRSTR"
FT   gene            complement(150754..152169)
FT                   /locus_tag="AHA_0136"
FT   CDS_pept        complement(150754..152169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0136"
FT                   /product="signal transduction histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38358"
FT                   /db_xref="GOA:A0KEK8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK8"
FT                   /protein_id="ABK38358.1"
FT                   /translation="MPRSLLSRMLLLLLLAILLSQTILTGIWMQQIQKRELEGMLSTTR
FT                   NLALSAASTVNFFKSLPLQYRHIALDQLRNMGGSRFFVSLNEEEIHISAIPDSERKTLV
FT                   LKEVQGVLTRKLSDAMAIKVDFSRPEELHVFNNDTLLADLPSSWARYTLSLEPINPPVL
FT                   VTQIEIEPGEWLYLAALLPAPYMTLDDTVMPSNQVRFIALMTVFLCFFTFLLVRWQTRP
FT                   LRRLAKAAVNLGKDIDQPSLKEEGASEIVAATRAFNIMQHRIRRYIDDRERLFSSISHD
FT                   LKTPITRLRLRVELLDDEQQIAKFNKDLDELELMVKGALQTVKDTDIHENIEQLDIDAM
FT                   LEQMAEAMNLHDERLTIEGHCKQPYRGKPLALKRCIGNLVDNGIKYGQRVRIIIMDDEE
FT                   MLILFIMDEGPGLPEDQFERIFEPYYRLSTDLAGTGLGLGIARNIAHAHGGDLVLENRP
FT                   QGGLQATLSLPRQ"
FT   gene            complement(152251..152985)
FT                   /locus_tag="AHA_0137"
FT   CDS_pept        complement(152251..152985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0137"
FT                   /product="GltR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38417"
FT                   /db_xref="GOA:A0KEK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK9"
FT                   /protein_id="ABK38417.1"
FT                   /translation="MHIHMSTSKQLLIVDDDQEIRELLNEYLTRAGFEVLTAAEGNEMR
FT                   KLLAQHNPDLIILDIMMPGDDGFTLCQQIRRDSQVPIIMLTAASDEADRVIGLELGADD
FT                   YITKPFSPRELQARIKALLRRAEFRQPEKEKEPSRRLRFAEWTLDTLSHQRTHEDGSLL
FT                   DLSGSDALLLGMFLQQPGVVLDRDTISDATRGRESLPMERGIDVQISRLRQKLGDNGKS
FT                   PRIIKTIRGSGYMLIAEVHEIP"
FT   gene            complement(153298..154461)
FT                   /gene="fadA"
FT                   /locus_tag="AHA_0138"
FT   CDS_pept        complement(153298..154461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="AHA_0138"
FT                   /product="acetyl-CoA C-acyltransferase FadA"
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930; match to protein family HMM
FT                   TIGR02445"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39512"
FT                   /db_xref="GOA:A0KEL0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEL0"
FT                   /protein_id="ABK39512.1"
FT                   /translation="MKDVVIVDCIRTPMGRSKGGAFRNVRAEDLSAHLMKSILLRNPNL
FT                   DPNEIEDIYWGCVQQTLEQGFNIARNAALLAGIPKQVGAVTVNRLCGSSMQALHDASRA
FT                   IQVGDGDIFIIGGVEHMGHVPMSHGVDFHPGMAKSVAKASGMMGLTAEMLGKLHGISRQ
FT                   QQDEFAARSHRRAHAATVEGRFAKEIVGLEGHDASGARFFYDYDEVIRPETTVETLSQL
FT                   RPVFDPVNGTVTAGTSSALSDGAAAMLVMSADRAKALGLTPRAKIRAMAVAGCDAAIMG
FT                   YGPVPATQKALKRAGLTIGDIDLFELNEAFAAQSLPCVKDLGLQDVVDEKVNLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMEEKDATLGVATMCIGLGQGIATVFERV"
FT   gene            complement(154483..156630)
FT                   /gene="fadB"
FT                   /locus_tag="AHA_0139"
FT   CDS_pept        complement(154483..156630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="AHA_0139"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="5.1.2.3"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737; match to protein family HMM TIGR02437"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38031"
FT                   /db_xref="GOA:A0KEL1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEL1"
FT                   /protein_id="ABK38031.1"
FT                   /translation="MIYQGETLTVSYLEDGIAELRFDAPGSVNKLDRATLLSLSEAIAA
FT                   LQQERELKGLILTSGKDAFIVGADITEFLELFDLPQADLLGWLKKANDIFSAIEDLPVP
FT                   TLSAIKGHALGGGCETILSTDFRLADTSAKIGLPETKLGIMPGFGGTVRLPRVIGADNA
FT                   LEWITTGKDYRADDALKVGAIDAVVAPDALQSAAVQMIKDAVKGKLDWQGRRAAKKAPL
FT                   RLSKLEAMMSFTTAAGMVAAVAGKHYPAPMTAVKTVEAAAGMSRDEALAVEAQGFIKLA
FT                   KTDVAKALVGIFLNDQHIKALAKKAAKQAAKATSHAAVLGAGIMGGGIAYQSASKGIPA
FT                   VMKDINEKALALGMGEATKLLNGQLEKGRIDGIKMGQVLSAITPTLSYDNVKHVDVVVE
FT                   AVVENPKVKAAVLGEVEGIIGEDAVLASNTSTIPISLLAKELKRPQNFCGMHFFNPVHR
FT                   MPLVEIIRGEQTSDETINRVVAYAAAMGKSPVVVNDCPGFFVNRVLFPYFFGFNKLVAD
FT                   GADFAAVDKVMEKEFGWPMGPAYLLDVVGIDTGHHAGDVMAQGFPARMSKEGRTAIDVM
FT                   YEVNRFGQKNGKGFYAYEQDKKGKPKKVADAASYELLAPIAKPKQDFDKDAIIARMMIP
FT                   MINEVVLCLEEGIVATPAEADIALVYGLGFPPFRGGVFRYLDTIGLDRYVAMADQYADL
FT                   GPLYRVSDKLREMAAQGKTFY"
FT   gene            complement(156833..158770)
FT                   /locus_tag="AHA_0140"
FT   CDS_pept        complement(156833..158770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0140"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /EC_number="6.2.1.16"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR01217"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36572"
FT                   /db_xref="GOA:A0KEL2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL2"
FT                   /protein_id="ABK36572.1"
FT                   /translation="MHNLCLWQPDQERIQQSNLQHFMAEVNRFHGLQLHSYAQLYQWSV
FT                   EKTTRFWPLVWQHCGVKGELGNIVAENRQEMQRTRWFPDSRLNFAENLLRRQDDTPAII
FT                   SRIEGSPSQTLSWRELADQVARLAQWLRGQGIGRGDVVAAYLPNIPQTVVAMLATTSLG
FT                   AIWTSTSPDFGEASVVERFGQTRPRVLFAVDGYHYNGKAIDIQDKVAGVVGQIDSIEQT
FT                   VIIPLLGHPLQLGHDWRQILASQPDASLQFEPMAFNDPLYILYSSGTTGKPKCIVHGIG
FT                   GTLLQHLKEHQLHCDIKPGERIFYFTTCGWMMWNWLVSALASGATLVLYDGSPFYPDGN
FT                   VLWDLARDEEVALFGTSAKYLDALHKQGYAPIKTHQLPQLRLICSTGSVLSPEGFDYVY
FT                   QQIKRDVQLSSISGGTDICSCFVIGNPISPVYRGESQGRGLGLAVQVFNEAGQPVQGEK
FT                   GELVCTKPFPAQPIGFWGDASGDKYHAAYFERFDNIWCHGDWIELTPTGGILFYGRSDA
FT                   TLNPGGVRIGTSEIYRYVEQLEEVEESIVIGQQWQQDERVVLFVKLKPGLMLDEALRER
FT                   IRQQVRLHCTARHVPARILQVDAIPRTKSGKIVELAVREVVHNRPVNNTHALADPEVLS
FT                   QYRDRPELAS"
FT   gene            158961..160283
FT                   /gene="pepQ"
FT                   /locus_tag="AHA_0141"
FT   CDS_pept        158961..160283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="AHA_0141"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="identified by similarity to SP:P21165; match to
FT                   protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36051"
FT                   /db_xref="GOA:A0KEL3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEL3"
FT                   /protein_id="ABK36051.1"
FT                   /translation="MSSYSQLFAQHLDTLQQRTRDILQQQGLSGLAIHSGQTHRIFLDD
FT                   QDYPFKVNPQFKAWLPVLDNPHCWLLVDGVNKPVLLFYRPVDFWHKVAELPNAFWVDFF
FT                   DIRFLTRPEQVADHLPANKQEWAYLGGHLEVAELLGLGQPNPEAVLNYLHYHRAYKTAY
FT                   ELECLRDANRIGVRGHIAAKDSFMAGASEFEINLAYMKAVGQGANEAPYGNIVAINRNA
FT                   AILHYTHLSAQRVPDAERYSFLIDAGVDVHGYASDITRTWAWRRGEFADLIAALDAQQQ
FT                   EIIEEIKPGRRYSELHLQMHHRLARLLQATELVDMSVDEMIHTGVTNVFFPHGLGHFLG
FT                   LQVHDAGGFMQDERGTHLSAPEQFPYLRCTRVMEVGQVFTIEPGLYFIDSLLEPLRLGE
FT                   QGKRVNWNKVEALRPYGGIRIEDNVVLHANGVENLTRQAGL"
FT   gene            160283..160900
FT                   /locus_tag="AHA_0142"
FT   CDS_pept        160283..160900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB38199.1; match to
FT                   protein family HMM PF01205; match to protein family HMM
FT                   TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38489"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL4"
FT                   /protein_id="ABK38489.1"
FT                   /translation="MAADYSIPAAPLEVSEEIKKSRFITYIAHTPTVEAAKAWIGDIKQ
FT                   QHPGARHHCWAFVAGAPQDSQVYGFSDDGEPSGTAGKPMLAQLMGAGLGEIAAVVVRYY
FT                   GGVLLGTGGLVKAYGGGVGAALKQLETRIKRQQTASLIQCDYTDMGAVEALIQAHQGQL
FT                   LAADYGASVTLQVAWEAAVWSRIAQELTDRTQGRVSLRPLDG"
FT   gene            160937..162394
FT                   /gene="trkH"
FT                   /locus_tag="AHA_0143"
FT   CDS_pept        160937..162394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="AHA_0143"
FT                   /product="Trk system potassium uptake protein TrkH"
FT                   /note="identified by similarity to SP:P21166; match to
FT                   protein family HMM PF02386; match to protein family HMM
FT                   TIGR00933"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36858"
FT                   /db_xref="GOA:A0KEL5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL5"
FT                   /protein_id="ABK36858.1"
FT                   /translation="MQILSIIRIVGLLVALFSSTMLLPALVAFGYRDGGGAEFVNSFFI
FT                   ALLLGAALWFPNRHQKKDLRSKEGFLIVVLFWVVLGSVGALPFLLGEVPGMTVSEAFFE
FT                   SFSGLTTTGATVLTGLDNLPKAFLFYRQLLQWLGGMGIIVLAVAILPLLGIGGMQLYRA
FT                   EIPGPVKDNKVTPRIAETAKALWFIYLLLTSLCALAYWMAGMTLFDAICHSFSTLSVGG
FT                   FSTHDASIGFFNSPAINLITVVFLLLASVNFALHFMVFAHKPVRLSNYLRDSELKVFLS
FT                   IQCVLVLICFVSLLFHGHYATWQEALNHGLFQAVSLGTTTGYSTTSYAEWPSFLPMLLM
FT                   FSAFIGCCAGSTGGGIKVMRFMILFLQGMRELKRLVHPRAIYTLKLGRRAVPERIVEAV
FT                   WGYFATYIILFFIFMLLLLMTGLNEVTAFSAVAAAFTNVGPGLGEVSANFGKISATAQW
FT                   ILVVAMLFGRLEIFTLLVLFTPAFWRS"
FT   gene            162333..162926
FT                   /locus_tag="AHA_0144"
FT   CDS_pept        162333..162926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0144"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35989"
FT                   /db_xref="GOA:A0KEL6"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL6"
FT                   /protein_id="ABK35989.1"
FT                   /translation="MADWKSSLFWYCLPLHSGVVEVGMDKILVLYSSRDGQTRKIVDAM
FT                   LAETEGCEVVMQDLHSLPKCNLSKFKKVLIGASIRYGNFHPSLFSFIHAHHEQLEVANA
FT                   AFFCVNLTARKPEKQTPQTNAYMKKFLRLSPWKPKTLGVFAGALQYSRYNWWQTRIIQL
FT                   IMKITGGSTDTSKDLEFTDWEKVRGFARDFWSKR"
FT   gene            163378..164914
FT                   /gene="rrsB"
FT                   /locus_tag="AHA_0145"
FT   rRNA            163378..164914
FT                   /gene="rrsB"
FT                   /locus_tag="AHA_0145"
FT                   /product="16S ribosomal RNA"
FT   gene            165116..165191
FT                   /locus_tag="AHA_0146"
FT   tRNA            165116..165191
FT                   /locus_tag="AHA_0146"
FT                   /product="tRNA-Glu"
FT   gene            165420..168315
FT                   /gene="rrlB"
FT                   /locus_tag="AHA_0147"
FT   rRNA            165420..168315
FT                   /gene="rrlB"
FT                   /locus_tag="AHA_0147"
FT                   /product="23S ribosomal RNA"
FT   gene            168431..168548
FT                   /gene="rrfB"
FT                   /locus_tag="AHA_0148"
FT   rRNA            168431..168548
FT                   /gene="rrfB"
FT                   /locus_tag="AHA_0148"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(168638..171214)
FT                   /locus_tag="AHA_0149"
FT   CDS_pept        complement(168638..171214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0149"
FT                   /product="acyl-CoA synthetase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36403"
FT                   /db_xref="GOA:A0KEL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL7"
FT                   /protein_id="ABK36403.1"
FT                   /translation="MKPSGLDRLFKPQSIAVIGASTDPQKAGHVVIRHLLAGQFKGPIL
FT                   PVSPHSTAIAGVLAYGDIDSLPLAPDLAIVCTRRERVLTLIEALGKRGAGAAIILAADF
FT                   TAPEREQLQQLSQQYGIRLLGPNSMGMLLPGQGINASFSPIAAKPGQVAFLSQSAAVST
FT                   TILDWAKQHELGFSAFISLGDHCDINFGQLLDQLSRDSVTRAILLYMDKLQDARHFLSA
FT                   ARAASRNKPILVLKSGRHEPDNGLDNVYDAAIRRAGMLRVRDTHELFAAVETLSHSLTL
FT                   KGERLAIISNGRGLANMAIDKLLERGGKLAMPPRDIGSDADINDYQQALDDLLQGDEAD
FT                   AILLIHAPSLTARGAALARSLIDYVKQHPRARRFNILTNWAGEYSAQEGRRLFSEAGFP
FT                   TYRTPESAVAAFMHMVEYRRNQKQLMETPASLQGDRLNLELCQQLIRQALERKQLTLDT
FT                   HLAHPILQAAGLSTLPTWIVSDAIEATLTAEQIGYPVAVKLRSPDILHKSAVHGVMLNL
FT                   RTSAEVAQAADAILDRVRQHDPSARIEGLLVQRMARRSGGLELRIRLQQDPVFGPVILL
FT                   GESGAEPQEMMAALPPLNQALARYQIIGALKSRKIREQASPERLDIDALGQVLCQLSEL
FT                   LLAFPEIQQLDLHPLQACGAEMVVLDASLTLQPAEEGRCRLAIRPYPTELEEGAWLKDQ
FT                   SHVLLRPIRPEDEPAHKQFVLKVSDEDRYKRFFADVGELGHEELARMTQIDYDREMAFV
FT                   AVGQDGPFDQQILGVVRAISNPDLSDAEFAILVRSDLKGLGLGKLMMEKIVRYARERGI
FT                   GQLSGMTMPSNRGMINLAKRLGFKIDIQLEDGVVNMELPCASQGQA"
FT   gene            complement(171287..171478)
FT                   /locus_tag="AHA_0150"
FT   CDS_pept        complement(171287..171478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36870"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL8"
FT                   /protein_id="ABK36870.1"
FT                   /translation="MMPHLIEINSSLLFDEYLQSLGVPQTQLDQEQDIYLQERHLAAVR
FT                   QIQGELKFYLRASALTRQ"
FT   gene            171648..172520
FT                   /locus_tag="AHA_0152"
FT   CDS_pept        171648..172520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38330"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL9"
FT                   /protein_id="ABK38330.1"
FT                   /translation="MIRIWLCCVMLLAGSVPAAEVPIRAWNLLLDHPNPAVAALLRLSL
FT                   DLTVPEYGPYRLIASPPMEQGRAVKELQSGELVQIGVFAPDEERERTLLAIHVPLAKGL
FT                   LGWRVCLIRQGDEGRFANIRSLTDWQQAGLRIGQHRSWPDTRLLKENGLNVVVGSLYDA
FT                   LFNMLRKQRFDCFLRSVIEIEEELKQHPELAIEPHLVFRYPLALLFFVSPKYPELAKRI
FT                   ELGLQRARQSGDYERVFEAGFGSTIRRLQLDRRVMLELSNPDLPAGSRAMMQDPSLIYA
FT                   PALSAVSAQ"
FT   gene            complement(172509..173402)
FT                   /gene="ilvY"
FT                   /locus_tag="AHA_0151"
FT   CDS_pept        complement(172509..173402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="AHA_0151"
FT                   /product="transcriptional regulator IlvY"
FT                   /note="identified by similarity to SP:P05827; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36265"
FT                   /db_xref="GOA:A0KEM0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEM0"
FT                   /protein_id="ABK36265.1"
FT                   /translation="MDLRNLELFLHLADSLHFGKSADAMAVSPSTLSRAIQRLEQETGC
FT                   ILFERDNRSVRLTPAGEKLREFGGALLQEWRQLKQELRRSDEPLQGRLRVFCSVTASYF
FT                   LLPEVLERFRRRYPQLEIKLETGDPALAVDKILTDEADLAIAARPDALSSKLEFASLQQ
FT                   VPLVFIAPRTAPQQSQWFSQGEPDWERLPLILSEQGLARKRCDQWLRNKGIAPNIYAEV
FT                   AGNEGIVAMVALGFGVGLVPAAVIDHSPMGEKVRIVEPKPALKPFDVGIAVLKKRLEEP
FT                   LIRAFWDTARGQGSLR"
FT   gene            173624..175105
FT                   /gene="ilvC"
FT                   /locus_tag="AHA_0153"
FT   CDS_pept        173624..175105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="AHA_0153"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF07991; match to protein
FT                   family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38758"
FT                   /db_xref="GOA:A0KEM1"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM1"
FT                   /protein_id="ABK38758.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMQREEFADGCNVLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDISYALRKAAITEKRASWQKATDNGFAVGTYEELIPTADLVLN
FT                   LTPDKQHSDVVKTVMPLMKQGAALGYSHGFNVVEEGQQIRADITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCYDKLVAEGTDPAYAGKLIQFGWETITEALKQGGISLMMDRLSNPA
FT                   KLRAFELSEQLKTLMRPLFEKHMDDIIAGEFSRGMMADWAEDDAKLFGWREETGKSAFE
FT                   NAPAFAGKIAEQEYFDNGVVMVAMVKAGVELAFETMVASGIYEESAYYESLHELPLIAN
FT                   TVARKRLYEMNVVISDTAEYGNYLFANAAVPLLREHFMPTLKAGDLGASKAEGQSVDNL
FT                   ALLAANEATRNHPIEKIGQVLRGYMKDMKRIAVGG"
FT   gene            complement(175254..176903)
FT                   /gene="pgi"
FT                   /locus_tag="AHA_0154"
FT   CDS_pept        complement(175254..176903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="AHA_0154"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="identified by match to protein family HMM PF00342"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39217"
FT                   /db_xref="GOA:A0KEM2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM2"
FT                   /protein_id="ABK39217.1"
FT                   /translation="MKNINPTQTQAWQALEAHFAANKETRLKDLFAQDPKRFDKFSLTF
FT                   GGDILVDYSKNLITEETLKLLVDLAKETDLRSAIDAMFNGDKINMTEGRSVLHVALRNR
FT                   SDRPIECDGKDVMPEVNAVLAKMKGFCEKIISGEWKGYTGKAIQHVVNIGIGGSDLGPV
FT                   MITEALRPYKNHLQMHFVSNVDGTHIAETLKKIDPETTLFLVASKTFTTQETMTNALTA
FT                   RDWFIKIAGDKAHVAKHFAALSTNGKAVAEFGIDTNNMFEFWDWVGGRYSSWSAIGMPI
FT                   ALSVGFENFEALLQGAFEMDMHFATASYEQNVPVLLALIGLWYNNFYGAESEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRNGKPVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFLAPAISHNPIGDHHPKLLANFFAQTEALAFGKSKEQVEAEFLAAGKTLEQVKDLV
FT                   PFKVFEGNRPTNSILFKSLTPKTLGALIAMYEHKIFVQGAIWNIFSFDQWGVELGKQLA
FT                   NKILPELNTDAAVTSHDCSTNGLINTWKAWKA"
FT   gene            177320..177508
FT                   /locus_tag="AHA_0155"
FT   CDS_pept        177320..177508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0155"
FT                   /product="phage lysis protein Y, holin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38604"
FT                   /db_xref="GOA:A0KEM3"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEM3"
FT                   /protein_id="ABK38604.1"
FT                   /translation="MKAVLSLFALSLIATGLIGLLTMVLTSAAPTLPLRVLAVIGAVLG
FT                   GYVLVQPLLNRVARRLV"
FT   gene            complement(177635..178471)
FT                   /locus_tag="AHA_0156"
FT   CDS_pept        complement(177635..178471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0156"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="identified by match to protein family HMM PF00924;
FT                   match to protein family HMM PF05552"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37732"
FT                   /db_xref="GOA:A0KEM4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEM4"
FT                   /protein_id="ABK37732.1"
FT                   /translation="MEPEIITEAQTWLVNNQGLLIEYAVNIAAALITLLVGYIAANLIS
FT                   SAVVKVMQARKLDTTVTHFVGSILKYAILVFVVIAALGRVGVQTASFVAIIGAAGLAIG
FT                   LALQGSLSNFAAGFLLIIFRPIKAGEFIEVAGTNGVVQSVQLFTTTLTSGDNKMVVVPN
FT                   SAILNGTIVNYSRMDTRRVDMTFGIGYGSDLRKAKQILERLVSEEPRILKEPAATIAVA
FT                   ALADSSVNIVVRPWVKTGDYWGVWFDFHEKVKLTFDAEGIEIPFPQMVMHMQKPQA"
FT   gene            complement(178658..179254)
FT                   /locus_tag="AHA_0157"
FT   CDS_pept        complement(178658..179254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0157"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37159"
FT                   /db_xref="GOA:A0KEM5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEM5"
FT                   /protein_id="ABK37159.1"
FT                   /translation="MASSNQKQSRRDQILQALAHMLETSPGQRITTARLAAEVGVSEAA
FT                   LYRHFPSKARMFEGLIDFIEDSLLSRVNLIMAEEKDTMARCHHILQLLLVFAERNPGIT
FT                   RILNGDALLGEHDRLRDRISVLFDKLETQIKQVLREKRLREGQGFQLDETMLANLLLAY
FT                   TEGRISQFVRSEFKIKPTAGFEDQWQFIRSQLLQS"
FT   gene            complement(179324..179782)
FT                   /locus_tag="AHA_0158"
FT   CDS_pept        complement(179324..179782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0158"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR00576"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39267"
FT                   /db_xref="GOA:A0KEM6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM6"
FT                   /protein_id="ABK39267.1"
FT                   /translation="MTTQIELKILDARIGTEYPLPAYATPGSAGMDLRALLDAPLTLAP
FT                   GDTTLVPTGLAIHIQDPGLCATILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNR
FT                   GNDNFTMQPGERIAQLVIMPVVQASFQLVDEFNQSERGEGGFGSSGRQ"
FT   gene            complement(179823..181025)
FT                   /gene="coaBC"
FT                   /locus_tag="AHA_0159"
FT   CDS_pept        complement(179823..181025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="AHA_0159"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="identified by similarity to SP:P24285; match to
FT                   protein family HMM PF02441; match to protein family HMM
FT                   PF04127; match to protein family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36688"
FT                   /db_xref="GOA:A0KEM7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEM7"
FT                   /protein_id="ABK36688.1"
FT                   /translation="MRLADKRILLGVSGGIAAYKSAELVRRLKDQGAEVRVVMTRSAKE
FT                   FITPLTLQAVSGHPVADSLLDPAAEAGMGHIELAKWADLVLIAPASANLMARMAAGMAD
FT                   ELLTTLCLATPAPVALAPAMNQQMYLNAATQANLKTLASRGILLWGPDSGSQACGDVGP
FT                   GRMLDPLELVELCCQQLAAEPLLAGVRLLLTAGPTREALDPVRYISNHSSGKMGYAIAR
FT                   AAREAGAEVTLVSGPVALAPPAGVTRVDVESAEQMHQAVMSRVGECDLFIGCAAVADYR
FT                   PAQVANQKIKKTGDNDQMQLTLVKNPDIIAAVGALSDKPFTVGFAAETVDVEQYALDKL
FT                   QRKRLDMIAANDVSRAGQGFNADDNALTVFWQGGQAPLPLADKLTLARHLIALIADHYR
FT                   H"
FT   gene            181173..181847
FT                   /gene="radC"
FT                   /locus_tag="AHA_0160"
FT   CDS_pept        181173..181847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="AHA_0160"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by match to protein family HMM PF04002;
FT                   match to protein family HMM TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37930"
FT                   /db_xref="GOA:A0KEM8"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM8"
FT                   /protein_id="ABK37930.1"
FT                   /translation="MSIKEWPEDERPREKLLRQGPGGLSDAELLAIFLRTGVSGLSAVD
FT                   LSRHLLQQFGSLRALLGAEQRAFCAAHGLGPAKYAQLQAVLEMGKRHLAEQLQRGDPLT
FT                   SPQLTRDYLQAQLRDRPREVFALLLLDNQHRVIQFVELFYGTLDSASVWPREIVQIALK
FT                   HNAAAVILAHNHPSGVAEPSRADRQITDRITAALALIDIRVLDHLVIGDGITVSFAERG
FT                   WL"
FT   gene            181984..182220
FT                   /gene="rpmB"
FT                   /locus_tag="AHA_0161"
FT   CDS_pept        181984..182220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="AHA_0161"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39915"
FT                   /db_xref="GOA:A0KEM9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM9"
FT                   /protein_id="ABK39915.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHANNATKRRFLPNLHTHRFWVESEKR
FT                   FVSLRVSAKGMRIIDKRGVEVVLAELRASGVKV"
FT   gene            182232..182399
FT                   /gene="rpmG"
FT                   /locus_tag="AHA_0162"
FT   CDS_pept        182232..182399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="AHA_0162"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36179"
FT                   /db_xref="GOA:A0KEN0"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEN0"
FT                   /protein_id="ABK36179.1"
FT                   /translation="MAKGIREKIRLNSSAGTGHFYTTTKNKRTMPEKMEIKKFDPVVRQ
FT                   HVIYKEGKIK"
FT   gene            182493..182948
FT                   /locus_tag="AHA_0163"
FT   CDS_pept        182493..182948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37673"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN1"
FT                   /protein_id="ABK37673.1"
FT                   /translation="MFKLSRKGWNNVIIVVVLIVITLLHRLELAQQENSAKRARPLLPD
FT                   SAVVLTWQGPSWQIERIGQGWRSGPDLGLSSAQLAAHIEAWQGWLLPPGESVRGNPVTL
FT                   KIWVAGQTDPIEVGLYQDSGKFAALLPPSTWLSLSQEQYRSLLRPAP"
FT   gene            182978..183790
FT                   /gene="mutM"
FT                   /locus_tag="AHA_0164"
FT   CDS_pept        182978..183790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="AHA_0164"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38933"
FT                   /db_xref="GOA:A0KEN2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEN2"
FT                   /protein_id="ABK38933.1"
FT                   /translation="MPELPEVEVSRQGISPWLTGIKVTRVVVRDGRLRWPVPGEIQELV
FT                   DLTIHRVSRRAKYLLLETDFGTAILHLGMSGSLRVLDIGTPAEKHDHVDIELANGKLLR
FT                   LNDPRRFGALLWTREPAEAHALLAKLGPEPLTDAFNADYLRERAKGRSTAIKTFLMDNQ
FT                   VVVGVGNIYANEALYAAGIHPKRAAGNISAERLGTLVAEIKRVLAEAIRQGGTTLKDFT
FT                   SADGKPGYFVQQLQVYGRGGQPCFHCHTLLSEIRLGQRTTVFCSHCQR"
FT   gene            183969..184850
FT                   /locus_tag="AHA_0165"
FT   CDS_pept        183969..184850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04393"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38803"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN3"
FT                   /protein_id="ABK38803.1"
FT                   /translation="MARFLYPDDSARKTFNRAKFVLRSLLYRQQLSRVFELFQAEPLKA
FT                   LPAHYPELLDKPMRPYRFAGSTATERAEMLENHYRLMLARYPDLIDPLYLGDGIELGRY
FT                   PESGCRIVLRHDGTFRREAELALSIVDPQGKRLYSCAFSLAGTPNRLAVVIGSVQGPEP
FT                   CIEQAQDKVRALTKEGHGLRPKSLVVMLVMELAEAMQAEHISAVRMKAHIYQARRYSKK
FT                   KKACLQADYDELWQEFGAIDLDSNFVRLQPAQRKPLEEIASKKRAMYRRRYEWLDQLTL
FT                   ASQQLLGPRLAG"
FT   gene            complement(184904..185386)
FT                   /gene="coaD"
FT                   /locus_tag="AHA_0166"
FT   CDS_pept        complement(184904..185386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="AHA_0166"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by similarity to PDB:1B6T_B; match to
FT                   protein family HMM PF01467; match to protein family HMM
FT                   TIGR00125; match to protein family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39025"
FT                   /db_xref="GOA:A0KEN4"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEN4"
FT                   /protein_id="ABK39025.1"
FT                   /translation="MTNKVIYPGTFDPVTNGHTDLIGRAAKLFDEVVVGVANSPSKRPL
FT                   FDLDERVQLARQVTAHLPNVKVVGFSGLLVDFAREQQANVLIRGLRAVSDFEYEFQLAN
FT                   MNRRLMPELESVFLTPAEENSFISSTLVKEVALHGGDIRQFVDPAVAAAIKAKQTK"
FT   gene            185610..186653
FT                   /locus_tag="AHA_0167"
FT   CDS_pept        185610..186653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0167"
FT                   /product="heptosyltransferase"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39719"
FT                   /db_xref="GOA:A0KEN5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN5"
FT                   /protein_id="ABK39719.1"
FT                   /translation="MKRILVVRNDKIGDFMLAWPSFAMLKRSMECHVTALVPAYTAPLA
FT                   RLCPWIDEIILDPGSRADKEQQRALQARIKAAAFDASICLFSNSRNAMLVWKAHIPYRL
FT                   APATKLAQVLYNQRLIQRRSRSQKPEYEYNLDLVRRFLADQQVSAVEPQGPYLSFDAKS
FT                   LQQVREQVAARLRLDAGRPWLMVHAGSGGSANNLSIEQYARLIIKLNQACPELQCILTA
FT                   GPGEERIAEQLAAELLAHGGNGWIYRSDEGLPKFCQVMANAALFVAGSTGPLHIAAALD
FT                   VPTIGFFPAHRSATPLRWRPLNSEGRHLAFSPPEDSDHPEDMSQLDPKTMAAAIARWAP
FT                   PFWRTEH"
FT   gene            complement(186723..187511)
FT                   /locus_tag="AHA_0168"
FT   CDS_pept        complement(186723..187511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0168"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35829"
FT                   /db_xref="GOA:A0KEN6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN6"
FT                   /protein_id="ABK35829.1"
FT                   /translation="MNKPTLAAVLIVKNEAENLRPCLASLDGLVDEIVIMDSGSQDETP
FT                   TIAAEFGARFFVNPVWPGFGRQRRLAQSHVQSDWVLWLDADERLTPELKAAIAAVMANP
FT                   ASDTIYSIPRLSWVFGRFIRHSGWYPDRVLRLYPKALTSYNEVLVHEKVEVRANMKIVN
FT                   LHGDLLHFTYRDLEHYLVKSAGYARAWADQRTARGKKGSLSQGLVHALGCFLKMYLLKA
FT                   GFLDGKQGLLLAILSAHSTFVKYADLWIRQQPQAPDQADK"
FT   gene            187753..188868
FT                   /gene="rfaF"
FT                   /locus_tag="AHA_0169"
FT   CDS_pept        187753..188868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="AHA_0169"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02195"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36566"
FT                   /db_xref="GOA:A0KEN7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN7"
FT                   /protein_id="ABK36566.1"
FT                   /translation="MKILVIGPSWVGDMVMSQSLYKAIKANHPDSELHVMAPAWCGALL
FT                   ERMPEVDKAIPMPLGHGDFKLGARRRLGKQLAAEKYDQAIIQPNSMKSALIPWFARIPV
FT                   RTGWKGEHRFGLLNDMRSNKSAFPLMVEAYLALAYPKAQMKSRADIPTIPQPALNVDLI
FT                   NQEKALERLGLDRARPVLVLCPGAEFGPAKRWPEGHYAVVAQKHLDEGWQVWIFGSAKD
FT                   SAVANTIRDRINPLSRPNCHVLAGKTNLYEAIDLMALAGRVIANDSGLMHVAAALNRPL
FT                   IGVYGSTSPLYTPPLADRVEIVHTDIECRPCFKRTCKFGHLKCLIELMPEQVIEAGRRL
FT                   ECSETPAPPLALPPGEPPRFVAEPGKRGEPH"
FT   gene            188870..190135
FT                   /gene="waaA"
FT                   /locus_tag="AHA_0170"
FT   CDS_pept        188870..190135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaA"
FT                   /locus_tag="AHA_0170"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00534;
FT                   match to protein family HMM PF04413"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38792"
FT                   /db_xref="GOA:A0KEN8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN8"
FT                   /protein_id="ABK38792.1"
FT                   /translation="MGYRLLYNLLIHLGLPLALLALYKPKKGKPGFGKRWAEHLGRTPA
FT                   TGQEAPLWIHAVSVGETLAISPFIRALKAERPDLPILLTTTTRTGAEQAARLGDLVEHR
FT                   YAPLDYPWAVAAFLNAVKPRALWVMETELWPNWLAACEERHLPVTIINARLSERSCRRY
FT                   GRFQGAFDALSQPLTHLLCQHQDDADRFHRLGLGRERLAVTGSIKFDIQLDEQVQARGR
FT                   ALRQLLGAERPVWIAASTHQGEDEQVLAAFDRVLAAQPSALLILVPRHPERFERVAALC
FT                   APYGCVRRTAGGAVGEHDKVYLGDTMGELPLMLAAADVAFVGGSLVKVGGHNLLEPAAL
FT                   GKPCLSGPAYFNFSDITRQLVAQGGAAVVADAAALGEQVSALLADESRRREMGEQARAV
FT                   VLRNQGALARTLSHCLASLEND"
FT   gene            complement(190206..191462)
FT                   /locus_tag="AHA_0171"
FT   CDS_pept        complement(190206..191462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0171"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37494"
FT                   /db_xref="GOA:A0KEN9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN9"
FT                   /protein_id="ABK37494.1"
FT                   /translation="MEFFNFLMFDVLSEPAVLVGLIALIGLIAQKKPVTECIKGTVKTI
FT                   MGFVILGAGATLVVNSLGDFATIFQHAFGIKGVVPNNEAIVSIAQQSFGKEMAMIMFFA
FT                   MLVNILIARLTPWKFIFLTGHHTLFMSMMVAAILSAGGMSGIPLIAVGSLVVGVTMVLF
FT                   PALAHPYMKQITGSDDVALGHFSTCSYVLAGWIGAKFGNKAHSSEEVQVPKSLLFLRDT
FT                   PVAISFTMGIIFLITSAFAGPEFVASVAKGKHWFMFSLMQSITFAAGVYVILQGVRMVI
FT                   AEIVPAFKGISDKLVPNAKPALDCPIVFPYAPNAVLIGFLSSFAAGLVGMVLLYLLGLT
FT                   VIIPGVVPHFFVGAAAGVFGNATGGRRGALLGAFANGLLITFLPVFLLPVLGDLGFANT
FT                   TFSDADFGVVGILLGLIVR"
FT   gene            complement(191523..191846)
FT                   /locus_tag="AHA_0172"
FT   CDS_pept        complement(191523..191846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0172"
FT                   /product="PTS sysytem, mannitol-specific enzyme II, B
FT                   component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36374"
FT                   /db_xref="GOA:A0KEP0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP0"
FT                   /protein_id="ABK36374.1"
FT                   /translation="MSGALRPTEEEHMKILVVCGHGLGTSLMMEMSIKSILKELAVTAE
FT                   VDHRDLASAGSERAEIFVATRDIAEQLVSMGVDGRLVSLDNMVDKAAMKEKLAIALREL
FT                   GAL"
FT   gene            complement(191843..192286)
FT                   /locus_tag="AHA_0173"
FT   CDS_pept        complement(191843..192286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0173"
FT                   /product="ascorbate-specific phosphotransferase enzyme IIA
FT                   component"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39332"
FT                   /db_xref="GOA:A0KEP1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP1"
FT                   /protein_id="ABK39332.1"
FT                   /translation="MLTQLLTEEVISIEAGARDWRHAIELATAPLLANGTIEPSYVAAL
FT                   YRSHEELGPYYVLGPGLAMPHARPEDGVNRLGLALTVLKEGVNFGSEGNDPVRLLVTLA
FT                   ASDSNSHVETIAQLAELFMNEEDVAAIMAATSKDDILRILARY"
FT   gene            192539..193561
FT                   /locus_tag="AHA_0174"
FT   CDS_pept        192539..193561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0174"
FT                   /product="HTH-type transcriptional regulator GntR"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37589"
FT                   /db_xref="GOA:A0KEP2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP2"
FT                   /protein_id="ABK37589.1"
FT                   /translation="MSEAKKRRSTGRVTLNDVAQLAGVGAMTVSRALRTPELVSDKMRE
FT                   RIEAAVDELGYIPNRAAGALASATSQTIVVIVPSLTECGCGEVIAGLQQTLRGEGYQIM
FT                   LGDAQHLKQQEESLLTSFLQHNPAAVVLFGSDPGETIRQRLQAARLPVVEVGAMARSPI
FT                   DMNVGVSNFDAGYQLTRHLIERGYRNIGFLCARQEQWMLQQRMQGWQKALLDNYLSPDA
FT                   IINTSERPSFSTGAAMLGEFLLRWPELDALVCVNDELAAGVLFECQRRHLNVPGKLAIA
FT                   GFDDLDVARACYPALTSVRIPYQRMGEEAADLILRQLVGEPVMGSALTLDFQLQKRQSS
FT                   "
FT   gene            193591..194571
FT                   /locus_tag="AHA_0175"
FT   CDS_pept        193591..194571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0175"
FT                   /product="putative quinone oxidoreductase, YhdH/YhfP
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR02823"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38056"
FT                   /db_xref="GOA:A0KEP3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP3"
FT                   /protein_id="ABK38056.1"
FT                   /translation="MFKALLLENQDGKTVPTLTRLDESQLPAGEVRVAVSYSSLNYKDG
FT                   LAITGKGKIVRQWPLVPGIDFAGTVLESADDRYQPGDKVVLTGWGVGEGHWGGMAEQAR
FT                   VKADWLVPLPAGLDERQAMCIGTAGLTAMLCVLALEEAGVTPQSGEILVTGAAGGVGST
FT                   AVALLAALGYQVAALTGRPEAQGELLTALGASRIVPRSELLEPAKPLEKQLWAGAVDTV
FT                   GSQVLAKLLAQMNYGGAVAACGLAGGFDLPTSVMPFILRNVRLQGVDSVMCPLARRQLA
FT                   WQRLARDLPASFFAQAVTEIGLEQVAEAAEAITQGQIAGRTLVKL"
FT   gene            194616..194765
FT                   /locus_tag="AHA_0176"
FT   CDS_pept        194616..194765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36459"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP4"
FT                   /protein_id="ABK36459.1"
FT                   /translation="MRVHYPRRMSMGGHKPDYDLDDDWEPESWEEELDEWEDESWQDDD
FT                   PLDD"
FT   gene            194898..195239
FT                   /locus_tag="AHA_0177"
FT   CDS_pept        194898..195239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36971"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP5"
FT                   /protein_id="ABK36971.1"
FT                   /translation="MIMRLSVIVFAVLLGGCASHSDDPCEKVWSEVGEADGKLGFTAER
FT                   VEFHQAQCGEKVDAELWKQGHQKGLAWYCRPEHLYLAGRSGGEYRGVCPNDVQARRLFE
FT                   QGRQGWTDQ"
FT   gene            complement(195253..195471)
FT                   /locus_tag="AHA_0178"
FT   CDS_pept        complement(195253..195471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39016"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP6"
FT                   /protein_id="ABK39016.1"
FT                   /translation="MKIDYTRAHRVVEVVEMGNKTLCEWRRSEIPADLKTLRKIVRKPK
FT                   FVCGKCARSANDKSYLCQPLRLKEKEV"
FT   gene            complement(195529..195963)
FT                   /gene="fliL-1"
FT                   /locus_tag="AHA_0179"
FT   CDS_pept        complement(195529..195963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL-1"
FT                   /locus_tag="AHA_0179"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="identified by match to protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38575"
FT                   /db_xref="GOA:A0KEP7"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP7"
FT                   /protein_id="ABK38575.1"
FT                   /translation="MKLFKFLLVLLLSCGALQAYASEGGEAPAEGEAAAAKPGFFYHLL
FT                   DPDIITNYLSDGKTLGYVRVTVELMAENEADLKLLEQHDPLIRDAIIRLMGSKSADQIK
FT                   SLVSREDLRKECQTRANELLVKETGKKAVRELIFTKFLYQ"
FT   gene            196109..196645
FT                   /locus_tag="AHA_0180"
FT   CDS_pept        196109..196645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0180"
FT                   /product="chorismate--pyruvate lyase"
FT                   /EC_number="4.-.-.-"
FT                   /note="identified by match to protein family HMM PF04345"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37637"
FT                   /db_xref="GOA:A0KEP8"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEP8"
FT                   /protein_id="ABK37637.1"
FT                   /translation="MKSELTVPLARLVPWQTPAQCEPPEALLPWLLEADSMTRRLRRHN
FT                   RHFSVQLFGNRSVALDADEQQLVVAEQPMGLCREVILHGDHGPAVLGWTLFAEAALQES
FT                   GLRELGEQPLGERIFGDEPARRDHLQLACFEIASNPWCPAGTVWGRRSRLFLGQWPLLV
FT                   HELFLPSLSCNKELE"
FT   gene            196642..197505
FT                   /gene="ubiA"
FT                   /locus_tag="AHA_0181"
FT   CDS_pept        196642..197505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="AHA_0181"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01474"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37205"
FT                   /db_xref="GOA:A0KEP9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEP9"
FT                   /protein_id="ABK37205.1"
FT                   /translation="MNLLTKERGLAYVQLARIDKPIGTLLLLWPTLWALWLAADGLPDL
FT                   WTLLVFVVGVFLMRSAGCVINDYADRNFDGHVKRTAGRPLPMGKVKPREVLALFAVLAL
FT                   ISFALVLTMNPLTIGLSFAALLLAVCYPFMKRYIPIPQLVLGMAFSWSIPMAYAAQANA
FT                   LPAVAWLVFLANLLWTIAYDTQYAMVDRDDDLKLGLKSSAILFGRHDKRIIGALQLLTL
FT                   LILLLVGQLSELGSSYYWSLLAAAALFVYQQRLIRERQREACFQAFLNNNYVGALIFAG
FT                   VVINYL"
FT   gene            complement(197570..199993)
FT                   /gene="plsB"
FT                   /locus_tag="AHA_0182"
FT   CDS_pept        complement(197570..199993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="AHA_0182"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36673"
FT                   /db_xref="GOA:A0KEQ0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEQ0"
FT                   /protein_id="ABK36673.1"
FT                   /translation="MSLGQNISRAILQWPVSGLVNHKSLPENPITELKLDPARPIVYAL
FT                   KTSSITDLMTLQQCCEDLGLPGPFTPLELNGQLLPRYVCLDRPPPLFGKRSKPLPFLQE
FT                   FHQLLDLHKQDPALDIQVVPVTLFWGRAPGREGEEASGWNIISSLAPNRLKKALIVILK
FT                   GRENLVRFSPPLSLRHMADKHGTDEAIAHKLARVARTHFSRQQLAATGPKLPNRNLLFK
FT                   QLLDSNVIQQAIEEEAQREGISLEKAQKRAHGYMDEIASDFSYRLIRLGESFLGWLWNK
FT                   LYRGLSVNGAEKVRQLAQEGHEIVYVPCHRSHMDYLLLSYVIYHQGMVPPHIAAGINLN
FT                   FWPAGPIFRHGGAFFIRRTFKGNPLYSTVFREYLNLLFAKGYSVEFFTEGGRSRTGRLL
FT                   PPKTGMLAMTLQAMMRGLDRPVTLVPVYLGYEHVMEVNTYHNELKGSRKEKESFLQVLG
FT                   ILRKLRNYGRGFVNFGEPLTLNNYLNEHVPSWKEHIGEEERPEWMAPTVNQLAELLMTR
FT                   INGAAAVNGLTLSALALLAAERHALTRDELQAQLNTYLDLLKQVPYSPHSTIPDEDAKT
FT                   LLDQAMELNKFEVSEDKLGQIVSLDRYQAILLTYYRNNILHLFAMPSLVAALIERCEGI
FT                   SRSEIVARCIDIYPLLKTELFLRYEEDELPELVDALLAELQRQQLIEARDGGFWVNPVN
FT                   QTRLLLLAESIQETLQRYAIVLTRVLAQPRIEAEQLEADGLMMAERLGTLHGINAPEFF
FT                   DQKLFSTLIHTLRSEGYLDPGCKPDLGRFQALADNIVPLLSTKIRRTIQAGNRL"
FT   gene            200198..200821
FT                   /gene="lexA"
FT                   /locus_tag="AHA_0183"
FT   CDS_pept        200198..200821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="AHA_0183"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="identified by similarity to SP:P0A7C2; match to
FT                   protein family HMM PF00717; match to protein family HMM
FT                   PF01726; match to protein family HMM TIGR00498"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36241"
FT                   /db_xref="GOA:Q44069"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44069"
FT                   /protein_id="ABK36241.1"
FT                   /translation="MKPLTPRQAEVLELIKANMNETGMPPTRAEIAQKLGFKSANAAEE
FT                   HLKALAKKGVIEIMPGTSRGIRLLLEEEEPLEESGLPLIGKVAAGEPILAQEHIESHYQ
FT                   VDPALFHPRADFLLRVQGMSMKNIGILDGDLLAVHKTQEVRNGQVVVARLDEDVTVKRF
FT                   QRKGSQVWLLPENEELSPIEVDLSCQQLTIEGLAVGVIRNADWM"
FT   gene            201261..201548
FT                   /locus_tag="AHA_0184"
FT   CDS_pept        201261..201548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39905"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ2"
FT                   /protein_id="ABK39905.1"
FT                   /translation="MASSSPWDPGLASPVSSITRFIKGNRMTRFYALWVHHKGACWTIW
FT                   LGCPKDKIVRLVRLFHSHHDGGLADAPWTAPVIPLRAQSRRPHERRRQQP"
FT   gene            complement(201552..201671)
FT                   /locus_tag="AHA_0185"
FT   CDS_pept        complement(201552..201671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38218"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ3"
FT                   /protein_id="ABK38218.1"
FT                   /translation="MDARSLANFRQKMTQGPVMPARTRPKQQPHHKVGLHKKQ"
FT   gene            201710..202396
FT                   /locus_tag="AHA_0186"
FT   CDS_pept        201710..202396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0186"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38466"
FT                   /db_xref="GOA:A0KEQ4"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ4"
FT                   /protein_id="ABK38466.1"
FT                   /translation="MALPFGPGWRVCRSERVCSLMVKPRYPLLFLLLVGGMMAGFYWNQ
FT                   PSLPEHADYYPAGRDINPFAFTDQDGQPFVPASLTGHWTFLFVGYTFCPDICPTTLADL
FT                   RSVYPELKKIAPNSQVVFISADPQRDDVARLKTYTAFFNPEFKAATGPHDKLFPFVRNL
FT                   GLIYSIADQGEKDYLIDHSASIVLINPAGKLEAVFRPRLSEGSVPRVVMASMVSDFAKI
FT                   VRLDDA"
FT   gene            202386..203804
FT                   /locus_tag="AHA_0187"
FT   CDS_pept        202386..203804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0187"
FT                   /product="DNA-damage-inducible protein F"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37282"
FT                   /db_xref="GOA:A0KEQ5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ5"
FT                   /protein_id="ABK37282.1"
FT                   /translation="MTHDEQRTPSDMLTPVWWRDGRRHRAVFALALPMVFSNVTTPLLG
FT                   LVDTWVIGHLGQAWFLGGVSVGATLINLLFWLLGFLRMSTTGLTAQAHGASSPAGQLDT
FT                   LARALGLAVGLGVTLLLLLLPLIPTLIALSGGSAEVQHYAAEYVSVRVWSAPAALCNLV
FT                   IMGWLLGMQDARSPMLLLIFTNLVNMGLDAWFVLGLGWQVKGVAAASLLADYSALGLGL
FT                   WLVSRHLRRLAASAWQGAWQRWRQWPALLRLLALNRDIFIRSLCLQLCFAFMTLQGARL
FT                   GDVAVAANAVLLNFLMLISYGLDGFAYAVEAMVGRAIGRRDRQGLREAIVLNLGWALLI
FT                   ALTFSLLFAVGGSRLIAHITDLPAVIAAANAQLPWLIAMPLLAVWCFLLDGVFIGATRA
FT                   REMRNSMLVAALCGFFPVWWLCQGWGVAALWAAMAALMAGRGLTLGWLCWQLERDGRLL
FT                   HSAHGVGEAQQASS"
FT   gene            complement(203833..204339)
FT                   /locus_tag="AHA_0188"
FT   CDS_pept        complement(203833..204339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0188"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36903"
FT                   /db_xref="GOA:A0KEQ6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEQ6"
FT                   /protein_id="ABK36903.1"
FT                   /translation="MLAPFSPHQDAVMLDIVLYQPEIPPNTGNIIRLCANTGYRLHLIE
FT                   PLGFEWDDKRVKRAGLDYHEFAEVKRWPNFEAFLEAVAPTRVFACTTKGRTAHSAVQFA
FT                   AGDALLFGPESRGLPIEIIESLPFEQRLRIPMLPQSRSMNLANAVAVFVYESWRQLGYA
FT                   GSLQE"
FT   gene            complement(204372..205727)
FT                   /gene="cpxA"
FT                   /locus_tag="AHA_0189"
FT   CDS_pept        complement(204372..205727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="AHA_0189"
FT                   /product="sensor histidine kinase CpxA"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to SP:P08336; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37467"
FT                   /db_xref="GOA:A0KEQ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ7"
FT                   /protein_id="ABK37467.1"
FT                   /translation="MRTARTFNGLSTQIFLWFWFMLLLVVAAVVILPTLDPRNIIPLPA
FT                   HEITRLNNNLKALQKGADPNQDFDLAQAIDAAGLLPVDNIYLRDAKGQMQSSTRLSKFV
FT                   IRFMLDSDNPAKPMLGSEHKRAIAGPFQMTHHGQIYHIYFGLNVENSYLFLFIQILDHP
FT                   IQILGIAMLVSTPLCLLLAWRLTRPILQLQQSVSQLAEGNLEAQIPNLGRRDEIGQLAD
FT                   HVSHMVDTLKNMIQKQKQLLSDISHELRSPLTRIQLAQALIRRKQGDSNELVRIESEIG
FT                   RLDKLIGDLLDLSRVQQHVEAPVVMPLAELLEPILDDAMFEANQSGKQLRLPPLPAESL
FT                   RMWPDLLARALENPLRNALKYAREFIKVDWYREGLEWVMTIRDDGPGVPVAQQAQLFLP
FT                   FFRVDDARNAKTGGTGLGLAIAAEAIARHGGTIRASSNQPAGLTITIRLPIG"
FT   gene            complement(205724..206419)
FT                   /gene="cpxR"
FT                   /locus_tag="AHA_0190"
FT   CDS_pept        complement(205724..206419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="AHA_0190"
FT                   /product="transcriptional regulatory protein CpxR"
FT                   /note="identified by similarity to SP:P16244; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35982"
FT                   /db_xref="GOA:A0KEQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ8"
FT                   /protein_id="ABK35982.1"
FT                   /translation="MHKILLVDDDLELTQLLTEILTLEGFQVTVAEDGEEGLQLLAEQH
FT                   FNLVLLDVMMPKLNGFAMLARLRKTHDTPVLMLTARGDSQDRVNGLEAGADDYLAKPFD
FT                   DRELLARVRAILRRTQSTQPQRGGSSEEVRFMDLVLQPGLQQASCHGELLELTATEFGL
FT                   LECLLRNPGQIVSKSQLSELVLGKKLEPFDRAIDMHLSNLRKKLPERTDGQPRFKTVRG
FT                   RGYLWLEQA"
FT   gene            206506..207417
FT                   /gene="fieF"
FT                   /locus_tag="AHA_0191"
FT   CDS_pept        206506..207417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fieF"
FT                   /locus_tag="AHA_0191"
FT                   /product="cation-efflux pump FieF"
FT                   /note="identified by similarity to SP:P69380; match to
FT                   protein family HMM PF01545; match to protein family HMM
FT                   TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36555"
FT                   /db_xref="GOA:A0KEQ9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ9"
FT                   /protein_id="ABK36555.1"
FT                   /translation="MSHQQYFRWVTLASMAAVTTATLLITGKLIAWLMTDSSSLLASLT
FT                   DSFMDVSASIINLLAIRYALSPADDEHRFGHGKAESLAGLIQAAFISGSALLLVMHGIS
FT                   SLLKQAPLERLEAGLWVSGGSIVLTLLLVSFQSLVIRKTNSVAIKADMLHYRSDLLLNG
FT                   GVLLALVLAGQGWYWADGLFAILIGLFLLWGALHIGYESVQALLDRQLPAEEQARIMAL
FT                   CCDVEGVHGVHDLRTRQSGPTRFVQLHLELDDQLPLVKAHQIADEAELAVRQAFERMDV
FT                   IIHMDPISVVHKEQQGTPSEQQ"
FT   gene            207426..208205
FT                   /gene="cysE"
FT                   /locus_tag="AHA_0192"
FT   CDS_pept        207426..208205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="AHA_0192"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF06426;
FT                   match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39160"
FT                   /db_xref="GOA:A0KER0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER0"
FT                   /protein_id="ABK39160.1"
FT                   /translation="MDDLVARTWQKIQQEAASMATEEPMLASFFHSTILNHKNLRSALS
FT                   FQLANKLDSATMPAIALREVIELALRSEPELLAVVAADICAVQERDPAVDLFSTPLLYL
FT                   KGFHALQGYRVANWLWRQGRRSLALYLQNQISVVFGVDVHPAARIGKGIMFDHATGIVV
FT                   GETAVIEDDVSILQSVTLGGTGKESGDRHPKIREGVMIGAGAKVLGNIEVGMGAKIGAG
FT                   SVVINPVPPHTTVAGVPAKIVGRPECDKPSLDMDQCL"
FT   gene            208227..209507
FT                   /locus_tag="AHA_0193"
FT   CDS_pept        208227..209507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39745"
FT                   /db_xref="GOA:A0KER1"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER1"
FT                   /protein_id="ABK39745.1"
FT                   /translation="MAKRWSGYLILGMWLLNLLHLYLGFSPWPAAIAAWGASLLTWPWL
FT                   VGAARRQALALYGAALALLIFSCWRGASLTAGDWLLPNINMLTMFAAVSTLNLATSGLL
FT                   TGTTSWQGRKGLWSTMASLNLLGAVINLSVLFIIGDRLERNGTLERRQVLVLSRIFCAA
FT                   AFWSPFFVAMAVALTYAPGLQLSRILPFGVVATLLAMGLTAWQVERLGVAEFAGYPLRL
FT                   QTLGLPVALALLVLLIKQIWPDLGILAVIALVAPLLAFAFMPSAGRGPALKRQVVERFP
FT                   AIGGQLVLFLGAGLLAAGINSALSVFELGGGHGLSFFHHFGWLESSLTLLLILLVAIVG
FT                   VHPLISISGLAPLLWPLSPDPSLLGMCFLLGWGLATGTSPLSGSNLALASRYNLSAGAI
FT                   LRGNLLYGLLMYGVACLLLGAYIALHA"
FT   gene            209553..209951
FT                   /locus_tag="AHA_0194"
FT   CDS_pept        209553..209951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0194"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF06005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38336"
FT                   /db_xref="GOA:A0KER2"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KER2"
FT                   /protein_id="ABK38336.1"
FT                   /translation="MCGAGRGPGAGCEKNRRIFRQYIHGRRILQRTGLFVPIGSGYAGF
FT                   TRLNRPLWGIAIEHTGMHMSLEVLEQLESKVQSAVDNISLLKMELDELKEQNNKLQDEN
FT                   HQLRNEHVAWQERLRALLGKMDQMGESI"
FT   gene            complement(210025..210675)
FT                   /locus_tag="AHA_0195"
FT   CDS_pept        complement(210025..210675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0195"
FT                   /product="sigma cross-reacting protein 27A"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38923"
FT                   /db_xref="GOA:A0KER3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER3"
FT                   /protein_id="ABK38923.1"
FT                   /translation="MKKVAVILSGCGVFDGAEIHEAVISLLALARQGAAVQCFAPNVPQ
FT                   LHVINHLTGEVSEGERRNVLVEAARLCRGQIRDVAELDAADYDALLVPGGFGAAKNLCD
FT                   FAIKGAECQIQPDVLKACQSFARAGKPAAYICIAPAMIPLIYGAGTLATIGHDEGTANA
FT                   IEAMGGSHLNCSVNEFVVDQERKVISTPAYMLANNIVEAADGIEKTVKQLLVL"
FT   gene            211076..213829
FT                   /gene="polA"
FT                   /locus_tag="AHA_0196"
FT   CDS_pept        211076..213829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="AHA_0196"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF01612; match to protein family HMM PF02739;
FT                   match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36807"
FT                   /db_xref="GOA:A0KER4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER4"
FT                   /protein_id="ABK36807.1"
FT                   /translation="MAPSNPLILVDGSSYLYRAFFASQQADLRTSTGLPSGAVRVMANM
FT                   MRSLRKQYPDCHVAVVFDAKGKTFRDDIYPEYKANRASMPDDLRSQVAPIHQMIKAMGF
FT                   PFLMVEGVEADDVIGTLARQATEKQLPVLISTGDKDMAQLVSDHVTLIDTMKDVKTDRE
FT                   GVIEKFGVPPELIIDYLALMGDKVDNIPGMTGVGEKTALALLQGIGSIDEIAANLDKVA
FT                   ALGFRGSKAFADKFREQEEQVRLSYVLATIKTDVALEQSLEELQLGPIDKEALLAVYRE
FT                   YELRNLIKELESGGAEESGAEGDDEGAAPVAAIETDYRCILDEAEFDEWLARLQAAPLF
FT                   AFDTETTSLDYMEARVVGVSFAIEPGKAAYVPFGHDYLGAPVQLTEAVVLGKLKPLLED
FT                   PARLKVGQNLKYDRNVLLNHGIELQGIAYDTMLESYVLNSTASRHDMDSLARRYLNAET
FT                   ISFEEIAGKGVKQLTFNQIELEQAAPYAAEDADITLRLHQALWGKLSAEPGLAKVFSEI
FT                   ELPLLPVLARMERLGTTIEPKLLHQQSQEIEVRLAELEKQAHELAGQEFNLSSPKQLGE
FT                   ILFTKLGLPIIKKTPKGAPSTAEEVLAELAETYELPQLLMEHRGLAKLKSTYTDKLPLM
FT                   IKPQTGRVHTSYHQAVAATGRLSSTDPNLQNIPVRNEQGRRIRQAFIPCAGYKLVAADY
FT                   SQIELRIMAHLSGDKGLLTAFAEGKDIHKATAAEVFGVALEAVTSDMRRSAKAINFGLI
FT                   YGMSAFGLAKQLGIGRAEAQKYMDLYFERYPGVLEYMERTRQQADAQGYVETLFGRRLY
FT                   LPDIKSRNAGLRKAAERAAINAPMQGTAADIIKRAMINVDGWIRGIEDQSIRMLMQVHD
FT                   ELVFEIREEKLEEYIAIIKEKMSAAAELDVPLVVEAGTGDNWDQAH"
FT   gene            complement(213909..214448)
FT                   /locus_tag="AHA_0197"
FT   CDS_pept        complement(213909..214448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0197"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36216"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER5"
FT                   /protein_id="ABK36216.1"
FT                   /translation="MDLRLRPYKGKRPQLGKRVYVDPCATLVGDIQLGDDASIWPMVAA
FT                   RGDVNHICIGARSNIQDGTVLHLTRKSASNPGGYPLLIGEDVTVGHKAMLHGCTIGNRV
FT                   LVGMGAILLDGVIVEDDVMIGAGSLVPPGKRLEAGFLYMGNPVQQARTLKPAEIAFLKT
FT                   SADNYVLLKDEYLQEA"
FT   gene            214913..216449
FT                   /gene="rrsC"
FT                   /locus_tag="AHA_0198"
FT   rRNA            214913..216449
FT                   /gene="rrsC"
FT                   /locus_tag="AHA_0198"
FT                   /product="16S ribosomal RNA"
FT   gene            216523..216599
FT                   /locus_tag="AHA_0199"
FT   tRNA            216523..216599
FT                   /locus_tag="AHA_0199"
FT                   /product="tRNA-Ile"
FT   gene            216610..216685
FT                   /locus_tag="AHA_0200"
FT   tRNA            216610..216685
FT                   /locus_tag="AHA_0200"
FT                   /product="tRNA-Ala"
FT   gene            216918..219813
FT                   /gene="rrlC"
FT                   /locus_tag="AHA_0201"
FT   rRNA            216918..219813
FT                   /gene="rrlC"
FT                   /locus_tag="AHA_0201"
FT                   /product="23S ribosomal RNA"
FT   gene            220152..220227
FT                   /locus_tag="AHA_0202"
FT   tRNA            220152..220227
FT                   /locus_tag="AHA_0202"
FT                   /product="tRNA-Thr"
FT   gene            220249..220366
FT                   /gene="rrfC"
FT                   /locus_tag="AHA_0203"
FT   rRNA            220249..220366
FT                   /gene="rrfC"
FT                   /locus_tag="AHA_0203"
FT                   /product="5S ribosomal RNA"
FT   gene            220520..221485
FT                   /locus_tag="AHA_0204"
FT   CDS_pept        220520..221485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0204"
FT                   /product="HTH-type transcriptional regulator EbgR"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35993"
FT                   /db_xref="GOA:A0KER6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER6"
FT                   /protein_id="ABK35993.1"
FT                   /translation="MATLKEIALEAGVSQATVSRVLNEDPTLSVKEETKQKIFEIAERL
FT                   EYKTSGARKGVHKSKLHFLAVYAYPQSTEVNDPYYLAIRYGIETQCARLNIELTHFYNG
FT                   AEGRDLSAVDGILVIGHLPAERLAALHSLSAQLVFVDCRSQGDFDSIDVDLALISQQVV
FT                   DFFIAQGHQRIGYIGGQDDGPDLRELAFLDYGQRLGVVQESDLYRGDFSSASGYKLAKE
FT                   MLAGDWPRALFVASDSIAIGVLRAIHEKGIAIPQQIELISVNDIPTAKFTFPPLSTVRI
FT                   HSELMGSQGVNLLVERLRDERDVPLRVLVPSKLTLRGTTR"
FT   gene            221807..224881
FT                   /locus_tag="AHA_0205"
FT   CDS_pept        221807..224881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0205"
FT                   /product="evolved beta-galactosidase alpha-subunit"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF02836; match to protein
FT                   family HMM PF02837; match to protein family HMM PF02929"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37231"
FT                   /db_xref="GOA:A0KER7"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER7"
FT                   /protein_id="ABK37231.1"
FT                   /translation="MNNWENVQFVGENRLAPRAYFFSYADHALAATMQRELSRRFLSLS
FT                   GQWQFHYFDHPLQVPEAFYHSPMSEWDQITVPNMWQMEGHGQLQYTDEGFPFPIDVPFV
FT                   PTNNPTGAYQRSFTLSQAWDGEQVIIKFDGVETYFEVYVNGHYIGFSKGSRLTAEFDIS
FT                   AYAKVGENLLSVRVMQWADSTYIEDQDMWWMAGIFRDVYLVGKPAAHVQDFFIRTALAD
FT                   DNQSATLSCDIQLENLGAAARDHRLVWSLLDQGSEIASGSLDHLAIDGKCDCRFTLDLA
FT                   NPHLWSAEDPYLYQLQLSLYNGQGELLEVIPQRVGVREIKVKDGLFYVNGHYLKLHGVN
FT                   RHDNDHLKSRAVGMDRVERDIVLMKQHNLNSVRTAHYPNDPRFYELCDQYGLFVMAETD
FT                   VETHGFANVGDLSRITDDPFWEPVFVDRIERHVHAQKNHPSIIIWSLGNESGYGCNIRA
FT                   MYRRCKQMDPTRLVHYEEDRDAEVVDLVSTMYSRVSQMNCFGEFPMPKPRILCEYAHAM
FT                   GNGPGGLSEYQQVFDRHPHIQGHYIWEWCDHGILDQDEQGRPVYKYGGDYGDYPNNYNF
FT                   CMDGLIYPDQTPGPGLREYKQVICPVKVRALDLASGKLEVENRYWFSNLDDIRLLVEVK
FT                   AEGELLASQQIRLEGVAPGATTELQLELPSLDGRETFVQLRVIKATATRYSAAEHELGQ
FT                   YQFQLKESTRQLQPFANPNATALQIADERLALTLSGSGFALRFSRLDGKLVSWQQDGNE
FT                   LIERAPRLTFFKPMIDNHKQEYESLWHPNHLQIMQEHFRTLSWRQLGEVVEVTVESLIA
FT                   PPVFDFGMRCRYVYTLSPNGQLHVALSGQPYGGYDDIIPKIGFELGIRQDLDRVHYYGM
FT                   GPGENYQDSRQSNWIDSFQSTVGEMWEHYPFPQDNGNRQQVRWATLTNRHGAGLYVRPD
FT                   APINLSVWPYSWEHIHAAQHINELEPSGYLTLNLDHKVLGLGSNSWGSEVLDSWRVRFE
FT                   PFSFGLTLLPIARGNLNPAALAGLDLTINGGRNLA"
FT   gene            224494..225333
FT                   /locus_tag="AHA_0206"
FT   CDS_pept        224494..225333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0206"
FT                   /product="evolved beta-D-galactosidase, beta subunit;
FT                   cryptic gene"
FT                   /note="identified by match to protein family HMM PF04074"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36897"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER8"
FT                   /protein_id="ABK36897.1"
FT                   /translation="MGALPLPAGQRQPPAGALGDPDQSPRRRSLRAARCPHQPERLALQ
FT                   LGAHPRGAAHQRAGAEWLSHPQSGSQGTGAGLQLLGFRGAGLLAGALRAVQLRPDPAAH
FT                   RPWQPQSGCAGRARSHHQRREEPRMITLDNLTLFKNIYREGKKWGRCVEAINNLANLKP
FT                   GICHSIGDSLTYRLQEGASPATSLFEGQRRYFDVHYYLEGEETVEWAAKSDLRVEQGYD
FT                   DTTDREWLVGEVRERQQVGNGQVVIFENDEAYRFVGDAPVRKLIIKVTVEGGYFKNK"
FT   gene            225436..226881
FT                   /locus_tag="AHA_0207"
FT   CDS_pept        225436..226881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0207"
FT                   /product="inner membrane transporter YgjI"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38615"
FT                   /db_xref="GOA:A0KER9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER9"
FT                   /protein_id="ABK38615.1"
FT                   /translation="MSDSKRNTIGKFGLLSLTFAAVFSFNNVINNNIEIGLASAPMFFL
FT                   ATIFYFIPFCLIIAEFVSLNKNSEAGVYAWVKSSLGGRWAFISAYTYWFVNLFFFTSLL
FT                   PRVIAYASYAFLGYEYILTPVATTALSMVLFAFATYVSTNGAKMLGPITSVTSSLMLLL
FT                   TLSYILLAGAALVGGVQPADPITVEAMVPDFSWAFLGITTWIFMAAGGAESVAVYVNDV
FT                   KGGSKSFVKVIIVAGIFIGVLYSIASLLINVFVHSDTLKYTGGSVQVFEGLAAYFGLPE
FT                   ILMNRFVGLVSFTAMFGSLLMWTATPVKIFFSEIPAGIFGKKTVELNENGVPARAAWIQ
FT                   YLIVLPLMVIPTLGSNTAQDLMNTVINMTAAASMLPPLFIMLAYLNLRLKLDHLPREFK
FT                   MGSRTTGIAVVSVLIAIFSVGFLASTFPTGADIMTIVFYNVGGILIFLGFAWWKYNRYE
FT                   ASLSAEARAKEAQPAAQVAMQTP"
FT   gene            226910..227296
FT                   /locus_tag="AHA_0208"
FT   CDS_pept        226910..227296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0208"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF01588"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37873"
FT                   /db_xref="GOA:A0KES0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES0"
FT                   /protein_id="ABK37873.1"
FT                   /translation="MVVGHPQTVEPEKEKSMSETIEFAEFKRVEMKVGKVLEVVRHPGA
FT                   DKLYIVQIDVGGEQPLQTVTSLVPYYSEEELMGSEVVVLTNLKPTRMRGERSECMLLCA
FT                   ETPDESQSVLLQPRVPMAPGTPIV"
FT   gene            227463..228899
FT                   /locus_tag="AHA_0209"
FT   CDS_pept        227463..228899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0209"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39498"
FT                   /db_xref="GOA:A0KES1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES1"
FT                   /protein_id="ABK39498.1"
FT                   /translation="MSESVRGTIGKFALLSMTFAAVFNVRNIVNNNIELGLSSAPIFLL
FT                   ATLVYFIPFVFIIAEFVSANKNSESGMYDWLKKPLGTRMAYLGSFLYWFVNLFWFVSLL
FT                   PNVIAYASYAMLGYEYSFSPMVTSVISIVLFAAATHISTKGASWLGKIAEIVAYGVFAL
FT                   FAIYVLGALMALSGDHVPAQPITLEAMTPTVNWATLGIMCWIFQAAGGAETAAAYLNDV
FT                   KGGQKSFIKVIISAGIVIGAMYAVGSLLVNVFVPRESLTYAGGMVEIFTGMAQYFQLSE
FT                   ALVGRFVGVVLFIAMFGSMMMWTSAPVKIHFSEIPQGVYGEKTTQLNEHGVPVRAAWWQ
FT                   FAFVFVMLVVNGFGSESVQQMMNTAINLTAGTAMLPPIFIMVAYFVFRWKHDDTPREFR
FT                   MGSRTFGMGVVSVLIAIFVVSMSASAFPSGVDLVRAFFINVFMTAVFSALAYWWISRFE
FT                   KRQARKQATGTAGGKLAKQS"
FT   gene            229111..230082
FT                   /locus_tag="AHA_0210"
FT   CDS_pept        229111..230082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0210"
FT                   /product="sodium/bile acid symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39371"
FT                   /db_xref="GOA:A0KES2"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES2"
FT                   /protein_id="ABK39371.1"
FT                   /translation="MRLDPFTSVLIVVVALASFFPCEGQVAVWFGLLTKLAVALLFFMH
FT                   GAKLSRQNLLAGLGHWRLHLVVMASTFVLFPLLGLLLTPLVPHWLSPAIYLGFLYLCAL
FT                   PATVQSAIAFTSMAGGNVSAAVCSASASSILGIFLSPVLVGLMINVQGEGVDTWHSIQA
FT                   IMVQLMLPFVVGHLSRPLIGRWVDSHRPLIGKLDQSSILLVVYVAFSEAVVQGIWHQVG
FT                   WYDLASIVLLSCVLLALVLGWNVWISRRLGFNRADEITIVFCGSKKSLANGVPMANVMF
FT                   PAASVGVMVLPLMIFHQIQLMVCAVLARRYHEQEAVPQVQQG"
FT   gene            complement(230140..232290)
FT                   /locus_tag="AHA_0211"
FT   CDS_pept        complement(230140..232290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0211"
FT                   /product="generic methyltransferase"
FT                   /note="identified by match to protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37534"
FT                   /db_xref="GOA:A0KES3"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES3"
FT                   /protein_id="ABK37534.1"
FT                   /translation="MTQATLLYSTATGLPEPTRTPLLTGSDPDHKRRELLAYFCQTFDL
FT                   YDSLFDCLADERAWFDKAIPLRHPLIFYYGHTAAFFINKLLAARLIEGRLDARIEAMVA
FT                   IGVDEMSWDDLDETHYDWPTVAELRDYRGRVRALVCDVIERMPLTLPIDWQSPAWVILM
FT                   GIEHERIHLETSSVLIRQLPLAWVRSQPRWPVCPEARRCRDEVPANSLLPVAGGRVRLG
FT                   KQDATYGWDNEYGERHIELAPFQASRMLVSNAEFFDFVQAGGYQTRAWWDDEGWGWRQY
FT                   ARARMPTFWVGDPLEPEQLQLRLMTEQVTMPWDWPVEVNQLEAAAFCRWQAAQTGLPVQ
FT                   LPSEAEWMLLREQLAGDQPDWIEAPGNINLARFASSCPVDACPQGSFFDLVGNVWQWTS
FT                   TAIDGFEGFKVHPLYDDFSTPTFDGKHTLIKGGSWISTGNEALKSSRYAFRRHFFQHAG
FT                   FRYLVSRYQEPVVVNPYETDTLVAQYLDFQYGPTHFGVANYAQTLAGLASELCSRHERA
FT                   LDIGCATGRASFELARRFAHVDGVDYSARFIDVALALASQDSFRYAVPVEGELVEYCEA
FT                   RLSRHELGREQSERVHFSQGDACNLKPRYGDYDLVLASNLIDRLREPARFLRDIAPRLR
FT                   SGGLLVLTSPYTWLTDYTPKANWLGGVRENGEALGTYQALQRLLAAEFEEQMPPRDVPF
FT                   VIRETARKHQHTVAQLTVWRKR"
FT   gene            232655..233377
FT                   /locus_tag="AHA_0212"
FT   CDS_pept        232655..233377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36335"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES4"
FT                   /protein_id="ABK36335.1"
FT                   /translation="MKWMMGVVLAVGLSGCSWLDDTRVSGAGAVIEQQHGVGRQVTRVL
FT                   AGVPASVHLVAGEPRGLRIRGQENLLPYLVLSERGDKLEIEVKDGYRLDPTEPLEITIT
FT                   LPALHELALAGVANGELRGFKGEALVLSVAGVGDIVADGLELDRLEGNIAGAGSLDLGN
FT                   STARAVELNIAGSGDVLGAELKGREVEVNIAGSGDVEVRAQERLKVGIAGSGSVSYWGD
FT                   PVLQSEIAGSGEVSRQGS"
FT   gene            complement(233431..234267)
FT                   /locus_tag="AHA_0213"
FT   CDS_pept        complement(233431..234267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0213"
FT                   /product="esterase YeiG"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00756;
FT                   match to protein family HMM TIGR02821"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38973"
FT                   /db_xref="GOA:A0KES5"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES5"
FT                   /protein_id="ABK38973.1"
FT                   /translation="MNLDIISSNKSFGGWHKRYSHASEVLGCEMRFAIYLPPQALTGQK
FT                   VPVLYWLSGLTCTDENFMQKAGAQRIAAELGIALVAPDTSPRGEDVADDPGYDLGMGAG
FT                   FYVNATQHPWRDHYQMYDYVTRELPELIETHFPVSTKRAISGHSMGGHGALIAALREPG
FT                   RYRSVSAFSPISHPSRCPWGQKALGAYLGNNPLLWQEWDACQLLRHHPVTPLPTLVDVG
FT                   LDDPFLAEQLHIDALADAAAGKEWPLELNRHAGYDHSYYFVASFIEAHLRFHARHL"
FT   gene            complement(234317..235444)
FT                   /locus_tag="AHA_0214"
FT   CDS_pept        complement(234317..235444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0214"
FT                   /product="alcohol dehydrogenase class III"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR02818"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39411"
FT                   /db_xref="GOA:A0KES6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES6"
FT                   /protein_id="ABK39411.1"
FT                   /translation="MAQVQSIKCKAAIAWGPGQPLSIEEVEVMPPQAGEVRVRIVATGV
FT                   CHTDAFTLSGEDPEGVFPCILGHEGGGIVESVGEGVTSVKVGDHVIPLYTPECGECKFC
FT                   KSGKTNLCQKIRATQGKGLMPDGTTRFSKDGQPIYHYMGTSTFSEYTVLPEISIAKVDP
FT                   AAPLEEVCLLGCGVTTGIGAVMNTAKVKEGESVAIFGLGGIGLSAVIGARLAKAGRIIA
FT                   IDINESKFELARKLGATDCINPNDYDKPIQEVIVELTDGGVDFSFECIGNVKVMRAALE
FT                   CCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVRGRSELPSYVQRYMQGE
FT                   FKLDDFITHTMGLEQINEAFDLMHEGKSIRSVIHY"
FT   gene            235564..236469
FT                   /locus_tag="AHA_0215"
FT   CDS_pept        235564..236469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0215"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38080"
FT                   /db_xref="GOA:A0KES7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES7"
FT                   /protein_id="ABK38080.1"
FT                   /translation="MFGWEGICEFVSVAEQGGFTPAARKLGVSVAQVSRQVAQLEDRLQ
FT                   AKLLLRTTRQVRLTELGEIYYRHCRQLLDNLYEAELAVGRHQAVPQGTLRITAPVSYGE
FT                   SRIAPLVNDFMVRFPQLEVTLNLTNQLLDLVHEGYDLALRLGHLKDSSLVARKLAQRVP
FT                   YVCASPAYTARHGMPNSLSELTRHTCLVGNSDEWHFTLDGRPHSVRVHGLLHCNSGHAL
FT                   LDAALKGIGIIQLPDYYVSDHLAQGELIELLPELRAPAEGIWALYPHNRHLSPKVRLLV
FT                   DYLAERLSDPHQPALVRPVG"
FT   gene            complement(236526..237491)
FT                   /locus_tag="AHA_0216"
FT   CDS_pept        complement(236526..237491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0216"
FT                   /product="putative transport system permease abc
FT                   transporter protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38576"
FT                   /db_xref="GOA:A0KES8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES8"
FT                   /protein_id="ABK38576.1"
FT                   /translation="MFEILILMLDATIRTAPPLILAAMAGMFCERSGVVNIALEGKLLA
FT                   AAFASAAAAAVSGSAWIGLGAGVGVSILFALMHGFATITHRGDQVVSGMAINILAAGLT
FT                   VTLGRYWFDQGGQTPALSGAARFAPIDLPYAKELYDVPVISQLYSELLSGHSLLEYVAF
FT                   AAVPLAWWVLFRTRFGLRLRAVGEAPAAVDTAGISVVRMRYTALIIGGLLAGIGGTYLA
FT                   VAQTAQFIPNMSAGKGFMALAALVFGKWRPWNAMAACLLFGFLDAVAIRLQGVSIGGFP
FT                   IPVQAIEALPYILTVFLLAGFIGKAVAPKALGTPYVKERE"
FT   gene            complement(237494..238609)
FT                   /locus_tag="AHA_0217"
FT   CDS_pept        complement(237494..238609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0217"
FT                   /product="putative transport system permease abc
FT                   transporter protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37285"
FT                   /db_xref="GOA:A0KES9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES9"
FT                   /protein_id="ABK37285.1"
FT                   /translation="MSQARIPAWISVGVLPAVNILLAFLVSAILFYYLDINPVDAAEIM
FT                   WYGAFGTGEGVGFTLYYATGFIFTGLSVAVAFHAGLFNIGGEGQAYIGGLGVGLVCLLL
FT                   GDSLPFALLLPLAIIAGGLFGAAWAFIPAWLQAKRGSHIVITTIMFNFIAASLMAYLLV
FT                   EVFKPAGSMATESKVFAEASWLPKMSELAGAFGMEMSNSPLNISFFWALLCAALVWVFI
FT                   WHTRWGYEIRSVGASQSASAYAGISYPKVVILAMVISGMLSGFFALNVLQGELHQIKLN
FT                   FVEGFGFTGIAVALMGRNHPVGVIIASLLFGFLYQGGAELSFEFGVDRNIVVVLQGLVI
FT                   LFCGALEHMMRPRIEQLYLAFANRSAQVKGA"
FT   gene            complement(238692..240272)
FT                   /locus_tag="AHA_0218"
FT   CDS_pept        complement(238692..240272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0218"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (sugar/ribonucleotide)"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37005"
FT                   /db_xref="GOA:A0KET0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET0"
FT                   /protein_id="ABK37005.1"
FT                   /translation="MDQTDRYAIELRGIDKRFGEVYANKQIDLKVRKGSIHGIVGENGA
FT                   GKSTLMSIIYGFYHADKGEMFIDGNPFKPHGSQDAIAAGVGMVHQHFMLVNNFTVLENV
FT                   ILGAENGWHLGKSLAAAEKLLGELARDYGLEVPLHEKVEDLPVGLQQRVEILKALYRGA
FT                   RILILDEPTGVLTPQEADHLFEVLKKLRDQGATIILITHKLREILAITDQVSIMRRGEM
FT                   VAHVATKDTDKEQLAELMVGRKVRLKVDKGPTQPGDAKLKVDGLSYVDDARVERVKSIS
FT                   FEVRAGEVVGIAGVSGNGQSELLSLLGGILKPSKGSFTITGGGQAHEVSVSHPADPERV
FT                   RNFGLGHVPEDRHKMGLINRFEAKEAFILGYHRRPQYNKGWLQNKEAILQDCQAKMDKW
FT                   DVRPPHPEHKTANFSGGNQQKLVIAREVEQDPDVLLIGQPTRGVDIGAIEYIHQQIIAM
FT                   RDKGKAVLLVSVELDEIMSLSDRILVIADGRIVGELDAAKADERTIGLMMANIVPDEVA
FT                   ASQSQGATS"
FT   gene            complement(240356..241459)
FT                   /locus_tag="AHA_0219"
FT   CDS_pept        complement(240356..241459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0219"
FT                   /product="membrane lipoprotein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37319"
FT                   /db_xref="GOA:A0KET1"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET1"
FT                   /protein_id="ABK37319.1"
FT                   /translation="MISLTHTVAHLQLASVLYGLPRQVVDPHITIKDTIVTKVLKLATV
FT                   AALTLAALSAQAASQPAVIYDTAGKFDKSFNEAVFRNGVEVYNKDKGVKVKEFEPQNEA
FT                   QREQGLRRLASRGNGPIVAVGFNMGSAVEKVATEFPKTQFTIIDMVVDKPNVQSVIFKE
FT                   HEGSFLVGALAAIASKTGKVGFVGGMDIPLIRKFECGYEQGAKYVNPKIEVFQNMTGST
FT                   PAAFADPAKGAELAKSQFAKGADVVYAAAGGTGIGVYQAAKDEGKLAIGVDSNQNHLQP
FT                   GTMLTSMVKSVGLAAYQTWDDAAKGTWKPGIKNLGLAEGGVDWALDKDNEKLITPEMKA
FT                   KVDAIKAEIISGKVKVHDYMSDSTCKY"
FT   gene            241787..243958
FT                   /gene="uvrD"
FT                   /locus_tag="AHA_0220"
FT   CDS_pept        241787..243958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="AHA_0220"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01075"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37514"
FT                   /db_xref="GOA:A0KET2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET2"
FT                   /protein_id="ABK37514.1"
FT                   /translation="MDVSTLLDGLNDKQRDAVAAPRCNLLVLAGAGSGKTRVLVHRIAW
FT                   LMQVERCSPFSIIAVTFTNKAAAEMRGRVEKVIGDGVRGMWIGTFHGIAHRLLRAHHLD
FT                   AGLPQDFQILDSDDQYRLIRRVLKALNLDEKHWAPRAVMGYINGKKDEGLRPGDIDLYG
FT                   DPVTRTYQQIYKTYQETCDRSGLVDFAELLLRAHELWLNKPHILEHYRDRFQNILVDEF
FT                   QDTNGIQYAWLRMLAGDTGKVMIVGDDDQSIYGWRGAKIENIQRFLTDYQGAETIRLEQ
FT                   NYRSTANILKAANCVIANNAERLGKELWTEGAEGEPISLYAAFNEVDEARFVVGRLKDW
FT                   KEKGGLLADCAILYRSNAQSRVLEEALMQDAMPYRIYGGLRFFERQEIKDAMAYLRLIN
FT                   NRGDDASFERVVNTPTRGIGDRTLEILRNNARDQGQNLWQSAKALLGDKVLTGRAGNAV
FT                   RGFVDLIDALEEQVSLLPLHQQADIAIQHSGLKAMYLAEKGEKSQARVENLDELVTACR
FT                   QYQRPDELEDMSDLSAFLAHAALESGENQADEYADAVQLMTLHSAKGLEFPLVLLVGVE
FT                   EGMFPSQQSTEESGRLEEERRLCYVGMTRAMEKLYICYAESRRIYGREMFHKPSRFIRE
FT                   MPAECLEEIRLRTQVSRPTQYGRFSQNEVQQSFDASGIKLGQRVLHPKFGEGIVLNFEG
FT                   VGQQSRVQIQFDDVGAKWLVTAYARLETL"
FT   gene            complement(244058..245614)
FT                   /locus_tag="AHA_0221"
FT   CDS_pept        complement(244058..245614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39123"
FT                   /db_xref="GOA:A0KET3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET3"
FT                   /protein_id="ABK39123.1"
FT                   /translation="MKFAAIQDCWRSLQRPLHAANGITKIEQHLSKSAITYNPDGVFAV
FT                   VGLNGAGKSCFFNYLTDQSYSKISFKKHTITLNDGNVLHFPGDKINATVIDISKELRNS
FT                   TKALLDVKSTWGQQDATSFKEDEISLFNYVLSTCYSDVLFEEVLVSEDESVPLFSVVKN
FT                   GVELNFEALSLGENLVFYIFWCLTRKYSSPGIFFVDEPESGLSPIAQERLVDLLVYISS
FT                   KKSKQIFISTHSPFIVSKLGEERVILMTKNVSAEWSHTTSDNCLEELGMKPGIKGIIFF
FT                   EDNKAKVFAEQLFSLYGSKLIKTHKLIFLKGESDVYEVVSRIPKSSDSFNVFGLLDADQ
FT                   RNDKRYVKGLNSQFFFLPGIYAPEQELINAIKENIDEYSKSLLFNKSELERKIKSCEGL
FT                   DHHDFFEELSKKLYGNVNTKVYQDAFRVWLFNYGDLKQIHGLMSAIDPNLTKENFDYVD
FT                   ELFNSDHGKQPDGHEEFYDAINLIQPQPQPQPQPQPQPQLIREKELHIKLFDKIMRFLS
FT                   S"
FT   gene            complement(245611..246813)
FT                   /locus_tag="AHA_0222"
FT   CDS_pept        complement(245611..246813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0222"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39564"
FT                   /db_xref="GOA:A0KET4"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET4"
FT                   /protein_id="ABK39564.1"
FT                   /translation="MNVSIGDKLLFPIVSLCYFYFILNLFKWYHMKIKQTDPDIDTIFG
FT                   RIERKYIDLQPDFQRDLVWNTSKKQSLIDTILREWQFPPVFLILVTDGLHEVLDGQQRL
FT                   NAIHEFMTNKLRVNGNIEPFDDNIARLNGLTYEQLPQDVKRRFGLYSMRVCELYDYKED
FT                   EPYELFFRLNQGSVLTPAEKRNTLYGPVREQVRELVHEMDLKGLNIDRIGFNNSRLAYQ
FT                   DVISRFLYALQHRSIEKKITDQMLIDFFRYPTGVDKETYLSAKKTIDKLSSLIHEKVKL
FT                   NKPTLFTWLLFINYEGAIEELFLHMNDLRGKSRSGDIGDPFQLFLIELYQDKSATSVND
FT                   AAPVKIRLLVLYLMGIHIGLNFNSENGLIAHSIYIKIISENNPTESLLLDYMSYSNWGA
FT                   L"
FT   gene            complement(246810..247247)
FT                   /locus_tag="AHA_0223"
FT   CDS_pept        complement(246810..247247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0223"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36157"
FT                   /db_xref="InterPro:IPR016596"
FT                   /db_xref="InterPro:IPR022548"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET5"
FT                   /protein_id="ABK36157.1"
FT                   /translation="MFRQIMMSAALLSAALLSGCASVPMAEATADAQAKQFVAPKDAAN
FT                   LYIYRNETFGAAVKMPLLVDGMAVGDTVAHTYILKQVTPGSHTITSKSENDATLTLSTE
FT                   AGKNYYVWQEVKMGLLMARSKLSQVSEEEGKQGVMESKLVK"
FT   gene            247422..247934
FT                   /locus_tag="AHA_0224"
FT   CDS_pept        247422..247934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36594"
FT                   /db_xref="GOA:A0KET6"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET6"
FT                   /protein_id="ABK36594.1"
FT                   /translation="MSKWMPTLHRLGWWLLRKATLALLTSLLFMISFTLFQYASWWPAM
FT                   AEDTSLEWSGFSQGWTFAELVPAMLEFSAVLACAFLPLFLLTPRPLLLPLFAGLWLWQT
FT                   YDIAFMTATASTWLPHEIIWTFILPHTHWLLLTLLAPLLLIRQLGRRLFVVAPATQPEM
FT                   SRLADKP"
FT   gene            complement(248027..249187)
FT                   /locus_tag="AHA_0225"
FT   CDS_pept        complement(248027..249187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0225"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37322"
FT                   /db_xref="InterPro:IPR024542"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET7"
FT                   /protein_id="ABK37322.1"
FT                   /translation="MKDQAATVLCFEHVTIARDCMDTLQALGFNVIRIAYSAEVFTKLP
FT                   FLNFDYLFSINFNPLLSQAAEALRKPYIAWVVDTPCYGMHHDAISNPFSFTFVYDLAVA
FT                   SRLKERSNGNVYYLPVAVNEQRQLSAEPGYDHDISFIANLTPPEYQTHIKPRLAPGPLQ
FT                   TLEELIGHIDLYLEGRPLTAQLTESHIRLVKEVYPLSGLAYLSEYEKLAYLLGREHSYR
FT                   ERVSCIQALAARFERVAVYGNPEWATHTETYSGYAEHYQAMPRLFQRSRINLNLVRSFV
FT                   ESGLPMRVFDILGAGGFMVTNDKEDLHHLFTPGKDLVIFRDKQDLLEICRYYLSHEEER
FT                   AAIAAHGQQTVLIHHTYRARLISLFQTVQSTLASMQHPGVKAHSNH"
FT   gene            complement(249679..249876)
FT                   /locus_tag="AHA_0226"
FT   CDS_pept        complement(249679..249876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37758"
FT                   /db_xref="InterPro:IPR017704"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET8"
FT                   /protein_id="ABK37758.1"
FT                   /translation="MKIYDRNRNALTPGQRVMIAATGAVDFLKEAHTDNLTPYQAEHEK
FT                   CVLLANSREQYAPIELIRLG"
FT   gene            250157..250657
FT                   /locus_tag="AHA_0227"
FT   CDS_pept        250157..250657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37372"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET9"
FT                   /protein_id="ABK37372.1"
FT                   /translation="MNRDIVAQFIKMLTNLDQCLAKAEAHAAAKKFNVENFFGDRLIVD
FT                   MLPFSKQVLICCDSARAVVATASLSEPPVLGDDPKTMADLRAHVAKTLTYLQSKLDADF
FT                   SQYASGHYYPYWAGGKGMDGHTCVHEYGIPNFYFHLTMTYALLRKAGVELGKGDYLGAI
FT                   NLQ"
FT   gene            complement(250746..251195)
FT                   /locus_tag="AHA_0228"
FT   CDS_pept        complement(250746..251195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38067"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU0"
FT                   /protein_id="ABK38067.1"
FT                   /translation="MRTGTVRLHRVLKAPPMRIYRAFIEADALAKWLPPYGFTCRVEQL
FT                   EAQVGGHFRMAFTHFGNGNSHAFGGEYLELEPGKRIRYTDRFDDPNLPGVMHVTVILTG
FT                   VVCGTELAIVQEGIPEVIPVEMCYLGWQESLAQLAALVEPEIPAQ"
FT   gene            complement(251276..251788)
FT                   /locus_tag="AHA_0229"
FT   CDS_pept        complement(251276..251788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0229"
FT                   /product="hemolysin"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39660"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU1"
FT                   /protein_id="ABK39660.1"
FT                   /translation="MNRHPSIKHWRELQEPEPGRYSGSEEPLSLGSALGRHYGFARLGI
FT                   HHELLPPGRHTSWPHAEETEDEFVHVLEGTPDVWLDGVLHRLQPGDSVGFKAGDGLAHT
FT                   FINNTDQPVRLLCVGDTDRADNHIHYAMHPERNRFIGERHWDAVPERELGDHDGLPDQL
FT                   RERNGPF"
FT   gene            complement(251886..252542)
FT                   /locus_tag="AHA_0230"
FT   CDS_pept        complement(251886..252542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38229"
FT                   /db_xref="InterPro:IPR021747"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU2"
FT                   /protein_id="ABK38229.1"
FT                   /translation="MKRAVIAGMVAILLGGCAVKNQVSHSLQAIPLTAFQQSESNPNQR
FT                   IYKEPGVDLRQYHQVLLDPLQFIRQENGQWYLLTANEQNEIGRYYHATFQRELMNHGVK
FT                   IASAPGPGVMRVQAAITNFDLTRPDPKLRDLLPAKIAINVTREVIGKEPYLLKVGSMAQ
FT                   LLDSQNGKLLVRVMDARESPDTTHKDSPITASEMEKMIDQWAAGRAKQLADNLGR"
FT   gene            252751..253488
FT                   /locus_tag="AHA_0231"
FT   CDS_pept        252751..253488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06206"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39813"
FT                   /db_xref="GOA:A0KEU3"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU3"
FT                   /protein_id="ABK39813.1"
FT                   /translation="MRILAPFAHIIAAMKLIRKDSMTSLMAALCGLLLSCLAWAAPTPF
FT                   VTTPPDSTITAPSASMEPLLSWFTGEFSSREQASYDNRFTSAELRLVEIWPGYKGFRWV
FT                   YAEQFLTERAVRPFRQRIYRFSLVPDGRILMAELTMPRAIDFAGAWRQPELLDSLTPQQ
FT                   LSLRQGCEIWLTRQPSGEYAGHSKVGSCSTNFGGASTLVQYLWIGPHSVRLLDRAYDTE
FT                   AHQRWGSPGEGYVYLRRVKQRGE"
FT   gene            complement(253498..254166)
FT                   /locus_tag="AHA_0232"
FT   CDS_pept        complement(253498..254166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0232"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39357"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU4"
FT                   /protein_id="ABK39357.1"
FT                   /translation="MQHYRELEQNTLANTGQAAGRIRINAPVTFGSYRLTPLLCRFMER
FT                   YPQIRIELDLSDRLVDVIGDGFDLIFRVGQPKDAGYIARPLASSDSVICASPHYLQRHG
FT                   TPLTLADLARHHCLGFSPWLGQSNLAEAFPLEQLHLWDSPFISNHGSALKVAALNHAGI
FT                   LLQPRALLREELERGTLQEILADALPAPRPVNLLYPAREPLPLRLRLLIDYLSEQRHQL
FT                   "
FT   gene            complement(254191..254382)
FT                   /locus_tag="AHA_0233"
FT   CDS_pept        complement(254191..254382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0233"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39859"
FT                   /db_xref="GOA:A0KEU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU5"
FT                   /protein_id="ABK39859.1"
FT                   /translation="MDRLTAIEIFVEVARAGSFAAVAERFAMTPAMIGKYIKWLEARVG
FT                   SRLLNRNTRRQSLTEAGQ"
FT   gene            254484..255104
FT                   /locus_tag="AHA_0234"
FT   CDS_pept        254484..255104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0234"
FT                   /product="lysine exporter protein, putative"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38904"
FT                   /db_xref="GOA:A0KEU6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU6"
FT                   /protein_id="ABK38904.1"
FT                   /translation="MTLDYYTLYLLLAIGTVLSPGPAVIYTIGNTLTRGTRHAIAGFCG
FT                   VAVGILLVASLASLAVLWFTRWLAAGQQILTLGGALYLLYLGLNSWRQRAVSPVPGAGP
FT                   DRDCRRSFIKGALISLLNPKAIIFFTSLFPQFIDFRHGALGQCMLLAVTFSAVVLVVHG
FT                   GYCLVFHWVGAQGYGERFARGINRLSAVMFTGFALLLLFKGLR"
FT   gene            255180..256424
FT                   /locus_tag="AHA_0235"
FT   CDS_pept        255180..256424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0235"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35952"
FT                   /db_xref="InterPro:IPR022605"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU7"
FT                   /protein_id="ABK35952.1"
FT                   /translation="MLPGSGSGARIIRTPTDMVEAMPMAWPFNKVGNMSYYEHEVVGHP
FT                   DVELGLCGERQVRYRIHGAEQAGSGLVVYIPGFGGDLGAYSQVFCEKVAAQHGMAALCV
FT                   DYFCMRSRPAVGAAISLLPEERERALALLGLPAKTPDTALLRALDGVQPAAPLRFQGVL
FT                   VPPDGAYQNFGVMAALDILNAIEDAMLRYGGNRDNLILVGSSYGGYLAQLVNKFRPGYA
FT                   RALFDNSSWAEPNLAYVVGQDIGAVEYQCSLQGGVELALCVDSPWRMVVGHPHEFDVDA
FT                   FIIRAFSASQLDQMAAQGGTQTFCLMVHAIHDAIAPADAKLAMARAMLARGFNAELILF
FT                   DESSVDGEFIRNMEHGMGLSMLQFFAQGLALLAERSPAFTATRAAEVTLHAGHSVYQLN
FT                   FANPEVRLQRQRIEA"
FT   gene            complement(256511..257545)
FT                   /locus_tag="AHA_0236"
FT   CDS_pept        complement(256511..257545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0236"
FT                   /product="YeeE/YedE family protein"
FT                   /note="identified by match to protein family HMM PF04143"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37575"
FT                   /db_xref="GOA:A0KEU8"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU8"
FT                   /protein_id="ABK37575.1"
FT                   /translation="MKWALMALIGFGFGFTLSFSRFGIVFGWREMLTKRNSYYVRVHLL
FT                   TIAIEILLFTCFLSFSHALFGDAMVGNVMAIGIPFIVGAFLFGIGMQLAGVCATGTLYC
FT                   CGEGQPRFWLVLLCYGIGTLISNQLRPELEATFSSHVVLAKDLTGNIWSGMLLNLALVA
FT                   ALFLLFRKSELKRTGELKPLFSGGNLFWRDGRFTVLTGGIIIALLNSSVVALHGSAWTI
FT                   TGAVYDMALRGASLFGLFEGNPKLAQPLFINPMVGMFWLGILGAMLARCISGGGTFAPM
FT                   RLGNSLASILGGLLMGMGAMYSACNLGGFFDGTASGSLHGWVWMLMALAGSLIGIRLRP
FT                   LFKL"
FT   gene            complement(257746..259491)
FT                   /locus_tag="AHA_0237"
FT   CDS_pept        complement(257746..259491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0237"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37070"
FT                   /db_xref="GOA:A0KEU9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU9"
FT                   /protein_id="ABK37070.1"
FT                   /translation="MMSIAPSALTDSNARRDMARAAGLYTGWDYAIHVPDSYGGYMFKA
FT                   IHDRSLLFSQALGILIFIILISISFFGLYSVKSAADKMGEGKDVVADILPPPLYLIEAQ
FT                   LQVYTLLHAAASEREGLLQSLARLEQEFNDRNRFWQESTLDDQLKQSLLGEQRTQAERF
FT                   WQLLDSQFIPAVQAGRLEQAAAIAAQLRTLYLAHRLGVDTTVSRGSQYAAEQLAQLSLT
FT                   ARMCYWLLLVAALTGCALVFWLGRPTQQRLLAAGRATAAIAEGALDSPMPPPGDDAIGD
FT                   LIQRIGRMRDQLSTLVAALQQSAGTLHQQATGLSSLSRQHVDDSLAQVDAARQVEEVIE
FT                   QLQALIQQSDAQLQQVTGMTSGSEAHANATRLVIQEVEQVIRAQADGVRRVSGTIGDLA
FT                   GLSQQISGLAGAIHGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTGEAT
FT                   TEITSIIGRIQDTSQRAVNEMDTELARVGKTVEHVADAKQSITRIEEGCGEICQRIDQV
FT                   GALLEQEKSLIHAINSNVGEMSRLAAKVNDSARHAASEADTVATNSQALTRQTQHFHLA
FT                   PPPRH"
FT   gene            260599..263367
FT                   /gene="mgtA"
FT                   /locus_tag="AHA_0238"
FT   CDS_pept        260599..263367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtA"
FT                   /locus_tag="AHA_0238"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00690; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01524"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39239"
FT                   /db_xref="GOA:A0KEV0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV0"
FT                   /protein_id="ABK39239.1"
FT                   /translation="MKQQHTASRHKQQGFVAPASAREKLSSRVLDEADKSLEYTLTAVR
FT                   GNIDGLTATEAANRLIQFGPNEVTHDKPPHALIQLLQAFKNPFVMVLIVLGLVSYVMDV
FT                   LMAEPGDEDWVKVTILGVMVGLSGLLRFWQEYRSAKAAEALKSLVRNTATVQRRPSPGV
FT                   APQRKEVAMTELVAGDIVHLQAGDMIPADIKLIESRDLFISQAVLTGEALPVEKYDTLG
FT                   AVAGKSADGTGTGAGEAGLLDLPNICFMGTNVVSGTARAVVVATGSDTYFGSLARNVVS
FT                   HKRIETSFDRGVNSVTKLLIRFMLVMVPIVFMLSGVSSGDWMSALTFALAVAVGLTPEM
FT                   LPMIVSANLARGAVAMAKRKVVVKRLNSVQNFGAMDVLCTDKTGTLTQDKIILEHHYDV
FT                   RGKRDDRILQLAWLNSFHQSGMKNLMDIAVVEHADALGESCKPANYRKVDELPFDFVRR
FT                   RLSVIVQDDLGQQLMVSKGAVEEMLAVSSQIADGQEVRELTDADRRALLRQSEEFNADG
FT                   YRVLIVATREIPATECKQSYRTSDEVKLVVRGFLTFFDPPKDSAAPAIRALNEYGVAVK
FT                   VLTGDNPIITSKVCRDVGLEPGVPLLGKDIEVMDDVALCTVVKHTTIFAKLTPLQKSRV
FT                   VKALQANGNTVGFLGDGINDAPALRDADVGISVDSGADIAKETADIILLEKSLMVLEEG
FT                   VIKGRETFGNILKYLNMTASSNFGNVFSVLVASAWLPWAPMLAMQMLIQNLVYDVSQML
FT                   LPWDKMDPEFLKRPRKWEASNIKRFMLWLGPTSSVFDISTYCLMWFVFGAGALYATANG
FT                   SMDPLVNGQAIMNSGWFIEGLVSQTLVVHMLRTRKIPFLQSTATLPVLLSTSIAIAIGC
FT                   YLPFSPLAEHFGFITLDGPKYFMWLVITMLAYMGLTQTVKSIYIKRHGQWF"
FT   gene            complement(263467..264210)
FT                   /locus_tag="AHA_0239"
FT   CDS_pept        complement(263467..264210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0239"
FT                   /product="transporter, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36947"
FT                   /db_xref="GOA:A0KEV1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV1"
FT                   /protein_id="ABK36947.1"
FT                   /translation="MGTPTNSALQSFTIRRPRNPPCCELDTVPEVSMFTSLFLTIGLIH
FT                   LIALASPGPDFALILRTSLHRPTALGAALGIALAILVHATLSLTGISLLIAEHPWLFIT
FT                   VKVVGALYLGWLGWGALKAAWHSSAELALHAGGEAQGWRKGVQRGIATNLLNPKALLFF
FT                   MGLLAAMVTPQVDGLTRGLLVLELFLLSLIWFGVLAWSLSTVRAQRLLGRVQRPLNLVT
FT                   GLLFGAVSLSILTGMAGEAYALVLH"
FT   gene            complement(264194..265012)
FT                   /locus_tag="AHA_0240"
FT   CDS_pept        complement(264194..265012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0240"
FT                   /product="transcriptional regulator, AraC/XylS family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38375"
FT                   /db_xref="GOA:A0KEV2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV2"
FT                   /protein_id="ABK38375.1"
FT                   /translation="MSAPQSRIHYWQSRLLPGVELSHSHHREFSYGRHVHLDYHIGLVQ
FT                   QGGQKFIHKGSSHHLVRGELSTVNPDEMHDGLSLLPEGYEVRVFAIAPEQLARWLPDSP
FT                   EPFFDQGLQRRPDLYQGFARLHMYLDNPSPDGLLAESELLALLGELLHLAPERHALADP
FT                   QLRYLRDHLLARLDERHSLEDLAALFGLDRFAFLRQFKKKTGMTPYAWLKRLRLEQSKR
FT                   LLGSGLPVSEVALAVGFFDQSHFHHGFRQAFGLTPADFRQQMLAASGHAD"
FT   gene            complement(265080..265982)
FT                   /gene="rarD-1"
FT                   /locus_tag="AHA_0241"
FT   CDS_pept        complement(265080..265982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD-1"
FT                   /locus_tag="AHA_0241"
FT                   /product="RarD protein"
FT                   /note="identified by match to protein family HMM PF00892;
FT                   match to protein family HMM TIGR00688"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38801"
FT                   /db_xref="GOA:A0KEV3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV3"
FT                   /protein_id="ABK38801.1"
FT                   /translation="MQQHVQRQGVIYALCAYTLWGLAPIYFKTIAAVPAAEILTHRMIW
FT                   SCALLMVLTLLGRQWHKVQAVLRQPKVLLTLAFTSITVGGNWLLFIWAINNGHMLDASL
FT                   GYYINPLFNVLLGMLFLSEKLRRLQWWAVGLAAIGVAIQIIAFGSLPWIALVLASSFAI
FT                   YGLIRKKLALDALTGLLIETLIMLPPAAIYLWGFADSPTSHLTQNDWHLNLLLIAAGAV
FT                   TTAPLLCFTAAATRLKLSTLGFFQYIGPSLMFILAVTLYGEALALDKMITFAFIWSALV
FT                   LFSLDGLRSGKRRQAAEQA"
FT   gene            complement(266108..266398)
FT                   /locus_tag="AHA_0242"
FT   CDS_pept        complement(266108..266398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39031"
FT                   /db_xref="GOA:A0KEV4"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV4"
FT                   /protein_id="ABK39031.1"
FT                   /translation="MTLICELGGEIPLFHFCPFIASLNRYNHQIDKPLNIKIKMLFFLG
FT                   SVLFLVIGLPLLFYMLGHGEAYVTWGPWISAIALMLWLLLDVDKIRRGGGR"
FT   gene            complement(266407..267903)
FT                   /locus_tag="AHA_0243"
FT   CDS_pept        complement(266407..267903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0243"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39725"
FT                   /db_xref="GOA:A0KEV5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV5"
FT                   /protein_id="ABK39725.1"
FT                   /translation="MSDLTLAQWQHKASHLTLPSQAFIDGSYRDAINGATLDCINPANG
FT                   KLLTKVAACDAADAELAVQAARAAFDDKRWSGLPPKQRKQILQRFAELMRLNKVELALL
FT                   ESLDMGKPIGDAMGYDAPAAANCIAWNAEAIDKIYDQVAPVEESALALVTREPLGVVAA
FT                   IVPWNFPLVMACWKLGPALATGNSVILKPSEKSPLTALRIAGLAKEAGIPDGVFNVLPG
FT                   FGHTVGEALAMHMDVDCITFTGSTKIGKHLVQCSGKSNLKRAFMECGGKSPNIILADAP
FT                   DLDAAAKSAAGAIFYNQGEVCTAASRLLVQNSIKPQFMDRLLAHAREWISANPLDPATR
FT                   IGAMVDHIQMEQVLNYIAIGQQEGAKLLLGGKRTNTESGGFYIEPTIFDEVTPEMRIFR
FT                   EEIFGPVLAVTGFDTLEEAIALGNDTDYGLAAAIWTADLNKAVKGSRALRAGTVFVNNW
FT                   DGGDMTMPFGGFKQSGNGRDKSLHALEKYTELKSTWIQLE"
FT   gene            complement(268165..268707)
FT                   /locus_tag="AHA_0244"
FT   CDS_pept        complement(268165..268707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0244"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35838"
FT                   /db_xref="GOA:A0KEV6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV6"
FT                   /protein_id="ABK35838.1"
FT                   /translation="MDIGHRLKAVRTKAALSQRELAKRSGVTNGFISQIEKNQVSPSVA
FT                   SLRKVLEGIPMSLATFFTDETEMDSEVIFRAADMPDLGTHPISYRLVGHSRANRAIGMM
FT                   QEILPPGADTGDDMLSHEGEECGIVIQGQVEVTVGEQVYLLTPGDGYYFDSRTPHRFRN
FT                   VDEHECVLISANTPASF"
FT   gene            268893..270224
FT                   /locus_tag="AHA_0245"
FT   CDS_pept        268893..270224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0245"
FT                   /product="omega-amino acid--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.18"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36563"
FT                   /db_xref="GOA:A0KEV7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV7"
FT                   /protein_id="ABK36563.1"
FT                   /translation="MKPISDINTPSDMSAFWMPFTANQQFKAAPRILKSAEGMYYHSED
FT                   GRKILDGTAGLWCCNAGHGRREIAEAVSQQISHLDFAPTFQMGHPLPFELANRLVEIAP
FT                   KGLGHVFYTNSGSESVDTALKIALAWQRARGQGTRTRLIGRERGYHGVGFGGISVGGIP
FT                   GNRKWFGSLLGGVDHLPHTLNIAKNAFTKGLPEEDVALADELEKIVFLHDASNIAAVIV
FT                   EPIAGSTGVLMPPKGYLKRLREICTKHGILLIFDEVITGFGRLGAPFAAQEFDVIPDMI
FT                   TCAKGLTNGAIPMGAVLVSNAIYDDMMAAGKGAIELFHGYTYSGHPVAAAAGLATLEIY
FT                   RNENLLSRAADLAGYWEEAAHSLKGCKHVKDVRNYGLVAGIELESMPDAPGKRAYEVFV
FT                   RCFEKGALIRVTGDIIALSPPLIIERSQIDDLFTLLQDALQAQD"
FT   gene            270323..271819
FT                   /gene="mmsA-1"
FT                   /locus_tag="AHA_0246"
FT   CDS_pept        270323..271819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA-1"
FT                   /locus_tag="AHA_0246"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38787"
FT                   /db_xref="GOA:A0KEV8"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV8"
FT                   /protein_id="ABK38787.1"
FT                   /translation="MTYRVSNFIDGETTESRSERFGAIFNPATGQQQGQVVLSTAAECQ
FT                   DAIASAERALADWAQTPPLVRARVLFRFKELMEQHRDDLARLISREHGKVFSDAQGELT
FT                   RGLEVVEFACGIPHLLKGEHSLNVGRGVDSHSMMQPVGVCAGITPFNFPAMVPLWMFPV
FT                   AIACGNTFILKPSEKDPSLSLRMAELLKQAGLPDGVLNVVNGDKEVVDVLLTDPRVGAV
FT                   SFVGSTPIAQYIYATASAHGKRVQALGGAKNHMLVMPDADLELAVSALMGAAYGAAGER
FT                   CMAISVAVVVGDETADALVARLSPLVAALRVGPGLGQSPENEMGPLISREHLAKVRGYV
FT                   DQGVAEGAELVVDGRGLSHGEGYFIGGSLFDRVGPEMRIYREEIFGPVLAIVRAPDYET
FT                   ALRLINEHEYGNGTAIFTCDGDTARDFTARVQVGMVGVNVPIPVPMAFHSFGGWKRSIF
FT                   GPLNMHGPDGVRFYTRMKTVTARWPQSLRAGAEFSMPTMK"
FT   gene            271904..272659
FT                   /locus_tag="AHA_0247"
FT   CDS_pept        271904..272659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0247"
FT                   /product="glutamine amidotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00117"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37499"
FT                   /db_xref="GOA:A0KEV9"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV9"
FT                   /protein_id="ABK37499.1"
FT                   /translation="MRLGILDCDRLDPDLVGDFGPVYSEMFIKGFRALAPGLEFRVWSA
FT                   LDGELPADLHECDAWLITGSRHDAYSDIPWIRALRDWIRRAHDADVKLAGVCFGHQVIA
FT                   QALGGEVMKSTKGWGLGVSVHPMLARQPWMEPGLETIRILASHQDQVEQLPPGATRLAG
FT                   NDFCPNFMFLQGDHIVAIQGHPEFSVEYNRALIERRRDLLPDDRYQRSLSSLEGEVDSA
FT                   TMMQWLLQFLGILPGADTAAGGITAGERA"
FT   gene            272656..273771
FT                   /gene="ald"
FT                   /locus_tag="AHA_0248"
FT   CDS_pept        272656..273771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="AHA_0248"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="identified by match to protein family HMM PF01262;
FT                   match to protein family HMM PF01488; match to protein
FT                   family HMM PF05222; match to protein family HMM TIGR00518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36423"
FT                   /db_xref="GOA:A0KEW0"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW0"
FT                   /protein_id="ABK36423.1"
FT                   /translation="MIIGVPKEIKNHEYRVGMTPAGVQELTARGHKVLVQQQGGEAIGL
FT                   SDAEYQAAGAELVASAAEIFARAEMIVKVKEPQPEECELLRPGQLLFTYLHLAPDPVQT
FT                   QLLVHSGAVAIAYETVTDDRGGLPLLAPMSEVAGRMAIQAGAHSLEKAQGGNGTLLGGV
FT                   PAVAPAKVVVLGGGVVGVNSARMALGLGADVTILDRSLPRLRELDSLYGPALKTLYSTR
FT                   TNIEACIAQADLVIGAVLIPGAAAPKLLTRDMLKLMRKGSVLVDVAIDQGGCFETSHPT
FT                   THEEPTYVVDGIIHYCVANMPGGVARTSTFALTNATLPFVLALADKGYARALQDDRHLR
FT                   AGLNVFKGKITQAAVAQALGYEYVSAESVLG"
FT   gene            273891..274730
FT                   /locus_tag="AHA_0249"
FT   CDS_pept        273891..274730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0249"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39068"
FT                   /db_xref="GOA:A0KEW1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW1"
FT                   /protein_id="ABK39068.1"
FT                   /translation="MSRILLLANLNCDHVLSLSEPLVAGARLQYLDQGRRLGGGAANTG
FT                   IGLVWAGHEVTIASRIGLDETGDWLLEQAAGYGLDCSHVERFGGETGELLILVDSTGER
FT                   TILRRPRRPDLPGDLPSEGVDCLYVNYPGTAIIGYMRQMLGKSFVVAQYPKGGQARRPC
FT                   HVLVASRSDLGEVDDPWQHARQIAGEQLAWLVLTEGKAGAVAIHGEEQIRVAARPVSVV
FT                   DTTGAGDAFAGGLIHGLARGMAIRDALQCAVDWGAFAVASESSIPSSALKNWLRQPH"
FT   gene            275030..275482
FT                   /locus_tag="AHA_0250"
FT   CDS_pept        275030..275482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0250"
FT                   /product="Rrf2 family protein"
FT                   /note="identified by match to protein family HMM PF02082;
FT                   match to protein family HMM TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37866"
FT                   /db_xref="GOA:A0KEW2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW2"
FT                   /protein_id="ABK37866.1"
FT                   /translation="MQLTRFTDYALRTLTFLAVQPGDRLSTITEVADTFAISRNHVVKI
FT                   VHQLGIKGYIETVRGKHGGIRLGRSAVSINLRDVVMDMEHVLCPVDCKRENCRLSGGCR
FT                   IQGILRRAMNAFLEVLGEYTLADAVRDPTRLCHLLGIEQDSILAMA"
FT   gene            complement(275541..276053)
FT                   /locus_tag="AHA_0251"
FT   CDS_pept        complement(275541..276053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0251"
FT                   /product="NapF protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36264"
FT                   /db_xref="GOA:A0KEW3"
FT                   /db_xref="InterPro:IPR004496"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW3"
FT                   /protein_id="ABK36264.1"
FT                   /translation="MTHFFCRWLTQALGGSRKPEVVCHEARPPWAIEESQFLSLCSRCG
FT                   ECFKACPNGLLKPANQPEYDDTPIAGTPVLDLACGQCSYCGSCARACPTGALDLQLGRQ
FT                   VQTRVRIEASCQARQGFYCLLCEDACPQQAIKATADGVSINMAACDGCGACGLACLHGA
FT                   ITLIPQL"
FT   gene            276180..276407
FT                   /locus_tag="AHA_0252"
FT   CDS_pept        276180..276407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0252"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39840"
FT                   /db_xref="GOA:A0KEW4"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW4"
FT                   /protein_id="ABK39840.1"
FT                   /translation="MNELMWLFLWRASLLYVFPLLMWGYCRIKGIEFVELDTGVNSHKW
FT                   VVLAAYLLYVLLWLLLNRYLELFLRQRSRK"
FT   gene            276404..277744
FT                   /locus_tag="AHA_0253"
FT   CDS_pept        276404..277744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0253"
FT                   /product="DNA recombination protein RmuC"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37955"
FT                   /db_xref="GOA:A0KEW5"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW5"
FT                   /protein_id="ABK37955.1"
FT                   /translation="MIEPGLWSLLLAGAVLAVGLGWLVGRRGAAQLAQQVLLSEERQQA
FT                   LQDRCDELQDEKLQSQQKLEQQQTLLIKLTARLKDAEATLRSERLAAAEKLQLQQEAEQ
FT                   RLSQQFENLANRIFEQNSGNFRELNQNSLDLLLTPLKEQLEGFRRQVGETHAQETAQRH
FT                   SLKFELERLAELNARMTEEAAALTRALKGDSKQQGNWGEVVLARILSECGLREGHEYHT
FT                   QVNIEVDRGKRYQPDVIVHLPQDKDIIIDAKVSLTAYERWYNSDDELEKAVALKEHVAS
FT                   VRNHIRELGRKDYQQLPGVRTLDYVLMFVAVEPAFLTAVEADPSLVRFGLDNNILLVSP
FT                   TNLMVALRTIENLWRYERQNQNARQIAERAGRLYEKLRLFVEEMQQLGGSLHRAQESYD
FT                   KAMGRLVNGRGNLIAQVERFRELGVEVTKTLPEPLVNRALEREDPAE"
FT   gene            complement(277850..279292)
FT                   /locus_tag="AHA_0254"
FT   CDS_pept        complement(277850..279292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0254"
FT                   /product="TrkH"
FT                   /note="identified by match to protein family HMM PF02386;
FT                   match to protein family HMM TIGR00933"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36598"
FT                   /db_xref="GOA:A0KEW6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW6"
FT                   /protein_id="ABK36598.1"
FT                   /translation="MIKLRPIIFTLGLVLSKLALFMWLPTLLALLTGSEGFVEFLKSVL
FT                   ITHGAALLCLHYGRKAVFHLGVREMFLLTTSVWVVACIFGALPFFFINHIDFTDAYFET
FT                   MSGVTTTGSTVLSGLDGMAHSILLWRSILQWLGGVGFIVMAVAVLPYLNVGGMKLFQTE
FT                   SSDWSDKSAPRAKTVANNIVLVYLVLSMLCFLAYWVSGMTLFEAVNHSMTTLSTGGYST
FT                   SDQSMSHFSNSAHWIGTVFMFLGGLPFLLYVQSLSRRDNSLLKDAQVQGFFWLVVWVTV
FT                   VVTFYLWLRDIYGFMDALRISCFNIVSVLTTTGFGLGDFGTWGPLTSIIFIILLALGAC
FT                   SGSTAGGLKIFRVQVAFALFKKQMRQLMHPSGVFPQKYNGRPVNDAIIRSMISFVLAYF
FT                   AVILLIAALLAAIGLDPLTAISGSITAVANVGPGMGPIIGPSTNFATLPDSAKWILSFG
FT                   MLLGRLEILTVAVLFFPSFWKQ"
FT   gene            complement(279389..280765)
FT                   /gene="trkA"
FT                   /locus_tag="AHA_0255"
FT   CDS_pept        complement(279389..280765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="AHA_0255"
FT                   /product="Trk system potassium uptake protein TrkA"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254; match to protein
FT                   family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39373"
FT                   /db_xref="GOA:A0KEW7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW7"
FT                   /protein_id="ABK39373.1"
FT                   /translation="MKIIILGAGQVGGTLAENLAGENNDITIVDTDSDRLRELQDKFDL
FT                   RVVNGHGAHPKVLREAGAQDADMLVAVTNSDETNMVACQVAYSLFNTPNKVARIRSPAY
FT                   LVERDRLFLPESVPVDHLIAPEQLVTDYVRRLIEYPGALQVVDFAGGKVGLVAVKAYYG
FT                   GPLVGNALSTLRDHMPNIETRVAAIFRQGRSIRPQGTTIIEADDEVFFVAAAGHIRAVM
FT                   SELQRLESPYRRIMIVGGGNIGAGLARQLEKRYSVKLIERNQKRAEQLSEVLENTIVFC
FT                   GDAADQELLAEEHIDQIDVFIAVTNEDEANIMSALLAKKMGAKKTMVLIQRSAYVDLVQ
FT                   GGSIDIAISPQQATISALLTHVRRADIANVYSLRRGAAEAIEAIAHGDENTSKVVGKTV
FT                   GELKLPPGTTIGAIVRGDEVLIAHDRTQIQQDDHVVMFLVDKKYIPEVERLFQPSPFFL
FT                   "
FT   gene            complement(280913..282205)
FT                   /gene="sun"
FT                   /locus_tag="AHA_0256"
FT   CDS_pept        complement(280913..282205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="AHA_0256"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189; match to protein
FT                   family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37178"
FT                   /db_xref="GOA:A0KEW8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW8"
FT                   /protein_id="ABK37178.1"
FT                   /translation="MKTRAQAALVIQQVLDQGQSLSAVLPAAQEKVAPRDRALLQELCY
FT                   GTLRWLPRLDAAVGEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAVKL
FT                   LKGTSLRGLINGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAYPDEWEFIME
FT                   ANNQRPPMWIRNNSQRQSREQMLVRMAEAGINAMAGEEGEDCILLERPCDVTKLPGFEA
FT                   GDCSVQDGAAQQAAALLDPQPGEWVLDACAAPGGKTAHLLERQPALAGVVAVDADDNRL
FT                   KRVQENLDRIGLTAKVIHGDASTPDLWWPEGQFDRILLDAPCSATGVIRRHPDIKWLRR
FT                   DQDIRELAELQHRILGALWSKLKSGGTLLYATCSVLPEENRDQIRAFLAATPDATLVPL
FT                   HAQDTPECPGRQFLPGEAEMDGFYYAKLIKR"
FT   gene            complement(282262..283206)
FT                   /gene="fmt"
FT                   /locus_tag="AHA_0257"
FT   CDS_pept        complement(282262..283206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="AHA_0257"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37667"
FT                   /db_xref="GOA:A0KEW9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEW9"
FT                   /protein_id="ABK37667.1"
FT                   /translation="MNKLKLIFAGTPDFAARHLAALLSSDHEVVAVYTQPDKPAGRGQK
FT                   LTASPVKELALAHNLPVYQPASLRKEEAQAELAALGADLMVVVAYGLILPKAVLDTPRL
FT                   GCINVHGSLLPRWRGAAPIQRSIWAGDAETGVTIMQMDVGLDTGAMIRKVSCPIAADET
FT                   SASLYDKLAGLGPQALVDTVNAMAAGNTAAEAQDDAQANYAEKLSKEEARIDWSMEAVA
FT                   IERCTRAFNPWPISWFEVAGQTVKVWQAEVVAQDHGQAAGTLLKADKQGIDIATGKGVL
FT                   RLLTLQPPGKKAMSVTDLLNSRRDWFEPGTQLN"
FT   gene            complement(283219..283731)
FT                   /gene="def-1"
FT                   /locus_tag="AHA_0258"
FT   CDS_pept        complement(283219..283731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="AHA_0258"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38402"
FT                   /db_xref="GOA:A0KEX0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX0"
FT                   /protein_id="ABK38402.1"
FT                   /translation="MAILDVLRFPDERLRTVAAPVETFTPELQHIVDDMFETMYAEEGI
FT                   GLAATQVDIHQRIIVIDVSENREDPLVLINPEIIEQAGSTGIEEGCLSVPGSRALVPRA
FT                   EWVKVRALDRHGKAFELEADDLLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMA
FT                   REDRKVL"
FT   gene            283840..284928
FT                   /locus_tag="AHA_0259"
FT   CDS_pept        283840..284928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0259"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38866"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX1"
FT                   /protein_id="ABK38866.1"
FT                   /translation="MYLKQTILACLLATLSQGVLADQLKLKAGYPETYVVQKGDTLWDI
FT                   SGQYLAEPWLWPRLWNINPQIANPHWIYPGDVLHLSWVNGEPRLGKAMQGGKQVVRLSP
FT                   KSRYENKANPIPTLPLSEIGPFLQTDHILADSQQAKQLPYVLGNDEAHIGMLEGDTLYV
FT                   QGSLIPGQDYGIYHPGTIYKDKKSGEQLGQEAVFVGTARAEALLPDGRTRVTLSHNQRE
FT                   VYQGDKLMPFPPQESLSAVFTPKAAPIISPGYIVDLPSKARGGGKFDVVLINKGIRDQV
FT                   APGDVLEILRPGARLVSKNGKVAYREYSSVYDKAFYSTGKPPLPSEAVARVMLFKVYDK
FT                   LSYGLILQSQDMVSTGYQVSNF"
FT   gene            284930..286045
FT                   /gene="dprA"
FT                   /locus_tag="AHA_0260"
FT   CDS_pept        284930..286045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="AHA_0260"
FT                   /product="DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39832"
FT                   /db_xref="GOA:A0KEX2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX2"
FT                   /protein_id="ABK39832.1"
FT                   /translation="MPLPSGRLALWLTLDAVTGIGPVTAARLLAHFGGDIVTLFDTDDG
FT                   ALRALGLQSVQVQQMRWPQPVVEQALSWAAEPGNHLLCPDDPAYPALLKEIPAAPLLLY
FT                   CRGNLAALSVPQLAMVGTRHPTYAGKDNAARLCSELVACGLAITSGLALGIDGVCHQQA
FT                   LAAGGTTLAVLGSGLDCLYPKRHQGLAMEILVRGGLLISELAPDKGPLAEHFPRRNRII
FT                   SGLSLGTLVVEAAEQSGSLITARYALEQGREVFAVPGAPQNVQALGCNKLIQQGAKLVL
FT                   SAADIVEELPGFVGLLQQVADLSEHSNNSELPYADLLDNVDYETTSVDTVAERSQLPVE
FT                   VVLGRLVELELAGAVMAVAGGYVRARRANHV"
FT   gene            286038..286511
FT                   /locus_tag="AHA_0261"
FT   CDS_pept        286038..286511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04361"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39398"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEX3"
FT                   /protein_id="ABK39398.1"
FT                   /translation="MFDVLMYLFETYIHSDADVMVEQNELTDELSRAGFDKDEIEKALN
FT                   WLERLANLHDSEREVYVAASAQGSMRIYAPQELARLSTECRGFLLFLEQAQVLNAETRE
FT                   ICIERLLELDKPDIELDDLKWVVMMVLFNVPGSENAYQQMEELVFDESDGVIH"
FT   gene            286567..287124
FT                   /locus_tag="AHA_0262"
FT   CDS_pept        286567..287124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0262"
FT                   /product="topoisomerase DNA-binding C4 zinc finger domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01396"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38729"
FT                   /db_xref="GOA:A0KEX4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX4"
FT                   /protein_id="ABK38729.1"
FT                   /translation="MSKIDHHLFSAHEHAFEREPCPQCGAELVIRQGKHGPFLGCSAYP
FT                   VCDYIRSLTPSGRDIEKVLEGSACPDCGQPLAIKKGRYGLFVGCTQYPACQHIESLQES
FT                   DDTQILCPECGKGHLISRTSRYGKQFYSCDGYPHCKYVVNDKPVPMPCPQCGWGIMVEK
FT                   KVRGALRWICPQKKCGHQSEQV"
FT   gene            287199..287702
FT                   /gene="purE-2"
FT                   /locus_tag="AHA_0263"
FT   CDS_pept        287199..287702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE-2"
FT                   /locus_tag="AHA_0263"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39569"
FT                   /db_xref="GOA:A0KEX5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX5"
FT                   /protein_id="ABK39569.1"
FT                   /translation="MNKPFVAVLMGSDSDFPVMQTTLEVLKSFDIAVEVKVTSAHRTPA
FT                   ATHQYVTDAEARGCKVFICAAGLAAHLAGAVAGITTRPVIGVPIDGGPLKGLDALLSTV
FT                   QMPGGVPVATVAIGKAGAKNAGYLAAQMLAVADDELAAKVQAERQKNADEVLAKDAALQ
FT                   ALLK"
FT   gene            287837..288397
FT                   /locus_tag="AHA_0264"
FT   CDS_pept        287837..288397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0264"
FT                   /product="Sua5/YciO/YrdC family protein"
FT                   /note="identified by match to protein family HMM PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37578"
FT                   /db_xref="GOA:A0KEX6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEX6"
FT                   /protein_id="ABK37578.1"
FT                   /translation="MPNEFELAVAALQRDGVIAYATEAVFGLGCDPDSESAVHRLLAIK
FT                   QRPVEKGLILIAADLAQLQDYIDLDQLTSEQLARVEASWPGPFTWIMPARSNTPAWLTG
FT                   QFTTLAVRVTAHPQVQALCRAFGKPLVSTSANLTGEEPARRVADIGELLASQLAYILPG
FT                   EVGGQANPSEIKDARTGAIIRPS"
FT   gene            288492..289400
FT                   /gene="hemF"
FT                   /locus_tag="AHA_0265"
FT   CDS_pept        288492..289400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="AHA_0265"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by match to protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36850"
FT                   /db_xref="GOA:A0KEX7"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEX7"
FT                   /protein_id="ABK36850.1"
FT                   /translation="MSKPDVAQVKAFLLQLQDEICRGLELADGAGHFVEDAWRREGGGG
FT                   GRTRVLRHGAVIEQGGVNFSHVHGDAMPASATAHRPELAGRRFEAMGVSLVIHPHNPYV
FT                   PTSHANVRFFIAEKEGEEPIWWFGGGFDLTPFYPFEEDVRHWHQLSRDLCQPFGTDIYP
FT                   EFKSWCDRYFFLKHRDETRGVGGLFFDDLNRWPFADCFAFMQAVGKGYLDAYLPIVERR
FT                   KALAYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLARWEYDWQ
FT                   PSAGSPEALLYSDYLKPREWL"
FT   gene            289504..290325
FT                   /gene="aroE"
FT                   /locus_tag="AHA_0266"
FT   CDS_pept        289504..290325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="AHA_0266"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36524"
FT                   /db_xref="GOA:A0KEX8"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEX8"
FT                   /protein_id="ABK36524.1"
FT                   /translation="MDRYLVFGHPVRHSKSPFIHTLFARQTQQELEYGLAEPAVEEFAT
FT                   SLRAFFAQGGKGCNVTVPFKEQAFALVDRLSPRARRAGAVNTIKLTDDGVLLGDNTDGA
FT                   GLVADLKAHGVALAGSRILLLGAGGAARGALAPLLAEQPEALVIANRTHARAEQLAAEF
FT                   RDLGAVSAQTYERLGGHFDLIINSTSASLQGELPPLVPALIHADIAIYDMMYGATDTPF
FT                   IAWAKGQGARQTVDGLGMLVEQAAEAFTVWRGIRPGTKQVLRELKRNLGTL"
FT   gene            290322..290582
FT                   /locus_tag="AHA_0267"
FT   CDS_pept        290322..290582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07369"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35942"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX9"
FT                   /protein_id="ABK35942.1"
FT                   /translation="MNQGILFPELADWQAHEQRIHFPAQQMGALVDCYISRRRLEKMTG
FT                   LSLAREEDILRAFESVRFDIEDIAEKLIEEQEFAEDGAIYL"
FT   gene            complement(291373..292023)
FT                   /locus_tag="AHA_0268"
FT   CDS_pept        complement(291373..292023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0268"
FT                   /product="GTP-binding protein YihA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39156"
FT                   /db_xref="GOA:A0KEY0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEY0"
FT                   /protein_id="ABK39156.1"
FT                   /translation="MDTQTLNFNKVHFVTSAPDIRHLPNDGGVEIAFAGRSNAGKSSAL
FT                   NTLTKHKNLARTSKTPGRTQLINLFELEPGKRLVDLPGYGYAQVPLEMKLKWQKSLAEY
FT                   LQRRESLKGLVILMDIRHPLKDTDMNMLEWSSHRKLPVMLLLTKADKLSPGPRNNQVIK
FT                   VRQAVAELGPQIQVEAFSSLTQIGVEKLAQTLTGWYLAGADDMTDGEQAPLEE"
FT   gene            292127..292783
FT                   /locus_tag="AHA_0269"
FT   CDS_pept        292127..292783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0269"
FT                   /product="cytochrome c4"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37649"
FT                   /db_xref="GOA:A0KEY1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY1"
FT                   /protein_id="ABK37649.1"
FT                   /translation="MGSGSLITRSWNAMKNLVITLALMVGVTGMAQAKGDAAAGQTKAA
FT                   VCAACHGPDGNSLVDMYPKIAGQHASYIKKQLVELKAAASGQTGRVAPIMGPMALPLSE
FT                   QDMEDLAAYFSSQKVTPLAVPDDAVAAGKALYMGGDMSRGLAACTACHGPRGSGVEQAK
FT                   YPSLSGQHPAYIKAQLTAFRAAARDNDPNSMMRDVAKKLTDQDIEVLSKYVAGLH"
FT   gene            293413..294189
FT                   /locus_tag="AHA_0270"
FT   CDS_pept        293413..294189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0270"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF04220"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39574"
FT                   /db_xref="GOA:A0KEY2"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEY2"
FT                   /protein_id="ABK39574.1"
FT                   /translation="MVILCQNTSNMPRGCRSCGIRRPFMAGLVRDPALFLIHRPPCQHP
FT                   LPDLFEPETGFNPVICRSHSFMSAKQPNRKPAGKRKESDASAQEGRERKRAAKRKGLKA
FT                   GSRQQVEQAGKKSGTKQAKDPRIGSRKPVALIVEEKSSKPVAPKQIKEKKLVMTPEQEL
FT                   ASIENDDRLNDLLDRLDAGETLEATEQAWVDQRVDRYQELMDELGIIDTDDDEDEADFD
FT                   EADFDEPGQPASEEELWDRFTQVDYQPEPKPEPKKK"
FT   gene            294201..294641
FT                   /locus_tag="AHA_0271"
FT   CDS_pept        294201..294641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38990"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY3"
FT                   /protein_id="ABK38990.1"
FT                   /translation="MLAALLGGLILLGLAWYAGTLLARLKRQHDSQQQAVAARNERILE
FT                   SVRVIAHAVRDGQCDYSEGAIRLTNLLDALQIKGGRAFAGEFPGLYGLYEKVKDMPTHE
FT                   VRRALKRNEVMKMDLERSGYEAELEAQILEDVARLKDFQLSR"
FT   gene            294669..296042
FT                   /gene="hemN"
FT                   /locus_tag="AHA_0272"
FT   CDS_pept        294669..296042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="AHA_0272"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00538"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38410"
FT                   /db_xref="GOA:A0KEY4"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY4"
FT                   /protein_id="ABK38410.1"
FT                   /translation="MQAEQIVWDQALIEKYNYSGPRYTSYPTALEFNEGFGYPDFVQAA
FT                   SQYPARNLSLYVHIPFCHKLCYYCGCNKVITRHRHKADQYLDFLEQEIKAQAPLFKQRL
FT                   VTQLHWGGGTPTYLDEPQTRRLMAMLREHFHFAEEGEISIEVDPREIELSMLDVLREIG
FT                   FNRISLGVQDFNKEVQVAVNREQDNDFIRAMLERARELGFRSTNLDLIYGLPHQNRESF
FT                   HHTLEEVLKTDPARLSIFNYAHLPSRFAAQHKLKEADMPAPQEKLAMLQDTIAFLTGRG
FT                   YQFIGMDHFAKPDDELAVAQREGKLHRNFQGYTTQGDCDLLGLGVSSISMIGDAYSQNQ
FT                   KELKAYYGQVETLGHAQWKGCSLNQDDLIRREVIKRLICDFRLNFAAVEQAHGLVFREY
FT                   FAEDLKLLQTFIDDGLVRMTEEGLEVISTGQLLIRNICMCFDVYLRNKARQQQFSRVI"
FT   gene            complement(296111..297112)
FT                   /gene="add-1"
FT                   /locus_tag="AHA_0273"
FT   CDS_pept        complement(296111..297112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add-1"
FT                   /locus_tag="AHA_0273"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="identified by match to protein family HMM PF00962;
FT                   match to protein family HMM TIGR01430"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37872"
FT                   /db_xref="GOA:A0KEY5"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY5"
FT                   /protein_id="ABK37872.1"
FT                   /translation="MIDRSLPLTDLHRHLDGNIRPQTILELGRQHNIQLPAFELEALRP
FT                   HVQIVENEPSLVAFLKKLDWGVAVLADYDACRRVAYENVEDLLRAGIDYAELRFSPAYM
FT                   AMAHKLHPQGVVEAIIDGVAAGSRDFGIKTNLIGIMSRTFGTEQCKQELDACLAHRDRL
FT                   IAIDLAGDELGFPGELFTDHFRRVRDAGMRVTVHAGEAAGPESMWQAIRELGAERIGHG
FT                   VKAIQDPALMAYLAEHRIGIESCLTSNIQTTTVASLTEHPIRQFLAAGVLACLNTDDPA
FT                   VEGIDLPHEYEVAAPAAGMTVSEIRTAQQNGLTLAFLSEAEKAELSARAAQR"
FT   gene            complement(297254..298672)
FT                   /gene="ntrC"
FT                   /locus_tag="AHA_0274"
FT   CDS_pept        complement(297254..298672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="AHA_0274"
FT                   /product="nitrogen regulation protein NR(I)"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954; match to protein family HMM TIGR01818"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37436"
FT                   /db_xref="GOA:A0KEY6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY6"
FT                   /protein_id="ABK37436.1"
FT                   /translation="MTAKVWIVDDDSSIRWVLERTLGSEGFECESFADGEALLSSLEMR
FT                   SPDVILSDIRMPGIDGLSLLEQIHRRQADLPIIIMTAHSDLDSAVNAYQRGAFEYLPKP
FT                   FDIDEAVTLVRRAENHLKEQRTKRKARQQDPASSPEIIGEAPAMQEVFRAIGRLSRSSI
FT                   SVLINGQSGTGKELVAHALHKHSPRAHKNFIALNMAAIPKDLIESELFGHEKGAFTGAN
FT                   NIRHGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHQPVQVDVRIIAAT
FT                   HQNLEKRVADGEFREDLFHRLNVIRIHIPALKERREDIPQLAQHFLLRAAKELNVEAKS
FT                   LHPDTQAYISRLPWPGNVRQLENVCRWLTVMASGQEVLVSDLPTELLTPITSTAEPGQP
FT                   ALSGGWQQQLQDWVAAKLALGETDILADALPQFERIMLETALDHTHGHKQEAARLLGWG
FT                   RNTLTRKLKELDLS"
FT   gene            complement(298682..299737)
FT                   /gene="glnL"
FT                   /locus_tag="AHA_0275"
FT   CDS_pept        complement(298682..299737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="AHA_0275"
FT                   /product="nitrogen regulation protein NR(II)"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to SP:P06712; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00989; match to protein family HMM PF02518; match to
FT                   protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37246"
FT                   /db_xref="GOA:A0KEY7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY7"
FT                   /protein_id="ABK37246.1"
FT                   /translation="MPTRPDQAKILLDNLLTAVILMDERLCIQFVNPAAEQLLSLSQRR
FT                   LIGIELPHLLEHISLDLQRLKQCLSSGQGFTDSEVTLVVEGEPRLVEMSVSPLADHEQR
FT                   LMVVELRKIDQQKKISQELQQHAQQQAAKELVRGLAHEIKNPLGGLRGAAQLLQKELPD
FT                   PALREYTGIIIEQADRLRVLVDRLLGPQRPGRHQMHNVHSVLEQVRRLVELELPPTVRI
FT                   ERDYDPSIPEFEMEPDQLQQAFLNMVRNAAEAIGEQTGLIRIKTRTAFQITIHGQRYRL
FT                   AAEIKIIDNGPGIPDAIRDTLFYPMITGKEGGTGLGLSIAQNLIDQHKGRIDCISWPGH
FT                   TEFTIFLPLRK"
FT   gene            complement(299818..300399)
FT                   /locus_tag="AHA_0276"
FT   CDS_pept        complement(299818..300399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN57435.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36184"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY8"
FT                   /protein_id="ABK36184.1"
FT                   /translation="MKNANPVWMLSLLLLVATGAQAAKVYSWTDSQGVVHYTDAPPPGQ
FT                   KAKEVDLRVAPFIGSSPRSVQVDNFNSLTGVDAKKEKEAAKLVIELLSPEQGSTLRDNT
FT                   GNVVFQGQISPQPPTQYDVRLTLDGKAAPIVKNSLAIRVENLDRGAHEAQLELLAKDGT
FT                   ILAKSKPVTFYLHRASINPAPKVTPLNNKG"
FT   gene            complement(300492..301901)
FT                   /gene="glnA"
FT                   /locus_tag="AHA_0277"
FT   CDS_pept        complement(300492..301901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="AHA_0277"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37740"
FT                   /db_xref="GOA:A0KEY9"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY9"
FT                   /protein_id="ABK37740.1"
FT                   /translation="MSAQNVLALIQEHEVKFVDLRFTDTKGKEQHVSIPSHQVDEDFFE
FT                   DGKMFDGSSIGGWKGINESDMVLMPDAASAKLDPFTEETTLNIVCDVLEPATMQGYDRD
FT                   PRSIAKRAEDFLKSSGIADTVLFGPEPEFFMFDNITFSNTMGHSFVKIESEEAAWNSGT
FT                   DYEHGNKGHRPFVKGGYFPVAPVDSSQDIRAAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTLTLKADEVQVLKYVIHNVAHAYNKTVTFMPKPMFGDNGSGMHCHQSLAKNGVN
FT                   LFAGDLYGGLSEMALHYIGGIIKHAKAINAFANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVPSPKARRIEVRFPDPAANPYLAFAAQLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEAAEVPTVAGSLDEALAALDADREFLTRGGVFSDDFINSYLELKQQDVDRVRMTP
FT                   HPLEFELYYSV"
FT   gene            302253..304064
FT                   /gene="typA"
FT                   /locus_tag="AHA_0278"
FT   CDS_pept        302253..304064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="AHA_0278"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39176"
FT                   /db_xref="GOA:A0KEZ0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ0"
FT                   /protein_id="ABK39176.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKLLQQSGTLDRSTEGQERIMDS
FT                   NDLERERGITILAKNTAIRWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTQKAFAQGLKPIVVINKIDRPGARPDWVMDQVFDLFDNLGATDEQLDFKVV
FT                   YASALNGWATMDQDVESDNMEPLFQAIVDNVEAPKADADGGFQMQISQLDYNSYVGVIG
FT                   IGRITRGRVKTNQQVTIVGADGKSRTGKVGQVLGYLGLSRTEVADAQAGDIIAITGLGE
FT                   LKISDTICDNGAVEALPPLSVDEPTVNMTFQVNTSPFAGKEGKFVTSRNILERLNQELV
FT                   HNVALRVEETDDPDKFRVSGRGELHLSILIENMRREGYELAVSRPEVILRTVDGVLQEP
FT                   FETVTVDVEEAHQGSVMEQLGLRKGEMTNMTPDGKGRVRLDFMIPSRGLIGFQTEFMTL
FT                   TSGTGLLYHTFDHYGPHKGGSIGERQNGVLISNATGKALTYALFGLQDRGRLFIGHATE
FT                   VYEGQVIGIHSRSNDLTVNCLKGKQLTNMRASGTDEAQVLTPPIRMSLEQALEFIDNDE
FT                   LVEVTPKSIRIRKKLLTEMDRKRAGRA"
FT   gene            304238..305110
FT                   /locus_tag="AHA_0279"
FT   CDS_pept        304238..305110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0279"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38475"
FT                   /db_xref="GOA:A0KEZ1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ1"
FT                   /protein_id="ABK38475.1"
FT                   /translation="MQQKFGGRLGHALSFLRHDGGHFAQFVWGRFQQDRLTVTAGYLAY
FT                   VTLLSLVPMIAVVFGMMSAFPVFQSLKQAMEQFVYHNFVPTAGEMLKEYIDGFVANATN
FT                   TTAVGIGALIVVALMLISAIDKNLNYIWRSTQSRPLAQAFAMYWMILTLGPVLIGASIA
FT                   ISSYIFSLRLFGAESLFGIGYLLLRGLPFLFSVLTFLLVYTVVPNCKVRLMHAFIGALV
FT                   AATLFELAKRGFAIYITNFPSYQAIYGALATIPILFVWVYLSWLVVLLGAETTACLGEY
FT                   ERPGADELA"
FT   gene            305191..305628
FT                   /gene="dtd"
FT                   /locus_tag="AHA_0281"
FT   CDS_pept        305191..305628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="AHA_0281"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF02580;
FT                   match to protein family HMM TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39550"
FT                   /db_xref="GOA:A0KEZ2"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEZ2"
FT                   /protein_id="ABK39550.1"
FT                   /translation="MIALIQRVSEASVTVEGEMTGAIGQGLLVLLGVEQGDDEAKADKL
FT                   LHKVSGYRIFSDENGKMNLNVSQAGGGLLVVSQFTLAADTNKGMRPSFSGGAHPVEAER
FT                   LYDYFVAQAAASGIPTATGRFAADMKVALVNDGPVTFWLQV"
FT   gene            complement(305617..306393)
FT                   /locus_tag="AHA_0280"
FT   CDS_pept        complement(305617..306393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39106"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ3"
FT                   /protein_id="ABK39106.1"
FT                   /translation="MGIRFGCRLGGDHPVHSSILELHWSKTILPCKFMDFNLQAYQADH
FT                   LLHLSAKPQRRLTVQENAHHRWLEIDGVVQSAMSLTEPATLCLPHQQVIACLLPEQAGS
FT                   ILELGLGGGDLTRHLHQRWPDARHECVDLDEEVITLYQLFFQPDQHPQRTPTLHQADAL
FT                   AFLEQSEAQYDLILLDLFSQDGNPPLLFQERIYQALAPRLNGELIINLLPRTRLELTRV
FT                   LMLLEQWVGPTTPYPVPGLRNVLLHTAPRYELASDL"
FT   gene            306468..307376
FT                   /locus_tag="AHA_0282"
FT   CDS_pept        306468..307376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0282"
FT                   /product="acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR02447"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37945"
FT                   /db_xref="GOA:A0KEZ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ4"
FT                   /protein_id="ABK37945.1"
FT                   /translation="MYRVVTPQTAAELDAYYQLRWELLRKPFNLPVGSERDEYDTVAIH
FT                   RLMLAPDGTPIAVGRLFVGGDEAQIRFMALRPEFRGQGLGARMVEDLEQLARSEKVKRL
FT                   VMNARQEAVEFYRKCGFLEVGEGPVSFGRIPHRQMIKSLSPLQTIQYRPEWCQDLTTRW
FT                   SRGIPISEKMGVHITHYDGQTFHLKANLAANLNVHDTMFAGSIYSQCVLAGWGLIWLQL
FT                   KEAGLVGDTVLAEGNIKYYRPVKEEPEARVAREGMPAVLEPLKAGESAKFSLKIKLFSG
FT                   DKLAAEFLGHYVVQPVKRPGQ"
FT   gene            complement(307439..309505)
FT                   /locus_tag="AHA_0283"
FT   CDS_pept        complement(307439..309505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0283"
FT                   /product="AsmA family"
FT                   /note="identified by match to protein family HMM PF05170"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38401"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ5"
FT                   /protein_id="ABK38401.1"
FT                   /translation="MNSWLRGLLYTLAFLLLFVWVGLGLFDAERAKGPIASWLSQQTGV
FT                   PVTIGRLVFNPLHPYTLLAEQVSYGNAVTLDKIYLEIESIDWLSRDVRIAHLDLIRPAI
FT                   KLPLPNQLPSLPVHSLTIADSTIDRLSLESDGLTLRGLNATLSDWQLLNPVRPPQANLT
FT                   LNINELATPAWALSRLNLAGRLEGQVLSTDKLTANLFDGLLETGMVLDWPARSLRLNNL
FT                   KTQGMRIEWGTLAKAESPLRQVSLDLGQIRDLSFNDIERELALNNLNGQLTAFNWQAGS
FT                   TPSGYFSGTLGDLGRGLFQLEAIQGKVAFSTQQLDAELQGKAYEGEFNLELSLDPLQQK
FT                   LTLKDMALSGMDISLPEGWWQDWQRWRPQQIDIRKLAFDKLKVLSFDDTLPLSLTGWQF
FT                   YLTDLSLRGNQPGPLLGRARLESAWFELVWDGLSARNGELDGELTAGSWQLNKLTSSLP
FT                   DEGSLSLSGQWGREPGQSSRLQLKGEKLDLVQWGKILHSPVSFAGKMDLSADLQALHGG
FT                   TPGAWRSSLQGNIALDATEPFWDKVKIDPLLDQWFKQAAAPTLSPAELWQAMQEGDTPF
FT                   YRIKLQGKVAQGQLKIEQAGASTITHLLGVQGSVDLVNEQWQLDLGVLNGQHCTELLGQ
FT                   WRGKLAEPTLSWSFQQKPDGCGWETGVRYPPQGNSSPLWRPAPKAPAAQAVNG"
FT   gene            complement(309648..311720)
FT                   /gene="recG"
FT                   /locus_tag="AHA_0284"
FT   CDS_pept        complement(309648..311720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="AHA_0284"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF01336; match to protein family HMM TIGR00643"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36805"
FT                   /db_xref="GOA:A0KEZ6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ6"
FT                   /protein_id="ABK36805.1"
FT                   /translation="MMKLDKISLDSLKGVGSKMQEKLERLGLATVQDLLFHLPLRYEDR
FT                   TQVWPIGDLPPGLHGAVEGEIQDTQLVMGRRRMLVCRISDGTGTLTLRFFNFTAAQKNS
FT                   LSPGRLMRCFGEVRPGKYGLEMAHPEYKLLGEEQAGQTEEALTPVYPTTEGLRQLTLRS
FT                   LTDQALAQLDLYGVEELLPAGLYPQQIDLAAALKLLHRPPPSVALALLESGQHPAQQRL
FT                   VLEELLAHNLSVLKVRAQAQTQLARALKPAPALVEQLLGALPFTPTGAQNRVVAEIGRD
FT                   LQQSHPMMRLVQGDVGSGKTLVAALAALQAIGNGCQVGLMAPTELLAEQHAINFAKWLE
FT                   PLGIGVGWLAGKQKGKAREEALAAIADGSVKMVVGTHAIFQEQVVFQRLALVIIDEQHR
FT                   FGVHQRLALREKGEREGVHPHQLIMTATPIPRTLAMTAYADLDTSIIDELPPGRTPITT
FT                   VALPDSRRQDVIERVRLACEEGKQAYWVCTLIEESEVLECQAAEDTAAELQNLLPGLHI
FT                   GLVHGRMRPVEKQRVMEEFKAGMLQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLH
FT                   QLRGRVGRGSVASHCVLLYHAPLSKTAQSRLGVLRETNDGFLIAQRDLELRGPGELLGT
FT                   RQTGLADLKIADLVRDQPLIPQVQKMARFLMDRHPSHVEPLIRRWLGLRDHYSNA"
FT   gene            complement(311897..313264)
FT                   /gene="pssA"
FT                   /locus_tag="AHA_0285"
FT   CDS_pept        complement(311897..313264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="AHA_0285"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36857"
FT                   /db_xref="GOA:A0KEZ7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ7"
FT                   /protein_id="ABK36857.1"
FT                   /translation="MISGFSMHSSAHYRQLLARLPQIAVAADQFEVLNSAKDFKSRILS
FT                   LIASARQRIYLVALYLQDDEAGREILSALYAAKQRNPALDVKVFVDFHRAQRGLIGKGK
FT                   QGGNHLMYQEMAARHEHQIAIYGVPVKGRELLGVLHLKGFIFDDTLLYSGASLNDIYLH
FT                   QQDRYRFDRYHQITSPELTRSMVNYVDDLFLRSEAVQRLDRTDIPSAKQLKGPIRRFKH
FT                   NLRLGQYRFDTMPVNSQEVAITPMSGLGKRGNQLNKMIRTLVRATEREIFICTPYFNPP
FT                   KELNKDIEALLKRGCKVTIVVGDKTANDFFIPPEEKFSTIGGLPYLYETNLRKFAERNQ
FT                   HHIDAGRLNLMLWCCERNSYHLKGIFVDDEWALLTGNNLNPRAWALDLENGLLVYDRRH
FT                   LLRPQFNAERENILANTKRISHFDQIEQIQDYPDQVRKLLARIHRVKAHILLKRII"
FT   gene            complement(313393..314733)
FT                   /locus_tag="AHA_0286"
FT   CDS_pept        complement(313393..314733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0286"
FT                   /product="Low-affinity gluconate transporter"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39685"
FT                   /db_xref="GOA:A0KEZ8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ8"
FT                   /protein_id="ABK39685.1"
FT                   /translation="MSDLSLIMTAAGSIVLLLFLVMKARLHAVVSLILVSMVAGLAAGM
FT                   NPADIAATIQKGMGGTLGFVAVVVALGAMFGKVMEVTGALDRVAHTLLGTFGVKRANWA
FT                   MSLTGFICALPLFFDVAVVLLIGVAFAIVRRGGGSVVKIGIALLAGIATCQAFLIPAPG
FT                   PILVASQLGADFGYMILFGLIAAVPALILAGPLFGELISKVVDVPLPADAQSSAHDDGQ
FT                   NLPSFGLAMGLIGLPLLLIGLKTIVGRFVEAGTPLHGWLEFIGHPFTAIMVACLAAFYL
FT                   LGIRRGMSRDEVMNVCNSAIQPAGVIILVTGAGGVFKQILVDSGVGAALGNMLADSGLP
FT                   IVALAFILAAAVRVIQGSATVAMLTACGLVLPMLEPLGLNGAQLAAVTIAIGGGAIVLS
FT                   HVNDSGFWLANRYLGLTEKQTLQTWTVMETIIGTTGGVMAMIIYSFL"
FT   gene            314979..315488
FT                   /gene="aroK-1"
FT                   /locus_tag="AHA_0287"
FT   CDS_pept        314979..315488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK-1"
FT                   /locus_tag="AHA_0287"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202;
FT                   match to protein family HMM TIGR01313"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36291"
FT                   /db_xref="GOA:A0KEZ9"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ9"
FT                   /protein_id="ABK36291.1"
FT                   /translation="MAGKSIIVMGVCGSGKSSVGLKVASVLGAKFIDGDDLHPRANIQK
FT                   MAGGNPLNDEDRAPWLERIRDAAYSLEQKNEVGVIVCSALKKQYRDQIREGNESVSFLF
FT                   LDGSQPLILERMRARKGHFMRESMVQSQFDTLERPDGEAGVFHIDIDGTFEQVVDRAVT
FT                   ALEQAQ"
FT   gene            315485..317281
FT                   /gene="edd"
FT                   /locus_tag="AHA_0288"
FT   CDS_pept        315485..317281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="AHA_0288"
FT                   /product="phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR01196"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38540"
FT                   /db_xref="GOA:A0KF00"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF00"
FT                   /protein_id="ABK38540.1"
FT                   /translation="MIHQVISSVTARIRERSAARRQAFLARIQRQADQGKTRAALACGN
FT                   LAHAVAASSCDEKGRILDMTRANVGIVTAYNDMLSAHQPYQGYPDIIKAALAELGHSAQ
FT                   VAGGVPAMCDGVTQGQPGMDMSLFSRDLIAQATALSLSHNTFDATLLLGICDKIAPGQI
FT                   MGALSHAHLPTAFVPAGPMASGISNDEKVKVRQQYAAGEVGRDALLQMECGAYHAAGTC
FT                   TFYGTANTNQLVFEAMGLMLPGSAFVHPHSELRRALTEEAARRISAMIPGSPAYRPLSA
FT                   VIDERSLVNGLVALLASGGSTNHSIHMVALARAAGLHLTWDDISDLSDVVPLLVRMYPN
FT                   GPADVNAFEQAGGVPGLMRRLAEEGLIHLDATPVFGEMQDYLSRPALVDGQLVWQPVGE
FT                   SGDASVLSPSGSVFQATGGTKLLAGNLGRAVVKVSAVAPEYRVIEAPARVFSSQHAVEA
FT                   AYKAGDLNQDAVIVVRHNGPAANGMPELHKLMPVLGNLQKAGYKVALVTDGRLSGASGK
FT                   IPAAIHVTPEALHGGAIGLLADGDLLRVDAVNGSLDCLTDLSGRTQAEIDLTLEQEGWG
FT                   RELFSVMRRAVSSAECGATIFD"
FT   gene            317302..317943
FT                   /gene="eda"
FT                   /locus_tag="AHA_0289"
FT   CDS_pept        317302..317943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="AHA_0289"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38114"
FT                   /db_xref="GOA:A0KF01"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF01"
FT                   /protein_id="ABK38114.1"
FT                   /translation="MQNWKVTPAEVFAASPLVPVMVINELEQALPMAKALLDGGISVFE
FT                   ITLRTPVALEAIALIAKAMPDAMVGAGTVLNCAQFDAAVAAGARFVISPGMTPALLAHA
FT                   ANSTAPLIPGVATPSEVMQALEAGYDHLKFFPAEANGGTKALAAIAAPLPQVKFCPTGG
FT                   IGPKNVADYLALKCVATVGGSWMLPAEAVKNGNWEEVTRLSREAVALVAS"
FT   gene            complement(318041..319048)
FT                   /locus_tag="AHA_0290"
FT   CDS_pept        complement(318041..319048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0290"
FT                   /product="HTH-type transcriptional regulator GntR"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38542"
FT                   /db_xref="GOA:A0KF02"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF02"
FT                   /protein_id="ABK38542.1"
FT                   /translation="MNDTRKRRPTLQDIADLTGVTKMTVSRYLRDPQAVAEGTRERIAA
FT                   AVEELGYIPNRAPDILSNATSKAIGILIPSLSNQVFSAVVHGIESVTRPAGYQTLLAHY
FT                   GYSPEREEEQVASLLSYHVDGLILSDSQHTERTRKMIATAGIPVVETMDLPQSPIDMVV
FT                   GMDHRAAARAMVTEMLHRGRRKLVYLGARLDVRTQLRMEGYYQAMQDFGLSGQHLLTEQ
FT                   SSSFTLGGQLLEQALVRYPDLDGLFCTNDDLAVGALLQCQAKWIPVPQQIAIAGSNALD
FT                   IGHAMTPKLASIVTPRKEIGRAAATMLLARLNGQPLADTRLDMGFSLYEGDSLG"
FT   gene            319139..319789
FT                   /locus_tag="AHA_0291"
FT   CDS_pept        319139..319789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0291"
FT                   /product="Qnr"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38882"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="PDB:3PSS"
FT                   /db_xref="PDB:3PSZ"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF03"
FT                   /protein_id="ABK38882.1"
FT                   /translation="MIKDKCFEGVRFEQQDLEGEQFQGCRFIGCNFSWLDLAECRFVDC
FT                   SFYDRESEQSCLLQGCDLREASFLRCDLTMADCSRSQCLGLELRDCQALGINFSRASFA
FT                   NQITVKSYFCEAHLTGNNFSYANFEGCLLEQCELSGNRWQGANLFGASLAGSDLSGSEF
FT                   GQIDWASVNLQGCDLRQCDLPGLDLRRVNLDGVQINEDQQQALLEQIGLIVFP"
FT   gene            complement(319911..321221)
FT                   /gene="yibP"
FT                   /locus_tag="AHA_0292"
FT   CDS_pept        complement(319911..321221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibP"
FT                   /locus_tag="AHA_0292"
FT                   /product="nonpeptidase homolog, peptidase M23B family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39852"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF04"
FT                   /protein_id="ABK39852.1"
FT                   /translation="MRGCEVISTKTSRVGLLAGALFFCLSFGPATAWAANQQLGAMQSQ
FT                   IKEQQQTIKLSRQELAKLNTQLKADEQAISAAAAKLEQTKQQLRENQQKLVGLQQDKLD
FT                   LEQQASHQKQLLAKQAESAFTAGNHDYLKLLLNQQDPAKLSRSLDYYDYLNKARIEAIE
FT                   ALRATRTKLAKNQQATKETESRLQSLLSEQQQHHQSLLASQQSRAKVRNQLQQSVQDDE
FT                   QKLSKLVKAEKTLKARLEELRRQREEQERRERAERERLAKLKAEQERQRKLAEQRRAEQ
FT                   QQPTEEVASSKPERGSGISSAGYYSGLKTNGSLRWPVQGPILIAYGSPRTAELKWKGTL
FT                   IGASEGTQVKAVAPGQVVYADWLDGFGMLLVIDHGRGYMSLYGHNQSLLRQVGQNVEQG
FT                   EPVALVGDSGGQDRPGLYFEIRYQGEAINPTKWLAKR"
FT   gene            complement(321231..322955)
FT                   /gene="gpmI"
FT                   /locus_tag="AHA_0293"
FT   CDS_pept        complement(321231..322955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="AHA_0293"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM PF06415; match to protein
FT                   family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36201"
FT                   /db_xref="GOA:A0KF05"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF05"
FT                   /protein_id="ABK36201.1"
FT                   /translation="MAFGPLGRGFVEWCDKPATKKKQLGNSVRPPPDGAWLSGDYFGRC
FT                   SNITLVSLPAIHSYPRGHSLMSTAKKPLVLVIMDGWGYSTKQEHNAVAAAKTPNLDRLA
FT                   RDYTSTLISGSGLDVGLPDGQMGNSEVGHVNIGAGRIVYQELTRISKDIQDGDFFQNVE
FT                   LAKAVDAAVTKGKAVHIMGLMSPGGVHSHEEHIMGMIEMAAKRGAEQIYFHAFLDGRDV
FT                   PPRSAQSSIEQFDALFARLGKGRFASMIGRYYAMDRDNRWDRVQQAYDLMTQGKGEFTA
FT                   DSASEALAAAYARDENDEFVKATRIGAAAPMQDGDALIFMNFRADRAREITRAFVDSDF
FT                   TGFARTATPALNFVMLTEYAADIKTACAYPPTALVNTLGEWLAKQGKTQLRISETEKYA
FT                   HVTFFFNGGEEACFTGEDREIVASPKVATYDLQPEMSSEELTDKLVGAIKSGKYDVIIC
FT                   NYPNGDMVGHTGVFDAAVKACEAVDHCIGRVTDALAEVGGECLITADHGNAEKMMDEET
FT                   GQAHTAHTNLPVPLIYFGRKAEVAEGGKLSDLAPTMLTLMGLPVPPEMTGKPLMILK"
FT   gene            323086..323517
FT                   /locus_tag="AHA_0294"
FT   CDS_pept        323086..323517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0294"
FT                   /product="rhodanese domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36766"
FT                   /db_xref="GOA:A0KF06"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF06"
FT                   /protein_id="ABK36766.1"
FT                   /translation="MQEYLDFAARNPLLTAAWFGLAGTLVYTTVRARFSPVKSVNNHTA
FT                   TLLINRENATVVDIRSQEEFAKGHLAGAQHLPLSQIQSNNLGPVEKHKDAPIIVVCESG
FT                   MTAGGAGRQLSKAGFKQVYVLSGGMAQWRAENLPVTKKR"
FT   gene            323565..324035
FT                   /gene="secB"
FT                   /locus_tag="AHA_0295"
FT   CDS_pept        323565..324035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="AHA_0295"
FT                   /product="protein-export chaperone SecB"
FT                   /note="identified by similarity to SP:P15040; match to
FT                   protein family HMM PF02556; match to protein family HMM
FT                   TIGR00809"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37114"
FT                   /db_xref="GOA:A0KF07"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF07"
FT                   /protein_id="ABK37114.1"
FT                   /translation="MAEEINNQEVQPEFHIQRVYTKDVSFEAPNTPHIFQKEWQPDVKL
FT                   DMDTKTNILADSVYEVVLTLTVTCKLETETAFLCEVQQAGIFTIGNLPEPQLAHCLAAF
FT                   CPNILFPYAREAVSNLVSKGSFPQLNLAPVNFDALFAQHMAQAQAQQATAEA"
FT   gene            324038..325042
FT                   /locus_tag="AHA_0296"
FT   CDS_pept        324038..325042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0296"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)"
FT                   /EC_number="1.1.1.94"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF02558; match to protein
FT                   family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36018"
FT                   /db_xref="GOA:A0KF08"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF08"
FT                   /protein_id="ABK36018.1"
FT                   /translation="MADQIAISVLGAGSYGSALAISLARNGHPTLLWGHDPAHVAELEQ
FT                   DRCNKAFLPDVPFPADLQLTADLQQAVQAAPVLLLVVPSHVFGQVLAQVKPFLRPDTRI
FT                   AWATKGLEPDSGRLLQDVAREVLGDEMPLAVISGPTFAKELAAGLPTAISVASTHDDFA
FT                   DDLSLLLHCGRSFRVYTNPDFIGLQLGGAVKNVIAIGAGLSDGLGFGANARTALITRGL
FT                   VEMQRLGAALGADAKTFMGMAGLGDLVLTCTDNQSRNRRFGLALGAGKDVNTAMAEIGQ
FT                   VVEGYRNTKEVHLLAARCGVEMPICEQIFKVLYEGKNPKEAAIALLSRDKKDE"
FT   gene            complement(325126..325704)
FT                   /gene="gntY"
FT                   /locus_tag="AHA_0297"
FT   CDS_pept        complement(325126..325704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntY"
FT                   /locus_tag="AHA_0297"
FT                   /product="protein GntY"
FT                   /note="identified by similarity to SP:P63020; match to
FT                   protein family HMM PF01106; match to protein family HMM
FT                   PF01521"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38584"
FT                   /db_xref="GOA:A0KF09"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF09"
FT                   /protein_id="ABK38584.1"
FT                   /translation="MISISDTAQAHFRKLLEKQPDGTNIRVFVVNPGTQNAECGVSYCP
FT                   PDAVDPEDQHLPFSGFDCLVDPLSAPFLVDATIDFVTDQMGSQLTLKAPNAKMRKVADD
FT                   APLIDRIEYVLMSEVNPMLAGHGGKVTLVELTEDKLAILQFGGGCNGCSMVDYTLKEGI
FT                   EKQLLEKFPGELNGVKDATEHQRGDHSYY"
FT   gene            complement(325785..326513)
FT                   /locus_tag="AHA_0298"
FT   CDS_pept        complement(325785..326513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0298"
FT                   /product="comF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36883"
FT                   /db_xref="GOA:A0KF10"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF10"
FT                   /protein_id="ABK36883.1"
FT                   /translation="MLKRLLAKASPILGRHADWQGNCLLCQQPCDVDPLLCSWCRQALQ
FT                   QADHTCRLCAAPLPAMHEERLPICGRCQRRPPPWERLQVIGDYRPPYPMLIPRLKYSGQ
FT                   ILLAPLLARLLADHLDLSDPPEAIIPVPLHWWRQWWRGFNQAEEIALTLSELTAIPCNN
FT                   RLLRRVRATAQQTKLSAGQRRRNLRGAFQIRPHAYQHVALLDDVVTTGATAGHLTRLLH
FT                   ESGVTKVEVWAVCRTLKHLK"
FT   gene            326550..327314
FT                   /gene="bioH"
FT                   /locus_tag="AHA_0299"
FT   CDS_pept        326550..327314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="AHA_0299"
FT                   /product="putative pimeloyl-BioC--CoA transferase BioH"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01738"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36065"
FT                   /db_xref="GOA:A0KF11"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF11"
FT                   /protein_id="ABK36065.1"
FT                   /translation="MSVSVERFGQGPDLVLLHGWGMNGAVWHGIVPALASRYRVHLVDL
FT                   PGFGNSPLAGEVEYSLPWLAEEVAAILPEQCHLLGWSLGGLVASQLALSHPERLHSLIT
FT                   VASSPCFMARDEWPGIAPKVLAGFNQMLAGDFKQTIERFLAIQAMGSEHARDDIRQLRH
FT                   WLAERPAPQLAALEAGLGLLAEVDLRDELTPLSLPWLRVYGRLDSLVPKASIPLLDERY
FT                   PSSRSVVLEKASHAPFISHPQQFIEIIEHFVG"
FT   gene            327386..327619
FT                   /locus_tag="AHA_0300"
FT   CDS_pept        327386..327619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0300"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="identified by match to protein family HMM PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37860"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF12"
FT                   /protein_id="ABK37860.1"
FT                   /translation="MRIDSALNSGVQGFQRAEQIADKASSQIARLNTPSGDKVQLPEEL
FT                   VNLKSAEVQAGASAKVIQTASDMMGTLIDIRV"
FT   gene            327621..328418
FT                   /locus_tag="AHA_0301"
FT   CDS_pept        327621..328418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36489"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF13"
FT                   /protein_id="ABK36489.1"
FT                   /translation="MNINVSLPTIIPNQLQPQTESARTDNRRAALIPQSRQSEAFNAES
FT                   EVGSQKEKSRASQANPNQTSQQARDGAQTSNPQAAIDNRFVEAAGEDGQRNKQQDPKQQ
FT                   EQQQKQELQVKELADRDQEVRTHEQAHQSTGGQYAGSPTYEFAMGPDGKRYATGGGVSI
FT                   DIGTIPGDPRATIAKMQQVRAAALAPAEPSSQDLSVARSAAAKEAQARKALLSSDPDTA
FT                   LAADGSAKTGVLNGYMEQRNQVIAQRYQQAVKPAAQQNLNLSV"
FT   gene            328514..328792
FT                   /locus_tag="AHA_0302"
FT   CDS_pept        328514..328792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36105"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF14"
FT                   /protein_id="ABK36105.1"
FT                   /translation="MHFDEVKPEDFATFSRVPPPHLQMEQFLMQLGGGGTEGTHFKKKV
FT                   MLAAGWSHTGVVSYGKYPQEACKAFNRLREVLAAHREADAILAALAQ"
FT   gene            complement(328848..331352)
FT                   /locus_tag="AHA_0303"
FT   CDS_pept        complement(328848..331352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0303"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39420"
FT                   /db_xref="GOA:A0KF15"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF15"
FT                   /protein_id="ABK39420.1"
FT                   /translation="MTSVVFAGVASRCPTPYSAHTRRLAAPTGPRGSGPAGTLSTARTD
FT                   PLPGDIASRLPVDQDPTKRPSMQSHVIEHQIAGELNARPEQVQAAVRLLDEGATVPFIA
FT                   RYRKEVTGGLDDSQLRTLESRLGYLRELADRRQVILRSIEEQGKLTPELARELNDADSK
FT                   TRLEDLYLPYKPKRRTKGQMAIEAGLEPLADLLLSDPLKDPEQEAVRFLNAEQGITDGK
FT                   AALDGARYILMERFAEQADLLEKLRDYLWHNATLRARVVTGKEQEGAKFKDYFEHDEPL
FT                   HKAPSHRVLAMLRGRNEGVLNLALVAGDDEGASPCEGIIAHHLKLNLQNRPADKWLQGV
FT                   VSWTWKIKLSLQMETELIGRIRESAEDEAIKVFAMNLKDLLMAAPAGMRCTMGLDPGIR
FT                   TGVKVAVVDATGKLVDHATIYPFEPKRQVDQSLKTLSELCQKHRVELISIGNGTASRET
FT                   DRLVSDLFERYPAAKAQKIVVSEAGASVYSASELASQEFPDLDVSIRGAVSIARRLQDP
FT                   LAELVKIDPKSIGVGQYQHDVGQSQLARRLDAVVEDCVNAVGVDVNTASVALLNRVSGL
FT                   SQTLAQNIVAYRDENGAFQHRQQLLKVSRLGPKAFEQCAGFLRIRGGSNPLDGSAVHPE
FT                   SYPVVERILAKLEQTVDSLLGNSSLLRTLKPTDYTDEQFGVPTVTDIIGELDKPGRDPR
FT                   PEFKTATFKEGVEKISDLVPEMVLEGVVTNVTNFGAFVDIGVHQDGLVHISSLTDRFVK
FT                   DPREVVKAGDIVRVKVLEVDVPRKRISLTMRLDEKAGQPARKPAEPRHTGNAKPKQAPR
FT                   QSPPADGAMGNAFAAALSKLKK"
FT   gene            complement(331424..331897)
FT                   /gene="greB"
FT                   /locus_tag="AHA_0304"
FT   CDS_pept        complement(331424..331897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="AHA_0304"
FT                   /product="transcription elongation factor GreB"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01461"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39100"
FT                   /db_xref="GOA:A0KF16"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF16"
FT                   /protein_id="ABK39100.1"
FT                   /translation="MKTKLITREGYNKLKQELDFLWREERPETTRKVAWAASLGDRSEN
FT                   ADYQYNKKRLREIDRRVRYLRKCLEELGIVDYSPAQEGKVFFGAWVEVENEEGETKRFR
FT                   IVGYDEIFERKDYISIDSPMARALLKKEVGDEAIVRTPVGDACWYINEISYPK"
FT   gene            332134..332853
FT                   /locus_tag="AHA_0305"
FT   CDS_pept        332134..332853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0305"
FT                   /product="transcriptional regulator OmpR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36582"
FT                   /db_xref="GOA:A0KF17"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF17"
FT                   /protein_id="ABK36582.1"
FT                   /translation="MSQQYKVLVVDDDLKLRSLLERYLTEQGFVVRGVANGEQADRLLT
FT                   RENFSLMVLDLMLPGEDGLSICRRLREAGNQIPVLMLTAKGDEVDRIVGLEMGADDYLP
FT                   KPFNPRELLARIRAVLRRHTVELPGAPSTAEKVVSFGSYQLNLATRELSRDGDPVALTS
FT                   GEFAVLKVLVSHPREPLSRDKLMNLARGREYTATERSIDVQVSRLRRLLEQDPAQPRYL
FT                   QTVWGLGYVFVPDGDCE"
FT   gene            332859..334160
FT                   /gene="envZ"
FT                   /locus_tag="AHA_0306"
FT   CDS_pept        332859..334160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="AHA_0306"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to SP:P02933; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35998"
FT                   /db_xref="GOA:A0KF18"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF18"
FT                   /protein_id="ABK35998.1"
FT                   /translation="MSSMFSRMLWFLAAVLVVYQFVSYATFYNYLLAPTVKQISHLLAN
FT                   QVKLIFPVESNQLALSEDAEALVYVATGSDIYTQTEAEQHGLNESKPYTYLEESISREL
FT                   GGKTKVRVEIQDHYIIWIQPPQANKVWVRIPLTEIEDDDIEPLILYMSVLLVVTLFAAW
FT                   RFARQLVRPLEDLEAGAVAVARGNFPDALGEQGSREVRRLTRTFNHMSSSIKGLIEERN
FT                   LMMAGVSHDLRTPLTRIRLATEMMSSGDEYLKESINADIDESNGIIDQFIDYIRPDEGL
FT                   DTQQIDLTQLIHDSLLVQTDQGLEVELELPAEAVRVACNPISIRRILNNLSGNSLRYGA
FT                   SRLQAELKDDGHWVRLRLSDDGPGIPEQDYYRVLKPFTQGNEARTGSGSGLGLAIVAKI
FT                   VSQHHGTIRLGRSELGGLLVEIRLPKNQPLEWID"
FT   gene            complement(334196..335110)
FT                   /locus_tag="AHA_0307"
FT   CDS_pept        complement(334196..335110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0307"
FT                   /product="transporter, drug/metabolite exporter family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39823"
FT                   /db_xref="GOA:A0KF19"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF19"
FT                   /protein_id="ABK39823.1"
FT                   /translation="MLKDQKKAYQYGLCAVALWSTVASAFKISLAYFEPVQLLLVAACT
FT                   STLTLGVIVACQGKLPLLLGYIKSRPLYYLALGVLNPFFYYLLLFKAYDLLPAQQAQTL
FT                   NYTWAITLSLLAVPFLGQKLRRRDGVAIVLGYFGALVIATRGDVFGLQFDSPLGVTLAL
FT                   VSTLIWAGYWILNTRNQGDPIVSLLLGFLISLPFIVAATWLLSDFSMTAWQGWAGAIYV
FT                   GLFEMGFGFVLWLMALRHATNTAPISNLIFISPFASLVLLNLLIGETIHPATPIGLALI
FT                   VAALLIQQLKYGRRYRKTSEPQA"
FT   gene            335374..335778
FT                   /gene="rpsJ"
FT                   /locus_tag="AHA_0308"
FT   CDS_pept        335374..335778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="AHA_0308"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39221"
FT                   /db_xref="GOA:A0KF20"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF20"
FT                   /protein_id="ABK39221.1"
FT                   /translation="MGGNVKNHTSGGSNLGRAVLIYVLLSIGALSMQNQRIRIRLKAFD
FT                   HRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHKRL
FT                   VDIVEPTDKTVDALMRLDLAAGVDVQISLG"
FT   gene            335801..336433
FT                   /gene="rplC"
FT                   /locus_tag="AHA_0309"
FT   CDS_pept        335801..336433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="AHA_0309"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37830"
FT                   /db_xref="GOA:A0KF21"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF21"
FT                   /protein_id="ABK37830.1"
FT                   /translation="MTIGLVGRKVGMTRIFTEDGVSIPVTVIEVEANRVTQVKSVETDG
FT                   YNAIQVTTGAKKASRVTKPEAGHFAKAGVEAGRGLWEFRLNNGETFTVGSELKVDLLAD
FT                   VKLVDVTGTSKGKGFAGTVKRWNFRTQDMTHGNSLSHRVPGSIGQNQTPGRVFKGKKMA
FT                   GHMGAERVTTQNLELVRVDAERNLLLIKGAVPGATNGNVIVKPAVKA"
FT   gene            336451..337056
FT                   /gene="rplD"
FT                   /locus_tag="AHA_0310"
FT   CDS_pept        336451..337056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="AHA_0310"
FT                   /product="ribosomal protein L4/L1 family"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37119"
FT                   /db_xref="GOA:A0KF22"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF22"
FT                   /protein_id="ABK37119.1"
FT                   /translation="MELVMKDAKSALEVSETTFGREFNEALVHQVVVAYAAGARQGTRA
FT                   QLTRSEVSGGGKKPWRQKGTGRARAGSIRSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   IRSILSELVRQERLIVVEKFGIEAPKTKELIAKLKEMELTDVLIVTAEVDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVLMTADAVKQIEEMLA"
FT   gene            337053..337355
FT                   /gene="rplW"
FT                   /locus_tag="AHA_0311"
FT   CDS_pept        337053..337355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="AHA_0311"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36693"
FT                   /db_xref="GOA:A0KF23"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF23"
FT                   /protein_id="ABK36693.1"
FT                   /translation="MIREERLLKVLKAPHISEKSTMVAEKQNTIVFKVAVDATKAEVKA
FT                   AVAKLFEVEVETVRTLNMKGKTKRAGARVGRRSDWKKAYVTLKAGQDIDFMGAAE"
FT   gene            337371..338192
FT                   /gene="rplB"
FT                   /locus_tag="AHA_0312"
FT   CDS_pept        337371..338192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="AHA_0312"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36495"
FT                   /db_xref="GOA:A0KF24"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF24"
FT                   /protein_id="ABK36495.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKIVNQDLYKGKPFAALLDKKDKSGGRNN
FT                   NGRITTRHIGGGHKQHYRIVDFKRDKDGIPAKVERLEYDPNRTANIALVLYADGERRYI
FT                   LAPKGLKAGDAIASGADAAIKVGNTLPMRNIPVGSTVHAVEMKPGKGAQLARSAGTFIQ
FT                   ILAREGNYVTLRLRSGEVRKVLAECRATIGEVGNSEHMLRQLGKAGANRWRGIRPTVRG
FT                   MAMNPVDHPHGGGEGRNKGMQPVSPWGQKAKGFKTRKNKRTDKYIVRRRNK"
FT   gene            338215..338493
FT                   /gene="rpsS"
FT                   /locus_tag="AHA_0313"
FT   CDS_pept        338215..338493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="AHA_0313"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39570"
FT                   /db_xref="GOA:A0KF25"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF25"
FT                   /protein_id="ABK39570.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPVKTWSRRSMIIPNMI
FT                   GLTIAVHNGRQHVPVFVTEEMIGHKLGEFAPTRTYRGHAADKKAKKR"
FT   gene            338504..338848
FT                   /gene="rplV"
FT                   /locus_tag="AHA_0314"
FT   CDS_pept        338504..338848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="AHA_0314"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38894"
FT                   /db_xref="GOA:A0KF26"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF26"
FT                   /protein_id="ABK38894.1"
FT                   /translation="MEAIAKHRYARTSAQKARLVADQVRGLSVDKALNILTFSPKKAAA
FT                   LVKKVLESAIANAEHNEGADIDALRVATIMVDEGPSMKRIRPRAKGRADRILKRTAHIT
FT                   VVVSDAKAGR"
FT   gene            338852..339565
FT                   /gene="rpsC"
FT                   /locus_tag="AHA_0315"
FT   CDS_pept        338852..339565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="AHA_0315"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38458"
FT                   /db_xref="GOA:A0KF27"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF27"
FT                   /protein_id="ABK38458.1"
FT                   /translation="MGQKVHPNGIRLGITKPWNSTWFANTKDFADNLYSDFQVRQFLTK
FT                   ELKNASLSKITIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRKAVAAIAGVPAQINIS
FT                   EVRKPELDGKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEAHTTYGVIGVKVWIFKGEVLGGLAAVNAAAAQEQ
FT                   APAKPKRDNKRRAAK"
FT   gene            339579..339992
FT                   /gene="rplP"
FT                   /locus_tag="AHA_0316"
FT   CDS_pept        339579..339992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="AHA_0316"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37882"
FT                   /db_xref="GOA:A0KF28"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF28"
FT                   /protein_id="ABK37882.1"
FT                   /translation="MLQPKRTKFRKTHKGRNRGLANSGNEVSFGTFGLKATSRGQLTAR
FT                   QIEAARRAMTRHVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVCPIQPGKVLY
FT                   EMDGVPEALAREAFALAAAKLSVQTTFVIKTVM"
FT   gene            339989..340183
FT                   /gene="rpmC"
FT                   /locus_tag="AHA_0317"
FT   CDS_pept        339989..340183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="AHA_0317"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39526"
FT                   /db_xref="GOA:A0KF29"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF29"
FT                   /protein_id="ABK39526.1"
FT                   /translation="MMKAQDLRQKSVEELNQELLGLLREQFNMRMQASTGQLAQTHTLK
FT                   QVRRDVARIKTVLTEKAGA"
FT   gene            340183..340431
FT                   /gene="rpsQ"
FT                   /locus_tag="AHA_0318"
FT   CDS_pept        340183..340431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="AHA_0318"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36645"
FT                   /db_xref="GOA:A0KF30"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF30"
FT                   /protein_id="ABK36645.1"
FT                   /translation="MTDKIRTLQGRVISDKMDKSITVAIERKVKHPIYGKIIKRTTKLH
FT                   VHDENNECKAGDLVEIRECRPLSKTKSWTLVAVVEKA"
FT   gene            340579..340947
FT                   /gene="rplN"
FT                   /locus_tag="AHA_0319"
FT   CDS_pept        340579..340947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="AHA_0319"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38629"
FT                   /db_xref="GOA:A0KF31"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF31"
FT                   /protein_id="ABK38629.1"
FT                   /translation="MIQMQSMLGVADNSGARSVMCIKVLGGSHRRYAGIGDIIKVSIKE
FT                   AIPRGKVKKGDVYNAVVVRTRKGVRRPDGSVIRFDNNAAVLLNNNQQPIGTRIFGPVTR
FT                   ELRNEKFMKIVSLAPEVL"
FT   gene            340959..341276
FT                   /gene="rplX"
FT                   /locus_tag="AHA_0320"
FT   CDS_pept        340959..341276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="AHA_0320"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37026"
FT                   /db_xref="GOA:A0KF32"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF32"
FT                   /protein_id="ABK37026.1"
FT                   /translation="MAAKIRREDEVIVLTGKDKGKRGKVTQVLIAKGKVIVEGINQVKK
FT                   HQKPVPALGQAGGIVTKEAPIDVSNVALFNSATGKADRVGFRIEDGKKVRFFKSTGELV
FT                   K"
FT   gene            341290..341829
FT                   /locus_tag="AHA_0321"
FT   CDS_pept        341290..341829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0321"
FT                   /product="50S ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37523"
FT                   /db_xref="GOA:A0KF33"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF33"
FT                   /protein_id="ABK37523.1"
FT                   /translation="MAKLHDYYKSDVVNELSKQFGYKTIMQVPRIEKITLNMGVGEAIS
FT                   DKKLLENAAADMAAISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWEFLERLI
FT                   CISVPRIRDFRGLNAKAFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTSANTD
FT                   EEGRALLAAFNFPFRK"
FT   gene            341840..342145
FT                   /locus_tag="AHA_0322"
FT   CDS_pept        341840..342145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0322"
FT                   /product="30S ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36422"
FT                   /db_xref="GOA:A0KF34"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF34"
FT                   /protein_id="ABK36422.1"
FT                   /translation="MAKTSMKAREAKRAKLVAKFASKRTELKAIIVDMNASEEARWDAV
FT                   LQLQQLPRDSSPSRQRNRCNITGRPHGFLRKFGLSRIKVREHAMKGEIPGLKKASW"
FT   gene            342167..342559
FT                   /gene="rpsH"
FT                   /locus_tag="AHA_0323"
FT   CDS_pept        342167..342559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="AHA_0323"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36961"
FT                   /db_xref="GOA:A0KF35"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF35"
FT                   /protein_id="ABK36961.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAASKVAVSMPSSKLKVAIAKVLKEEGY
FT                   ITGYSVAGDVKPELEIELKYFQGKPVVELIQRVSRPGLRIYKRTTDLPKVMGGLGVAIV
FT                   STSKGVMTDRAARKASMGGEIICYVA"
FT   gene            342573..343106
FT                   /locus_tag="AHA_0324"
FT   CDS_pept        342573..343106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0324"
FT                   /product="50S ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39433"
FT                   /db_xref="GOA:A0KF36"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF36"
FT                   /protein_id="ABK39433.1"
FT                   /translation="MSRVAKAPVTIPAGVEVTLNGQELSIKGGKGSLVRSIHAGVEVTK
FT                   EDNVLKFAPRDGIAGADAQAGTARALVNNMVIGVTQGFERKLQLVGVGYKASIKGNAVA
FT                   LALGFSHPVEHALPAGVTAECPTATEIVLRGVDKQLVGQVAADIRAYRAPEPYKGKGVR
FT                   YANEQVRTKEAKKK"
FT   gene            343116..343469
FT                   /gene="rplR"
FT                   /locus_tag="AHA_0325"
FT   CDS_pept        343116..343469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="AHA_0325"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39842"
FT                   /db_xref="GOA:A0KF37"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF37"
FT                   /protein_id="ABK39842.1"
FT                   /translation="MDKKAARLRRATRARKKMQELGATRLVVHRTPRHIYAQVIAANGS
FT                   EVLASASTVEKAISEAIKYTGNADAATAVGKAIAERAIAKGVQNVSFDRSGFKYHGRIA
FT                   ALAAAARDAGLQF"
FT   gene            343484..343984
FT                   /gene="rpsE"
FT                   /locus_tag="AHA_0326"
FT   CDS_pept        343484..343984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="AHA_0326"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39378"
FT                   /db_xref="GOA:A0KF38"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF38"
FT                   /protein_id="ABK39378.1"
FT                   /translation="MAKVESQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGR
FT                   VGYGYGKAREVPAAIQKAMEQAKRNLNKVELNNGTLHHPVRGVHSGSTVFMKPASQGTG
FT                   IIAGGAMRAVLEVAGIHNVLAKTYGSTNPINVVRATVDALVQGQSPAQIAAKRGLRVEE
FT                   ILG"
FT   gene            343991..344170
FT                   /gene="rpmD"
FT                   /locus_tag="AHA_0327"
FT   CDS_pept        343991..344170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="AHA_0327"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39681"
FT                   /db_xref="GOA:A0KF39"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF39"
FT                   /protein_id="ABK39681.1"
FT                   /translation="MANTVKVTQTRSSIGRLPKHKATLRGLGLRRIGHTVELEDTPCVR
FT                   GMINQVYYMVKVEG"
FT   gene            344173..344610
FT                   /gene="rplO"
FT                   /locus_tag="AHA_0328"
FT   CDS_pept        344173..344610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="AHA_0328"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35971"
FT                   /db_xref="GOA:A0KF40"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF40"
FT                   /protein_id="ABK35971.1"
FT                   /translation="MRLNTLSPAAGSKRVKHRPGRGIGSGLGKTGGRGVKGQTSRSGGG
FT                   KVRNGFEGGQMPLKIRLPKFGFFSRKSLVSAEVRLNEIALVEGDVVDVSTLKQAGVITK
FT                   NIVFAKVVLSGNIDRAVTVRGLSVTKGARAAIEAAGGKIEE"
FT   gene            344619..345947
FT                   /gene="secY"
FT                   /locus_tag="AHA_0329"
FT   CDS_pept        344619..345947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="AHA_0329"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by similarity to SP:P03844; match to
FT                   protein family HMM PF00344; match to protein family HMM
FT                   TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39412"
FT                   /db_xref="GOA:A0KF41"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF41"
FT                   /protein_id="ABK39412.1"
FT                   /translation="MAKKPGLDVKAQGGLSELKSRLLFVLGAIIVFRAGSYVPIPGIDA
FT                   AVLAELFQQQKGTIIEMFNMFSGGALSRASILALGIMPYISASIIIQLLTVVHPALAEL
FT                   KKEGESGRRKISQYTRWGTLVLGTFQAIGIATGLPNMMQGLVTHPGLGFYFTAVVSLVT
FT                   GTMFLMWLGEQITERGIGNGISLIIFTGIVAGLPHAIGATAEQARQGELHILLLLLLGL
FT                   IVFAVTYFVVFVERGQRRIVVNYAKRQQGRQVFAAQSTHLPLKVNMAGVIPAIFASSII
FT                   LFPGTITSWFGQGEGKIADILQQVSMVLQPGQPLYEMLYAAAIIFFCFFYTALVFNPRE
FT                   TADNLKKSGAFIPGIRPGEQTARYIDKVMTRLTLAGALYITFICLVPQFLMTAWNVQFY
FT                   FGGTSLLIIVVVIMDFMAQVQTHMMSHQYGDVLRKANLKGYGR"
FT   gene            346228..346584
FT                   /gene="rpsM"
FT                   /locus_tag="AHA_0330"
FT   CDS_pept        346228..346584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="AHA_0330"
FT                   /product="ribosomal protein S13p/S18e"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38153"
FT                   /db_xref="GOA:A0KF42"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF42"
FT                   /protein_id="ABK38153.1"
FT                   /translation="MARIAGINIPDHKHAVIALTAIYGVGRTRSKAICAAAGIAENVKI
FT                   KDLDEAQIESLREQVGKFTVEGDLRRQISMNIKRLMDLGCYRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKAIKK"
FT   gene            346599..346988
FT                   /gene="rpsK"
FT                   /locus_tag="AHA_0331"
FT   CDS_pept        346599..346988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="AHA_0331"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38687"
FT                   /db_xref="GOA:A0KF43"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF43"
FT                   /protein_id="ABK38687.1"
FT                   /translation="MAKTPTRARKRVKKQVSDGIAHVHASFNNTIVTITDRQGNALSWA
FT                   TSGGSGFRGSRKSTPFAAQVAAERAGEIAKEYGVKNLEVMVKGPGPGRESSIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            347028..347648
FT                   /gene="rpsD"
FT                   /locus_tag="AHA_0332"
FT   CDS_pept        347028..347648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="AHA_0332"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36993"
FT                   /db_xref="GOA:A0KF44"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF44"
FT                   /protein_id="ABK36993.1"
FT                   /translation="MARYIGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTVPGQHGARK
FT                   ARLSDYGVQLREKQKVRRIYGVLEKQFRNYYRDAARQKGNTGENLLQLLEGRLDNVVYR
FT                   MGFGATRAESRQLVSHKAIMVNGRVVNIPSFQVSPEDVICVREKAKKQARIKASLEVAG
FT                   QREKPTWVEVDAAKMEGAFKRLPERSDLSADINEQLIVELYSK"
FT   gene            347674..348663
FT                   /gene="rpoA"
FT                   /locus_tag="AHA_0333"
FT   CDS_pept        347674..348663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="AHA_0333"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37601"
FT                   /db_xref="GOA:A0KF45"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF45"
FT                   /protein_id="ABK37601.1"
FT                   /translation="MLGSVTDFLKPRLVDIEQVSPTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEILLNLKGIAVKLEGKDEVTLSLTK
FT                   SGTGPVTAGDITHGDEVEIVNPEHVICHLTGANAEISMRLKVQRGRGYVPASARVHNDD
FT                   EERPIGRLLLDSAFSPIVRIAYNVEAARVEQRTDLDKLVIDMETNGTLDPEEAIRRSAT
FT                   ILAEQLEAFVDLRDVSVPEKKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   gene            348707..349090
FT                   /gene="rplQ"
FT                   /locus_tag="AHA_0334"
FT   CDS_pept        348707..349090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="AHA_0334"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35840"
FT                   /db_xref="GOA:A0KF46"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF46"
FT                   /protein_id="ABK35840.1"
FT                   /translation="MRHRLSGRQLNRNSSHRQAMFRNMASSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNAIVAKLFNELGPRYLERAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPAAAEAAAE"
FT   gene            349952..351488
FT                   /gene="rrsD"
FT                   /locus_tag="AHA_0335"
FT   rRNA            349952..351488
FT                   /gene="rrsD"
FT                   /locus_tag="AHA_0335"
FT                   /product="16S ribosomal RNA"
FT   gene            351690..351765
FT                   /locus_tag="AHA_0336"
FT   tRNA            351690..351765
FT                   /locus_tag="AHA_0336"
FT                   /product="tRNA-Glu"
FT   gene            351994..354889
FT                   /gene="rrlD"
FT                   /locus_tag="AHA_0337"
FT   rRNA            351994..354889
FT                   /gene="rrlD"
FT                   /locus_tag="AHA_0337"
FT                   /product="23S ribosomal RNA"
FT   gene            354966..355083
FT                   /gene="rrfD"
FT                   /locus_tag="AHA_0338"
FT   rRNA            354966..355083
FT                   /gene="rrfD"
FT                   /locus_tag="AHA_0338"
FT                   /product="5S ribosomal RNA"
FT   gene            355180..355256
FT                   /locus_tag="AHA_0339"
FT   tRNA            355180..355256
FT                   /locus_tag="AHA_0339"
FT                   /product="tRNA-Asp"
FT   gene            complement(356544..357545)
FT                   /locus_tag="AHA_0340"
FT   CDS_pept        complement(356544..357545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0340"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36485"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF47"
FT                   /protein_id="ABK36485.1"
FT                   /translation="MKACTMSKKLLRQLTLARCIPHRPYKLTASQLQVKLEEEGIHVSL
FT                   RTVQRDLEEMSGMGLFDLTSDERSKPHGWCFERHGLNDFANIMPLSLAVALKTWSDQAS
FT                   QLLPASVLTELNPLVDKASQVIRDSQSELAERWLESVHQSPRPFAGNPEIRRSTLIRDA
FT                   LWRGRKFSAEIQRVIKERTVWLCYDRINPLGILNQAEGPTLLCTLSELDPKVYGIPFDH
FT                   IKNVELTNFSATQPKDFNIQKLIRDQGYQDVSGPIRFVGRIDANCPTLVDGQIPGHNPR
FT                   MTRYDKRSVVVETEVQDTPEFRTWLNNMSGNLEVLAPESLRKAYPTPGSRVS"
FT   gene            complement(357834..358220)
FT                   /locus_tag="AHA_0341"
FT   CDS_pept        complement(357834..358220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0341"
FT                   /product="SirB family protein"
FT                   /note="identified by match to protein family HMM PF04247"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36429"
FT                   /db_xref="GOA:A0KF48"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF48"
FT                   /protein_id="ABK36429.1"
FT                   /translation="MIAYYPMLKHLHMTLALVSVLLFLYRWLLALGGSPRLQQKWLKIL
FT                   PHVNDTFLLLFGVLLAVTLQMSPGQQPWLMAKLIALVVYIGLGVMALKRPARSQKLVAG
FT                   LAALAVFGYMVGAAITKSALSWLA"
FT   gene            complement(358217..360073)
FT                   /gene="kefB"
FT                   /locus_tag="AHA_0342"
FT   CDS_pept        complement(358217..360073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="AHA_0342"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefB"
FT                   /note="identified by similarity to SP:P45522; match to
FT                   protein family HMM PF00999; match to protein family HMM
FT                   PF02254; match to protein family HMM TIGR00932"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39466"
FT                   /db_xref="GOA:A0KF49"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF49"
FT                   /protein_id="ABK39466.1"
FT                   /translation="MGHGLLFDAFIYLSAAVIAVPLAKRWGLGSVLGYLLAGIIIGPFL
FT                   LGLVGEQKDVMHFAEFGVVLMLFLVGLELRPALLWQLKGPILGTGGLQVLLTTAALTGV
FT                   AHLIGLPWQQGLAIGLILALSSTAIVLQSLQERKLMQSESGRSAFAVLLFQDIAVIPIL
FT                   AILPLLAIAPVASSGSSELAGWQHGLLVVAAISGIVLGGHYLMRPVFRAIAQSHMREIF
FT                   VAAALLLVIAIAVLMESVGLSPALGSFLAGVVLADSEYRHELEADIEPFKGLLLGLFFM
FT                   SVGAGINFGLFAEHPLLIPTLVVGLMVLKWLVLMALGFAIRISPSQRWTFGLALAQGGE
FT                   FAFVLFSFAAQNKVLPGDTIALLTLVVALSMALTPLLLILNDRVIQPWFDYRNQSELPQ
FT                   HEQPELVEHPVIIAGFGRFGQIVGRLLHGHGIGTTILEQDASQIEMLRKYGYQVFYGDA
FT                   SRLDLLHAAGAHKAKLLVLSINDPATSLEVIEMVKKHFPHLKILARAQDRPHAHEILRQ
FT                   GVGSVYRETLGSAVDLGVEALTQLGFRANQAWRAGQTFKQHDNWLLREQVNYLDDEHTY
FT                   INKSLQYRDILSDLLQDDQEGQERIHAHNWNSGLPDNDKEAI"
FT   gene            complement(360144..360824)
FT                   /locus_tag="AHA_0343"
FT   CDS_pept        complement(360144..360824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0343"
FT                   /product="modulator of glutathione-dependent potassium
FT                   efflux system"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39135"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF50"
FT                   /protein_id="ABK39135.1"
FT                   /translation="MITSLLNASFFRRSLASVFGPSSDQEPMKRILVIFSHPALQSSRA
FT                   NKQLLQAIDGLEGVTLHDLYQHYPNMFINVKREQALLSEHDIIVFQHPFYWYSCPAIMK
FT                   EWMDLVLEYGYAYGPEAHALNGKQWLSAITTGGAPESYCSEGYNQRPLLDFLLPFRQTA
FT                   QLCGMSWLPPFVLHSFHKIRDQEALRRCGQDYRQLLCALRDEQLTPAQLAGSPYLRDLL
FT                   EVLS"
FT   gene            complement(360821..361717)
FT                   /locus_tag="AHA_0344"
FT   CDS_pept        complement(360821..361717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0344"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37804"
FT                   /db_xref="GOA:A0KF51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF51"
FT                   /protein_id="ABK37804.1"
FT                   /translation="MINIVFRWLSSEKTMVGLMLDLRLLRFFIAIYEEKNITAAAERCH
FT                   VSQPSLSAGLRQLEETLGDSLFIRGKKGVAARDQAHYLYPHAVKLVEEARRLPALFRQK
FT                   ATRARLNMAIMPDLSRRRVAGLLQQVQAVLPELDLTLSDYGTPADCRLTLDALRREDEI
FT                   FLPLWEEDYVLCVRRDHPLASRQQLELAELQHYDFIECPPCEAHQQTIGLLACDRLTLN
FT                   LVAKAESKGLVMALVLAGVGISFLPDGLVEDEAGLCTVPVRGPRMFRRIGLCYPAHQTL
FT                   NPALRELIPELASHGAS"
FT   gene            361687..362529
FT                   /locus_tag="AHA_0345"
FT   CDS_pept        361687..362529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0345"
FT                   /product="clavaldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35843"
FT                   /db_xref="GOA:A0KF52"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF52"
FT                   /protein_id="ABK35843.1"
FT                   /translation="MITSGKQYLSLMDAVTIVIPFRAGQPLVCSNRLLNQKENIMSKPL
FT                   VVITGASAGIGAAIARAFSAAGHPLLLLARRVEPMQALALPDTLCIGVDVTDTAAMKAA
FT                   IKQAEAQFGPVGCLVNNAGVMLLGQADVQDPAEWQQMLNINVMGVLNGVHAVLAGMKAR
FT                   RSGTIINISSIAGRKTFPNHAAYCATKFAVHALTENIREEVADVGVRMVTIAPGAVETE
FT                   LLSHTTDESIKAGYHDWKDQMGGVIAPEVIADAVLYAWSQPANVCVREIMLAATRQQP"
FT   gene            362617..362940
FT                   /locus_tag="AHA_0346"
FT   CDS_pept        362617..362940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36987"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF53"
FT                   /protein_id="ABK36987.1"
FT                   /translation="MVLTRRQLARARRWLPLWSLLMVLMSFGSRAATDLCTLTPHCSQS
FT                   ERTLEKAMPCGSFTSALAMTVLTGDSLTVAMLEPDTPDFISPSQFMPDVPTDRLERPPR
FT                   HLG"
FT   gene            362990..363421
FT                   /locus_tag="AHA_0347"
FT   CDS_pept        362990..363421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04214"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37618"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF54"
FT                   /protein_id="ABK37618.1"
FT                   /translation="MYKSLLLAVLAGTVSFSALATEQMTVYKSQYCGCCKTWIKHMEEN
FT                   GFEVKVVETEQLEPVKQQYGITPQLASCHTGVVNGYVVEGHVPAADVQKLLKEKPAIRG
FT                   LTIPGMPQSAPGMDIPGQPYQVLSISNEGATKVWSSYPG"
FT   gene            363580..365799
FT                   /locus_tag="AHA_0348"
FT   CDS_pept        363580..365799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0348"
FT                   /product="protease II"
FT                   /EC_number="3.4.21.83"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF02897"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39710"
FT                   /db_xref="GOA:A0KF55"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF55"
FT                   /protein_id="ABK39710.1"
FT                   /translation="MIPCPRSQGSGPPTLLQRKGCDMFTFSRGLLLLACLAAVPCSYAN
FT                   DESAMPTSDTLIQPPVAAKHPHAIKKHGDTRVDNYYWLRDDERQKPEVLAYLEAENAYT
FT                   DAMLKPIKPLRDQLYQEMVARIPQQDESVPYVKNGYRYQTRYEPGKEYAIYSRSKLGEE
FT                   AASLLLDGNQRAEGHEFYALGALEVSRNNRWLAVAEDFLSRRQYQIQFLDLESGKWAAE
FT                   LLPNTSGNLVWANDSKTVFYVRKHPKTLLPYQVYRHELGTEPAKDQLVYEEKDDSFYVS
FT                   LYATTSEDFIVIALSSTTSGEARLIDANVPTQAPRLFLPRQVDHEYSLDHYRGRFYVRS
FT                   NKDGKNFGLYETKESPVDRWKAVIAPNPDVLLESYALFKEWLVLEERSQGLTRLRQVNW
FT                   QSGEQKEIAFDDPAYVTWLAYNPEPDTSALRYGYSSMTTPSSTYELDLNSGKRTLLKQQ
FT                   PVAGFKAEQYASERLWITARDGVAVPVSLVYRKDKFKQEGAGTHTNPLLVYGYGSYGAS
FT                   MDPDFSSARLSLLDRGFVYAIAHIRGGEELGRHWYEDGKLLKKQNTFNDFIDVTEALVA
FT                   QGYGAKDQVYAMGGSAGGLLMGAVINQAPQLYRGVVAQVPFVDVVTTMLDESIPLTTGE
FT                   YDEWGNPNQKRYYDYMKAYSPYDQVKAQAYPNLLVTTGLHDSQVQYWEPAKWVAKLREL
FT                   KTDDNKLLLSTDMDAGHGGKSGRFKAYEDIALEFAFILDLAKPQA"
FT   gene            366071..367186
FT                   /locus_tag="AHA_0349"
FT   CDS_pept        366071..367186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0349"
FT                   /product="trap transporter solute receptor, taxi family"
FT                   /note="identified by match to protein family HMM TIGR02122"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38189"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF56"
FT                   /protein_id="ABK38189.1"
FT                   /translation="MLVAFWGTFAVHPLPHIEVMGNRRRRTVVCPAFARGTGELNQSKR
FT                   MNNMKGLSLACALSAVLAGVSFGGPVQAQERFVTIGTGGQTGVYYVAGQSICRFLNRGA
FT                   ADHQIKCNAPASGGGVANVNGIRSGEFNFGIMQSDHQYKAMKGLPPFQAEGAMDDMRAV
FT                   FSLQSEVFTILARKDAKIAGFDDLKGKRVNIGNPGSGQRDTFEEIMAVKGWKKGDFGLV
FT                   SELKPAEQASALGDNNIDAMSYFVGHPNGAIQEASTTTDAVLVPVTGADIDKLLAEKSY
FT                   YSKAEIPGGIYKGSDQPTPSIGGKAVLSTSAKADPEVVYQLVKSVFDNLDRFKRLHPAF
FT                   ADLKEADMIKVGLSAPLHEGAARYYKERGWL"
FT   gene            367289..369841
FT                   /locus_tag="AHA_0350"
FT   CDS_pept        367289..369841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0350"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="identified by match to protein family HMM PF06808;
FT                   match to protein family HMM TIGR02123"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35902"
FT                   /db_xref="GOA:A0KF57"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="InterPro:IPR021814"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF57"
FT                   /protein_id="ABK35902.1"
FT                   /translation="MQDKQLSTEELIAQDVGARLPLGIMGGCITTLALAWSLFQLWIAS
FT                   PLPFMLGFGVLNDTETRAIHLTFALLLAYLVFPAFRRSPRDRVPLGDLALGLVAAGAAS
FT                   YLFVMYEALAQRPGNLTTADLVTACIGIPLLLEAARRALGPALAVIALVFLAYSLAGPW
FT                   MPGLLAHRGVSFTALANHQWITTEGVFGIALGVSTSFVFLFVLFGALLERAGAGHYFIQ
FT                   LAFSLLGHLRGGPAKAAVVASGLTGLISGSSIANVVTTGTFTIPMMKKVGFSAEKAGAV
FT                   EVASSVNGQIMPPVMGAAAFLMVEYVGIPYVEIIKHAFLPATISYIALLYIVHLEALKL
FT                   GMQPIGDHQPKPWLRRLTGFAFGAALISGLSMAVYYGLGWLKPALGDYALPGIALLLAA
FT                   TYLGLLKIAASNEPLAAEDPDKPLTELPNTRTVLLSGLHFLLPVVVLVWCLMVERLSPG
FT                   LSAFWGTVMLVIILLTQRPLLNWLRSDGRHDYGSLQDGLIDLREGLVAGARNMIGIGIA
FT                   TATAGIIVGAVSQTGVGLVLADLVEMLSMGNLLLMLLLTALLSLILGMGLPTTANYIVV
FT                   SSLLAPVVVTLGQQNGLIVPLIAVHLFVFYFGIMADVTPPVGLASFAAAAVSKGDPIKT
FT                   GITAFYYSLRTAALPFLFIFNTDLLLIDVDFAHGVLIFMVATVAMLIFAAATQGHFLVK
FT                   SRWYESVLLLLVAFTLFRPGFWMDMVHDPYRETPPAQLAQTLGEVEAESTLRLRIQGED
FT                   AVGKLRQSTVLLAVPAGEDGEARLASLGLALYEQDGKTLIDSVTFGSPAAAAGMEFDQE
FT                   IMMVKAPTERWRKELMWLPGFLLFALIVWLQRRRVVRA"
FT   gene            complement(369900..370010)
FT                   /locus_tag="AHA_0351"
FT   CDS_pept        complement(369900..370010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36703"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF58"
FT                   /protein_id="ABK36703.1"
FT                   /translation="MMCHLGISFEQACEQLGLSQVEQQTLSLLQEQDPQE"
FT   gene            complement(370032..370184)
FT                   /locus_tag="AHA_0352"
FT   CDS_pept        complement(370032..370184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37011"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF59"
FT                   /protein_id="ABK37011.1"
FT                   /translation="MEDAMKNYLPAIDIMMCHLGISFEQACEQLGLSQVEQQTLSLLQE
FT                   QDPQE"
FT   gene            370361..370987
FT                   /locus_tag="AHA_0353"
FT   CDS_pept        370361..370987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0353"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07947"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38746"
FT                   /db_xref="GOA:A0KF60"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF60"
FT                   /protein_id="ABK38746.1"
FT                   /translation="MLLSFLIIASGWWHIRAAYGSDSRQFYISKPLTMLLIIALAFGYQ
FT                   SYDHDGSHAWILLGLCLSLAGDVLLMLPSDRFIQGLAAFFVAHLCYIVGFAQGPLVLNL
FT                   VDGLLLLLVAGMVFGLLWGKLGEMKVPVFCYMLVIIGMAWVAAGAWHASLTAGSAAALV
FT                   GALMFLFSDSMLALDRFRRPFPHATAWVMTSYFAAQFLIAASLAG"
FT   gene            complement(371078..372631)
FT                   /locus_tag="AHA_0354"
FT   CDS_pept        complement(371078..372631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0354"
FT                   /product="multidrug resistance protein B"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39189"
FT                   /db_xref="GOA:A0KF61"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF61"
FT                   /protein_id="ABK39189.1"
FT                   /translation="MEPIPRRNWIAVMGGLIGAFMAILDIQITNASLKDIQGALSATLS
FT                   ESSWISTSYLVAEMIAIPLSGWLSRGLSVRRYLLWTTGAFIVASVLCSFSWNLTSMIVF
FT                   RALQGFTGGALIPMAFSLIVSLLPLHKRATGMALFGLCATFAPAIGPTLGGWLTEQMSW
FT                   HYIFYMNVPPGLLVMAMLAHGLDKKPVDWEVIKRVDLIGIVTMAVGLGLLEVVLEEGNR
FT                   EDWFGSSFIVRLTVISVVALVFFVISQLLRRHPLVNLRLLHNPRFALACFAYLVLGMAL
FT                   MGSIYVLPLYMTQIHNYNALEIGEVLMWMGLPQLLVLPLVPRLTHKIDPRYLVSFGFLV
FT                   FAVSCFMNMNMSADYAGPQLIQSLIVRALGQPFIMVPLSLVATASLTHDEIPSSSTLLN
FT                   VLRNLGGAFGIAIIATLIDNDTRIHVSQISSTLAASSIEGQSYLLQLAQTMMAQGSGPE
FT                   LARQQAQAMLSNTISREAAIMAYNQVFFVMGIFLLLASGLMLLLKQPAPRAADAEPLEA
FT                   "
FT   gene            complement(372631..373683)
FT                   /locus_tag="AHA_0355"
FT   CDS_pept        complement(372631..373683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0355"
FT                   /product="HlyD family secretion protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39916"
FT                   /db_xref="GOA:A0KF62"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF62"
FT                   /protein_id="ABK39916.1"
FT                   /translation="MSQHKKIPLLAAMILALLGLLFAGYWYLHGRYFESTDNAYLQSEV
FT                   TGIGSKLSGYISEVLVTDNQPVKAGQLIARLDDREYKTKVAEAEADLRLNQATAENLAA
FT                   TRTQQLSLIRQAEAKVSSANAEQVRAQQQVRRVSQLNQRHYSSQDSLDEVRAGLQVNQA
FT                   QEQEAKAALQAARERLLVLDAEAKQNQAKLALSAAQLEQAKLELAYTELRAPADGIIGK
FT                   RSLRAGLYVQSGMQVASLVPLQQVWVEANFKETQLLHMQPGQKVEVILDAYPDQPVEGI
FT                   IDSLAPATGAKFALLPPENATGNFTKIVQRVPVKIRIPEPGPLAGKLLPGLSTEVIVDT
FT                   RSPDPVVAAH"
FT   gene            373780..374682
FT                   /locus_tag="AHA_0356"
FT   CDS_pept        373780..374682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0356"
FT                   /product="transcriptional regulators, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35852"
FT                   /db_xref="GOA:A0KF63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF63"
FT                   /protein_id="ABK35852.1"
FT                   /translation="MDLNAALILVRIVDKGSFTAAAQELGMTKATVSRRIAELEQRLGV
FT                   RLLYRSTRQLTLTEAGEQYYLRCSKAVDELAQAELMVSASQQEVTGTLKLAVPIEAGQL
FT                   VVGRLVAEFLQAYPGLQVELELTNRIVDPINEGLDAIVRIGDMSDSNLAARRLWSNARL
FT                   ICASPAYLARSPAITHPEDLVHHERVAVTSGFLASHWCFERDDKEVLVDPPSRFRVNNI
FT                   TCAREAAKAGLGLASLPAMLCHEELASGTLVSVLPEWQQPRVPIYLLFPERRLMPRKLR
FT                   VFIDFIVAKGADYGIDTLL"
FT   gene            374739..375053
FT                   /locus_tag="AHA_0357"
FT   CDS_pept        374739..375053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36442"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF64"
FT                   /protein_id="ABK36442.1"
FT                   /translation="MDHWINLYRASHSLEAHALKGALEVEGVPVRLNGEALSGALGELP
FT                   VDLLQVTLMVREQDRSKAGRVIERYQQRQGNGWLCGQCGEENGANFDVCWRCHHDPHEN
FT                   "
FT   gene            complement(375068..376387)
FT                   /locus_tag="AHA_0358"
FT   CDS_pept        complement(375068..376387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0358"
FT                   /product="proton/glutamate symporter"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36975"
FT                   /db_xref="GOA:A0KF65"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF65"
FT                   /protein_id="ABK36975.1"
FT                   /translation="MPPQTEYKDIGVMLFHGLAFKPWRIWTRRPLWLKTLLGMLTGIGL
FT                   GAGFSEQALLLKPIGVLFVNTIQMLMVPLIFCSVIAGLTSLLKGKTLDRIAGKAIGLYL
FT                   CSTAVAICIGLMMGWLLEPGMGANMGPYERVGMAESPTLASVLSHLVPRNPVQAMVDGK
FT                   ILQVIVFAVALALALNATGRRGRPAILFFTSLAEGMFKLTQMVMALAPYGVCALMAWMT
FT                   GKYGMSLLLPLLKVIGAVYLGCLLHVLGVYSSLLILLARLNPLHYFKSIVDAQAVAFTS
FT                   SSSNSTLPISLACAERRLGVSPAITAKVLPIGATINMDGTALYQGVTALFVAQAFGVDL
FT                   HMVDYLTIISIATLASIGTAGTPGTGLMLLTLTLTAVGLPLEGVALIAGIDRILDMART
FT                   TVNVSGDILVSVLIARSERELDLATYHDASAGEDIDFTLR"
FT   gene            376422..376805
FT                   /locus_tag="AHA_0359"
FT   CDS_pept        376422..376805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0359"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37584"
FT                   /db_xref="InterPro:IPR019620"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF66"
FT                   /protein_id="ABK37584.1"
FT                   /translation="MPHYRQSRGHHQYGRREIGNLLAYIKVVGSGAGFNRHQICLFKRF
FT                   AMTQSVHGHEVMEMMLAHGGQFTRASLKQAIDERFGAEARFHTCSASEMDAEALIDFLA
FT                   KRGKFIESEQGFQTHADKICNHG"
FT   gene            376908..377507
FT                   /locus_tag="AHA_0360"
FT   CDS_pept        376908..377507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0360"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01914;
FT                   match to protein family HMM TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39539"
FT                   /db_xref="GOA:A0KF67"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF67"
FT                   /protein_id="ABK39539.1"
FT                   /translation="MDTFSAAVMLFLIMDPLGNLPVFLSILRHIDPKRRRKVMMRELLF
FT                   SLVIMMAFLFVGQQILNFLNLRQEAVSIAGGIILFLIAIKMIFPSEGGVTGLAAGEEPF
FT                   LVPMAIPMIAGPSILASLLLLANQEPTRMADWSLALLMAWGASAVILMFYEVFNKLLGE
FT                   RGLTAVERLMGMLLVMISVQMLLDGVHHYLAVTGQN"
FT   gene            complement(377612..378580)
FT                   /locus_tag="AHA_0361"
FT   CDS_pept        complement(377612..378580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0361"
FT                   /product="HTH-type transcriptional regulator YidZ"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36795"
FT                   /db_xref="GOA:A0KF68"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF68"
FT                   /protein_id="ABK36795.1"
FT                   /translation="MLLEQLGRIDLNLLIILQVLLEERNGSRAARRLHLSQSAVSKALG
FT                   RLRETFDDPLFVRSAYGLEPTARALSLQQQLQPILLSLDNLIQPPDFDPTTTEREFVIA
FT                   SMDSAFTLFAPLYLSELKRQAPGIRLRYEEWTENSLTEMSQGQVDIAFTVRENCINSDF
FT                   RLDTLPNAICQRLLAIDDLTCLVQHDHPALHEPEWDLTRYLAYPHVQTYCEGRDRWMLD
FT                   HKLAEQDLYRRIEATVPSFEAALRMGMHSDMIVTLSRLYARHATQVYPLVPLPLPIALD
FT                   SISHLLIWHQRHEEDPGHRWLRETLLTLIMGKLEPTAAEPS"
FT   gene            378854..379015
FT                   /locus_tag="AHA_0362"
FT   CDS_pept        378854..379015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0362"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36428"
FT                   /db_xref="GOA:A0KF69"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF69"
FT                   /protein_id="ABK36428.1"
FT                   /translation="MGLGGIHIWHLLILLVVVVVVFGSKRLAGAGEDLGTAIRDFRKAL
FT                   RDDESQPK"
FT   gene            379030..379332
FT                   /locus_tag="AHA_0363"
FT   CDS_pept        379030..379332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04175"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38086"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF70"
FT                   /protein_id="ABK38086.1"
FT                   /translation="MSVEEKVELNETCDSCGCFAEIGTIIGEGDDVMELVIEAAAEADA
FT                   RAKLAAYEALAKQVTAEATSSSELSQGANGVILKARLQFTCTAEKLIFEMRARSI"
FT   gene            379381..380982
FT                   /locus_tag="AHA_0364"
FT   CDS_pept        379381..380982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0364"
FT                   /product="amino-acid abc transporter binding protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39556"
FT                   /db_xref="GOA:A0KF71"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF71"
FT                   /protein_id="ABK39556.1"
FT                   /translation="MGPRSIVSYPTDGFARRESANRRRSHHGSALVLRHFPHLYLPPVG
FT                   LAPARGEATAGACIMRRRWLWGLLALCALPLLAADLKPQRLPQPGDLASILQKKELRAL
FT                   VVYERGFFFFDKGAQHGILVNQLQGFERWLNQTYLAKEKIKLKIIYIPVRQDKLLDYLT
FT                   EGRGDLVAANMTVTPTRREQVTFSNPVIAPIEEWVVSQHSLPTFNRITQLSGRRVWVRA
FT                   SSSYYESLRQLNWLFRELGLPPIYIETVPEYLQDGDLLEMVAAGIIPLTVTDSFKGRIW
FT                   LGMISGLRAHKLIPLRDNGRSAWALRNNSPELLKAVNDYLADAGKRTLYSDMALRRLLA
FT                   RNDQMSNILAPDPLGRLSTIRKVLEQQADKYRLDWLMLAALAYKESGLNANIRSERGAV
FT                   GIMQLLPSTGGEVGIRGARLASLEGNVEAACRYMRLILDTYFNDPKLDVLNRHLFALAA
FT                   YNAGPNRVQALRAKAEAAGLDPNVWFGNVEQLVANEVGQGPINYVSTIYKYYVAYRFSL
FT                   PQLEGKAAAIEAVAQP"
FT   gene            381214..382467
FT                   /locus_tag="AHA_0365"
FT   CDS_pept        381214..382467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0365"
FT                   /product="phospholipase D family protein"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37721"
FT                   /db_xref="GOA:A0KF72"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF72"
FT                   /protein_id="ABK37721.1"
FT                   /translation="MIPAEFALIDQPELALKLRCQLIRGARSRIQAQYYSWEEDSSGKL
FT                   LLAELLHAARRGVRVQLLIDDLYAGDNRFLEMVAHQPGIEVRLFNPFWLRGWRPLTLLL
FT                   EGLLSFRRINHRMHNKLLLVDGSQAVIGGRNIGDRYFGLGGAPQFVDLDLACRGPLCQQ
FT                   AEQGFDQFWRSRWSHPIRRLLRRPLQRAEVQVVNDFLLTMNEPQVAAVYDLPASLFDPE
FT                   PVPLRWHAGQAEVWFDRPGKGLVSRPTTARLLWRKLADNQGTLSLVTPYLILTRGLRRR
FT                   LRQQRQAGVNIDILTNSLASTDVPLVYGAYRRHRPWLIRQGIALSELEGESLSLHAKLI
FT                   LVGEEEALLGSFNLDPRSLLLNTELVLHLACPALCAELQQWLATWQQRSSHSVAAPPST
FT                   LRRLLARVSDWLPLQRWL"
FT   gene            complement(382947..384065)
FT                   /locus_tag="AHA_0366"
FT   CDS_pept        complement(382947..384065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0366"
FT                   /product="fatty acid desaturase, family 1"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37997"
FT                   /db_xref="GOA:A0KF73"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF73"
FT                   /protein_id="ABK37997.1"
FT                   /translation="MERPPIIMTNTLLFALSGLTALIAVPWYGMTHGYDLWQWGSFLLL
FT                   FCYCGISITAGYHRLWSHKAYKAHPILQWIFAIGGALALQNSALHWSSDHRRHHRHVDD
FT                   NQQDPYSAGRGFWYSHIGWMLREYQGETYHDYSNVRDLQNNPIVVFQHKHYLALTLATN
FT                   IGIPLLLGLVHGDLLGMLLLAGVLRMVMTHHTTFFINSLAHIWGSQPFTDRNSARDNGI
FT                   LAFFTFGEGYHNFHHLFENDYRNGIHWWQFDPTKWLIRSASWCGLTRDLRACPEERIEQ
FT                   ARLEMQLKRAQAKLRKQDDRDLWQALLQEEYDKLNQQLQHYYASRKRLLEQRKRKALAR
FT                   YDQLKLQLEYRNLHDAFIAAKRNWSRLLAGIA"
FT   gene            384214..384834
FT                   /locus_tag="AHA_0367"
FT   CDS_pept        384214..384834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0367"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37759"
FT                   /db_xref="GOA:A0KF74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF74"
FT                   /protein_id="ABK37759.1"
FT                   /translation="MGIRAQQKEKTRRTLIEAAFSQLCANRSFSNLSLREVAREAGIAP
FT                   TSFYRHFRDMEELGLTLVDEGGLTLRQLMRQARQRIAGGGSVISTSVQTFMEFVENNPN
FT                   IFRLLLRERSGTSAAFRQAVAREIQHFIAELTDYLEATTGAPREEAYIQAEAMVTIVFS
FT                   AGADALDMTSEECRALSDRTIRQLRMIAMGAEVQNQKRREPLS"
FT   gene            384843..385220
FT                   /locus_tag="AHA_0368"
FT   CDS_pept        384843..385220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0368"
FT                   /product="ATPase of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37361"
FT                   /db_xref="GOA:A0KF75"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF75"
FT                   /protein_id="ABK37361.1"
FT                   /translation="MDSSMHDQNPIPKKPLLLALLIGICGDASLTVLSESVVPFSFFPM
FT                   IALVLAAYQLYQHYRHVSLEGNTPVCMLLCFFIGVFGHSALVKVQYPELGSNFFSLIMM
FT                   LLLLAVLSIKLGISVGKKEKE"
FT   gene            complement(385259..385570)
FT                   /locus_tag="AHA_0369"
FT   CDS_pept        complement(385259..385570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39835"
FT                   /db_xref="GOA:A0KF76"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF76"
FT                   /protein_id="ABK39835.1"
FT                   /translation="MKRVFNLLAMGLILFFWFGVLVSLIAPLPGKLNGFLPVCGVIVAL
FT                   MHWVQASMVKAACKPYFAVSRLEFTQVLVFGVFGMVEIRTRLQAIVDAKQRGTDNKAG"
FT   gene            complement(385681..386310)
FT                   /locus_tag="AHA_0370"
FT   CDS_pept        complement(385681..386310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0370"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39151"
FT                   /db_xref="GOA:A0KF77"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF77"
FT                   /protein_id="ABK39151.1"
FT                   /translation="MPRVKSSRNGPSKSPAPQGKSGFVRIISGQWRGRKLPVRDVEGLR
FT                   PTTDRVKETIFNWLAPHVRGTRCLDLFAGSGGLGLEALSRYAEQVTLIEMDKGAADQIK
FT                   KNLTTLGSSQGQVIQSDAVSWLQGPATPFDLVFLDPPFRRELLPQVCELLEQRGWLAPD
FT                   ALIYLEREKEMADLPLPASWQLLKDKQAGQVCYQLYLRDTKHDAAV"
FT   gene            386421..388322
FT                   /locus_tag="AHA_0371"
FT   CDS_pept        386421..388322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0371"
FT                   /product="cell division protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38711"
FT                   /db_xref="GOA:A0KF78"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF78"
FT                   /protein_id="ABK38711.1"
FT                   /translation="MAKGLFSWLGFGRKKEEAEAVQPQTPQATPITAEPEVAAAPAPVS
FT                   DPTPAVAAEVPASAQNSVLHDDCCPPAELDDHGPLVVEECASDLEPVIVNEALLAEEER
FT                   AAAQAQAQEAARVAAELKAAQEVRIAAEARAAEEARIAAEARTAEEARLAAEARAAEEA
FT                   RIAAEARAAEEARLAAEARAAEEARVAAEARAVKEARIAAEASAAEETRIAAEARAAEE
FT                   ARIAAEARAAEEARLAAEARAAEEARIAAEARAAEEARLAAEARAAEEARLAAEAQAAE
FT                   EARLAKEAQRVEDLRLVAEMEAEAAALAALPLAAKVDDDTQEKPQREGFFARLKRSLVR
FT                   TRENIGSGFFGLFRGKKIDDELFEELETQLLTADLGVDTTSRIIEGLVQHADRKQLKDA
FT                   EALYGLLKQDMGEMLAKVEQPLVIDTSKKPYVILMVGVNGVGKTTTIGKLAKQFQAEGK
FT                   SVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIYDAIEAARSRGADVLIA
FT                   DTAGRLQNKSNLMEELKKVVRVMKKLDDAAPHEIMLTLDAGTGQNALSQAKLFSEAVGL
FT                   TGITLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDFIEALFSREE"
FT   gene            388413..389081
FT                   /gene="ftsE"
FT                   /locus_tag="AHA_0372"
FT   CDS_pept        388413..389081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="AHA_0372"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38753"
FT                   /db_xref="GOA:A0KF79"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF79"
FT                   /protein_id="ABK38753.1"
FT                   /translation="MIRFDKVSKVYSGGHQALQKVSFHLRKGEMAFLTGHSGAGKSTLL
FT                   KLISVMERPTDGRVFFHGDDVSHIKRGEIPYVRRQIGMIFQDHRLLMDRTVFDNVALPL
FT                   VIDGYSHADINKRVAAALDKVGLLGKERYQPRMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPQLSMDIMRLFEEFNRFGVSVLIATHDLGLIARMRYRTLTLKAGRMYSAGEEL
FT                   "
FT   gene            389081..390034
FT                   /locus_tag="AHA_0373"
FT   CDS_pept        389081..390034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0373"
FT                   /product="cell division membrane protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37573"
FT                   /db_xref="GOA:A0KF80"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF80"
FT                   /protein_id="ABK37573.1"
FT                   /translation="MAIVRHKQPPLRRFMMYWVDHARQAFSSLGELWRNPLASLMTLAV
FT                   LGVSLALPSCFHVLLKNAEVVEGSWQTSSQISLYLRKDLPEQNILDMKQRILLYPEVES
FT                   VTYMSRDEALKEFREISGFGDALDYLDSNPLPPVLSVIPDPRWQNPEGAAELLNKLNNE
FT                   DGVEQGKLDLQWLTRLQGIMNLLRHTITGIAVLLLSAVLLIVGNTLRLNILNQRSEIEV
FT                   LKLVGATDAFIHRPFLYTGIWFGVIGGMLAWWLTEVMVIWSEGVVKELAGLYNSNFRLV
FT                   GMGAVDGINLILLGALLGLIASWFSVHRHIRDIEPS"
FT   gene            390490..391344
FT                   /gene="rpoH"
FT                   /locus_tag="AHA_0374"
FT   CDS_pept        390490..391344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="AHA_0374"
FT                   /product="alternative sigma factor RpoH"
FT                   /note="identified by similarity to SP:P11539; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545; match to protein family HMM TIGR02392; match to
FT                   protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37097"
FT                   /db_xref="GOA:A0KF81"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF81"
FT                   /protein_id="ABK37097.1"
FT                   /translation="MGTSLQRTMALIPQGSLEGYIQAVNSIPVLSAEEERELAERLQQG
FT                   GDLEAARQLVMSHLRFVVHVAKSYAGYGLPQADLVQEGNIGLMKAVKRFDPSVGVRLVS
FT                   FAVHWIKAEIHEYVLRNWRMVKVATTKAQRKLFFNLRKSKKRLGWLNHEEVQAVAADLG
FT                   VSAADVTEMEARMSNYDQAFDLVGDDEEEGGFAPVHYLEDKSSDLAATIENDNWDDHAT
FT                   RRLSSALATLDERSQHIIRARWLDDESKTTLQELADTYGVSAERVRQLEKNALKKLKDA
FT                   MEA"
FT   gene            391471..392130
FT                   /locus_tag="AHA_0375"
FT   CDS_pept        391471..392130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0375"
FT                   /product="carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36352"
FT                   /db_xref="GOA:A0KF82"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF82"
FT                   /protein_id="ABK36352.1"
FT                   /translation="MKLLNDLFTNNREWAERIKAEDPEFFATLSAQQAPEYLWIGCSDS
FT                   RVPANQLMGLLPGDVFVHRNVANLVVHTDFNCLSVLQYAVEVLKVKHIIVCGHYGCGGV
FT                   KAAMQNQELGLIDNWLRNIKDVYFKYREQLDAIEDEHERFDYLCELNVAEQVANVCHTT
FT                   IIQNAWRKGQELAVHGWIYGIKDGLLHDLDLCISGPEQIPDVYRAWPDMRPPHRRR"
FT   gene            392142..392846
FT                   /gene="hutC"
FT                   /locus_tag="AHA_0376"
FT   CDS_pept        392142..392846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="AHA_0376"
FT                   /product="histidine utilization repressor"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702; match to protein
FT                   family HMM TIGR02018"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35932"
FT                   /db_xref="GOA:A0KF83"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF83"
FT                   /protein_id="ABK35932.1"
FT                   /translation="MAPALYLQIKQHILDGIRERHYQAGDRIPTEAALCEQFAVSRMTV
FT                   NKALRELVAEGWLVRTAGSGSFVADRRTESPLLAIRNIADEIAERGSEYSGRVIRLQRQ
FT                   AADEKVAVQLGLRVGAPIFHSLIVHQADGEPLQLEERFVDAERLPQYGEQDFASQTPNR
FT                   YLMEVCPLSEMEHVVEAVLPSAGEAGLLQVRVDTPCLLLHRRTWSDGYLVSYARLLSPG
FT                   SRYKLSSKTSLS"
FT   gene            392933..394237
FT                   /gene="hutI"
FT                   /locus_tag="AHA_0377"
FT   CDS_pept        392933..394237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutI"
FT                   /locus_tag="AHA_0377"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969; match to protein
FT                   family HMM TIGR01224"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39901"
FT                   /db_xref="GOA:A0KF84"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PDB:2OOF"
FT                   /db_xref="PDB:2Q09"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF84"
FT                   /protein_id="ABK39901.1"
FT                   /translation="MNLILSFPSEIGYKLMYIHLEVGMNKELLNCERVWLNVTPATLRS
FT                   DLADYGLLEPHALGVHEGRIHALVPMQDLKGPYPAHWQDMKGKLVTPGLIDCHTHLIFA
FT                   GSRAEEFELRQKGVPYAEIARKGGGIISTVRATRAACEEQLFELALPRVKSLIREGVTT
FT                   VEIKSGYGLTLEDELKMLRVARRLGEALPIRVKTTLLAAHAVPPEYRDDPDSWVETICQ
FT                   EIIPAAAEAGLADAVDVFCEHIGFSLAQTEQVYLAADQYGLAVKGHMDQLSNLGGSTLA
FT                   ANFGALSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLKETKLPPVAALRKAGVPMAV
FT                   SSDINPGTAPIVSLRMAMNMACTLFGLTPVEAMAGVTRHAARALGEQEQLGQLRVGMLA
FT                   DFLVWNCGHPAELSYLIGVDQLVSRVINGEETLHG"
FT   gene            394230..395174
FT                   /gene="hutG"
FT                   /locus_tag="AHA_0378"
FT   CDS_pept        394230..395174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="AHA_0378"
FT                   /product="formimidoylglutamase"
FT                   /EC_number="3.5.3.8"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01227"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39322"
FT                   /db_xref="GOA:A0KF85"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF85"
FT                   /protein_id="ABK39322.1"
FT                   /translation="MDKFNPVDMSVWQGRQDPEDGELALRWHDKVQPWPQAGRAAPGVA
FT                   LVGFACDEGVRRNKGRVGAAGAPLAVRKLLANSAWHLGRPVYDRGDVNCEDGDLDAAHG
FT                   RLAERVARLLDEGHFPLVLGGGHEVAFGSWSGLNRHLAGRGRVGIINFDAHFDLRMKLE
FT                   QASSGTPFFQIAEQCAIQGTPFTYACLGVAETANTQALFARAEALGVWHVLDEAMTPAE
FT                   LPALLSGLDAFIARCDHLYLTIDLDVLPAAVMPGVSAPAARGVELAVIEPLIAHIRASG
FT                   KLRLADLAEYNPSLDQDNRSARVAARLVHQLIK"
FT   gene            395229..396938
FT                   /gene="hutU"
FT                   /locus_tag="AHA_0379"
FT   CDS_pept        395229..396938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="AHA_0379"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="identified by match to protein family HMM PF01175;
FT                   match to protein family HMM TIGR01228"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37402"
FT                   /db_xref="GOA:A0KF86"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF86"
FT                   /protein_id="ABK37402.1"
FT                   /translation="MSQQHQDPRHDPNRVIRAPRGTTLTAKSWLTEAPLRMLMNNLDPE
FT                   VAEHPQSLVVYGGIGRAARNWACFDKIVEVLTRLEEDQTLLVQSGKPVGVFQTHKDAPR
FT                   VLIANSNLVPHWANWEHFNELDKKGLMMYGQMTAGSWIYIGTQGIVQGTYETFFAVANQ
FT                   HFNGEPKGRWILTGGLGGMGGAQPLAATMAGFSMIAVECDETRIDFRLRTRYVDKKAHS
FT                   LDEALAMIEEAKQSGSAVSVGLLGNAADVFAELVARGITPDVVTDQTSAHDPVHGYLPQ
FT                   GWSVAQWRALQKSAPQEVNVAARHSMARQVEAMLTLQSRGAATLDYGNNIRQMALEEGV
FT                   KNAFDFPGFVPAYIRPLFCEGIGPFRWVALSGDPEDIYKTDQKVKELIPDDPHLHNWLD
FT                   MARDRIAFQGLPARICWVGVKDRVRLGLAFNEMVKNGELKAPIVIGRDHLDSGSVASPN
FT                   RETESMMDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGFSQHSGVVIVCDGSDD
FT                   AAKRVGRVLRNDPATGVMRHADAGYEIAINCAHEAKLDLPMIDGANGVKGKV"
FT   gene            396943..398475
FT                   /gene="hutH"
FT                   /locus_tag="AHA_0380"
FT   CDS_pept        396943..398475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="AHA_0380"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="identified by match to protein family HMM PF00221;
FT                   match to protein family HMM TIGR01225"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36958"
FT                   /db_xref="GOA:A0KF87"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF87"
FT                   /protein_id="ABK36958.1"
FT                   /translation="MFELTITPGELDLATLRRVSREPVHVSLDPAALAGIHASAAVVTK
FT                   VIEQNRVVYGINTGFGLLANTRIPVEQLDELQRSIVLSHAAGIGEYMDDATVRLMMVLK
FT                   LNSLARGFSGIRLVVLEALMRLINAEVYPVVPKKGSVGASGDLAPLAHMSCLLIGEGKA
FT                   RHAGELIDAATALKIAGLEPIALAPKEGLALLNGTQASTAFALEGLFHAEDLYAGAITI
FT                   GAMSVEAALGSRRPFDARIHAVRGQRGQIDAAACYRHLLVDGSEIGMSHHNCEKVQDPY
FT                   SLRCQPQVMGACLTQIRQAAEVLVCEANAVSDNPLVFAEDEDILSGGNFHAEPVAFAAD
FT                   NLALAIAEIGSLSERRMALLIDSRMSGLPAFLVNNGGVNSGFMIAQVTSAALASENKTL
FT                   AHPASVDSLPTSANQEDHVSMATFAGRRLADMAENTRGILAVELLAAAQGLDFRAPLRS
FT                   TELIELAKGRLREEVSFYDKDRYFAPDIEAAAALLGRASYNDLLPAGVLPSL"
FT   gene            complement(398545..399642)
FT                   /locus_tag="AHA_0381"
FT   CDS_pept        complement(398545..399642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0381"
FT                   /product="calcium/proton antiporter"
FT                   /note="identified by match to protein family HMM PF01699"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36479"
FT                   /db_xref="GOA:A0KF88"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF88"
FT                   /protein_id="ABK36479.1"
FT                   /translation="MKSFIRQEIALPVGLLTLLFFKTLGSDLLTEATPLGIYLPVSAML
FT                   LAIVTWAIFSVVRHSDALAIKLGEPFGTLILTLSVISLEVVMISSVMLTGEPNPVMARD
FT                   TMFAVVMLVTNGLVGFTLLFGGWRYHTQSFNLDGVKSYLVAIIPLALLCLVLPNFTEGG
FT                   NIGSMSSAMSWMLIIISVLLYGVFLLIQTRSHSHFFIDSDHEDYEEHHGPLQSNVYHTL
FT                   LLLAYLVVVILLAKTLAIPINHGVKVLAAPPALGGFIVACIVLAPEAVGAIKAAFNNQL
FT                   QRAMNLYFGSVLATIALTVPAVLFIGAMLGQEVRLGLSAADMVLLFTTLMVCKVTFSSG
FT                   RTNVLHGATHLVLFVVYLFLMFEHE"
FT   gene            complement(399804..401171)
FT                   /locus_tag="AHA_0382"
FT   CDS_pept        complement(399804..401171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0382"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38015"
FT                   /db_xref="GOA:A0KF89"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF89"
FT                   /protein_id="ABK38015.1"
FT                   /translation="MDESIRAQLAQFTFDCGQKDMALLRDPRFYSRHIRIQGLKLASGT
FT                   GCSSLGVDLPFTAADLPPYPSQELFGLAATQARFNTEQELVAYFHVGNNTAYWVLNNSW
FT                   SHALLQYPCTDCFYLEFHQQTPDEAMPVFPRGNKSIKEEGGSQSLSFFDPNNHIKQTLW
FT                   AGKALEHYAQQQARHYGFWGGAAVGALLVAAYWGLRNYRRSLKGLLQAGLARREFVPFY
FT                   QPVVDSRSLQVVGFEALLRWQRGGDLIPPGAFIDYAEEQQLILPMTSQLLEKVIADLPR
FT                   LAPGQWVSVNIVAAHLEHPHLRNLLLQHGWPSPAQLTFELTERKPITDIKTAVIEITAL
FT                   QQQGYHFKLDDFGTGYGGFAYLQRLGIRQIKIDKMFVDTIGTDDLKRSVLDATIAFGRE
FT                   SGMEMIAEGVERQDQVDYLQQHGVHLIQGYVYAQPMALTKLKIWLLAWYQNHTGER"
FT   gene            401850..403808
FT                   /locus_tag="AHA_0383"
FT   CDS_pept        401850..403808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0383"
FT                   /product="msha biogenesis protein mshh"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39510"
FT                   /db_xref="GOA:A0KF90"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033423"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF90"
FT                   /protein_id="ABK39510.1"
FT                   /translation="MDVVGHTERHMKLTTQLVSFITLCVIAAMAMVLLGGVFSFRELGM
FT                   EMQQKKVNSLVEIIDKQLEVADDHQDLTRWLPTLLRSAHVVELEIRQDKQRIYWFRDVQ
FT                   QPTDESLLIPYHQPMPHQPGMQADFKLERPFKEFEYSIKAMSGISLGVFIVVFGLWYSI
FT                   RWLRLQLRGAELLAERAQLILDNKLTKLAHDPADEWPQPASQALDYLLAELADARKERS
FT                   RFDNFIRSNAFVDKMTGIGNRLFFDNRLESAIMEASVMSGGVLLIELAGLEELDPELNG
FT                   RQSQDLLMEASASIAAFVRKHNGALQARYAGQVFAVLLPNMSESEMVDGAGQLHKSLQR
FT                   LHWPEAVNPDTAVYLGAVCYQAEDSLLKVQEEAELALKSARLQGHTGWFLYEKQLDEEQ
FT                   SSKGTVRWRTLIGRRIEEHGIDFYVQPVQQERDQVVLQQDLLIRIHDEQGRELQAGVFM
FT                   PMAEKAGLLLPLDRLVAEQTLGLLRQRSEQSCPISLTLCAQSLLHREFQRWLFFDLFQL
FT                   PRSTNERLILQLSEAQVTRHYEALKRPLRALRMLGCQLAIDHAGQDVVSTQYIKEFEIN
FT                   FLKLHPSLVREIHTRQVNQMAVRSLVGGCANTRTRVIAVGVESGDEWKMLRHLGVHAGQ
FT                   GPWFAEPERLVLEPAGA"
FT   gene            complement(403909..404856)
FT                   /locus_tag="AHA_0384"
FT   CDS_pept        complement(403909..404856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0384"
FT                   /product="ACC deaminase/D-cysteine desulfhydrase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38906"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF91"
FT                   /protein_id="ABK38906.1"
FT                   /translation="MTDYSLSPHSSPMALPPLPPALVPSPLQAVSHPLLIAYGVQLWCK
FT                   RDDLIHPAISGNKWRKLKYHLLHAREQGKRHLLSFGGAYSNHIHALAAAGCQSGLRTTG
FT                   IIRGEPQAVSNCTLSAAKGWGMDLVFVDRQSYRRRQDPAWLAQFENEETLIVPEGGSSP
FT                   LAIPGVAELVDEVPFSPDLWVLPCASGGTLAGLIAGKRAPQQILAIAVLKGGSFIADEV
FT                   RRLHPAAADTPGWRIALDHHDGGYAKFSPALWQWVQAFSAETGLPLEPIYSGKAMWGLF
FT                   RELAAGRIPRGSKIVFIHTGGMQGLAGLREQGRL"
FT   gene            404926..405789
FT                   /locus_tag="AHA_0385"
FT   CDS_pept        404926..405789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0385"
FT                   /product="hypothetical msha biogenesis protein mshi"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36754"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF92"
FT                   /protein_id="ABK36754.1"
FT                   /translation="MKQLFRRSTPSRQVGLLLASDRIMLASLGNPPIFATRAINGPQEW
FT                   PQAMAELFSRHGLAKSKVRVALAASLYQQVQIDKPAVPDAEMAGALPWAIKDYVSESVL
FT                   QLAMDYVDLPTPPAGRPRINVICVPKARVQQLADAVNGIASLDAIVSDELAMTALYEPD
FT                   QTVRMLLWQPKGQDLQLLVFHQGGLCFSRQLRGFGALTGEHEPDAMLLDSLALEIQRSL
FT                   DYLVGQLKLPELGQMQLAIASPFIGTLVRHMEQTFGFAVSAMANKAILSGVEYLSAYAA
FT                   ALGGEQ"
FT   gene            405786..405890
FT                   /locus_tag="AHA_0386"
FT   CDS_pept        405786..405890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0386"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36193"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF93"
FT                   /protein_id="ABK36193.1"
FT                   /translation="MSALAMSTAKASKSELLSGIEYLSAYETVLGEDA"
FT   gene            405890..406483
FT                   /locus_tag="AHA_0387"
FT   CDS_pept        405890..406483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37696"
FT                   /db_xref="GOA:A0KF94"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF94"
FT                   /protein_id="ABK37696.1"
FT                   /translation="MKRQINLYGAEFRPRRQWASLNQMALVWGGSVLLLLCAAGVIAWQ
FT                   QHAVERELVQVRAALEIKRGEAQRLDAELARHQADGLLQQQLATKQEELTAKQGLMRQL
FT                   GSLALQKSQGYAGLMADLSRIRDPQLSLQRIEIADGYVNLSGFAGRSQDVPAWVNRFKQ
FT                   TPSLVGKQFGELTLSRDKEGRLAFQLSGIEREKP"
FT   gene            406483..407130
FT                   /locus_tag="AHA_0388"
FT   CDS_pept        406483..407130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0388"
FT                   /product="msha biogenesis protein mshj"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37309"
FT                   /db_xref="GOA:A0KF95"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF95"
FT                   /protein_id="ABK37309.1"
FT                   /translation="MSLKEQWQAWADKIAALSQRERVLILLTGVVVVGAVAIYGWLDGA
FT                   AVRLEQERLALSTAQRDLEIMDLENQGKQAKLARDPDLHVRTQLAQLDGELGKLDAELK
FT                   AQTVDLIQAHEMPAVLEALLSRSANLHMVALTSLTPEPLMAGEQRINLFKHGIRLKLEG
FT                   GYFDVYQYLKALEGLPRHFYWKQFDYQVQEYPKAVVEMEIYTLSTSKEFIRG"
FT   gene            407520..409193
FT                   /locus_tag="AHA_0389"
FT   CDS_pept        407520..409193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0389"
FT                   /product="msha biogenesis protein mshl"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF07655; match to protein
FT                   family HMM TIGR02519"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38588"
FT                   /db_xref="GOA:A0KF96"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF96"
FT                   /protein_id="ABK38588.1"
FT                   /translation="MKKHHLCLISAAVLTAGCTSYRHPEPVQAKDALRHAMTEQNKGGA
FT                   LTSVPKSVQSELLQLNRPPQAISMPEPRLRIAAHDVDAVEFFGSLFKGSRYSVAVHPGV
FT                   AGQISVELKDVTLTEVLAVVGDMYGFDVQRKGNVFHVYPAGLRTETIPVNYLMMSRRGL
FT                   SRTSVSTGGVASNDNNSSNNNNFDNANNSTNNSTSNRSSNGSSNSDSNGTRIETDTSSD
FT                   YWTDLRDTLQTLIGSGDGRAVITSPQAGLVTIRAYPKELKAVREFLNQSESHLKRQVVL
FT                   EARILEVALNEGYEQGVDWSGLSASWDGNKGITGGGSLTPSTIANTPNQIFSALGGGAG
FT                   FKISDGNFNVAVNLLKTQGDVNTLSSPRVTATNNQKAVIKVGTDEYFVTNASTTTTTSG
FT                   TSAPIVTPNVELTPFFSGIALDVTPQIDEEGKVLLHIHPSVIDTEEQKKTIDVGTADPL
FT                   ILPLAKSSIRESDTVVQANNGDIIVIGGLMKTDKQEIVSKVPLLGDIPWVGEAFTNRRE
FT                   STKKVELVILLKPTVVEKDTWQNELQRSSELLDKWYPPKG"
FT   gene            409271..410161
FT                   /locus_tag="AHA_0390"
FT   CDS_pept        409271..410161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0390"
FT                   /product="general secretion pathway protein A"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36249"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF97"
FT                   /protein_id="ABK36249.1"
FT                   /translation="MYLNHFGLQEAPFGLTPNTGFYYGLPPHEEALQVLNWALAQGEGF
FT                   IKVTGEVGTGKTLLCRKLLSELGSEERPVRLAWLPNPHLNPAELRIALALELGLAVRDQ
FT                   SELDLTDRIHRHLIALHQQGSRVVVLIDEAQALPDETLEAIRLFGNLETESSKLLQIVL
FT                   FGQPELDARLAKPYLRQLRQRIGFSYCLRPLRFDETRAYLEHRLQISGYRGAPLFGGRA
FT                   LRQLWRASRGIPRLINILAQKCLMLAYGQGARQIDSRLVRLAVRDTDDARRFVPRRWWP
FT                   LVLLLGCALAYGVWQ"
FT   gene            410257..411255
FT                   /locus_tag="AHA_0391"
FT   CDS_pept        410257..411255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0391"
FT                   /product="tetratricopeptide repeat family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38952"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF98"
FT                   /protein_id="ABK38952.1"
FT                   /translation="MLLLTLICGLALGILGWRTWIYWQQSQRVVEARQLQAAGEPTPDA
FT                   IARAVPAAVPASAEQEPVDQVVALPTPRHLATSPTAEPQQAEERTADDADVAAIDEEGP
FT                   SDEELQPDLYAELAAEQEAPAAAPRKPGVLKIETVNLSEAELATLAERKATTAMAKGQL
FT                   RDAQDNYYQVLAHDPRNQGAREQLAGLLYGEGRLSEASQLLEEGLRFDPEQADFRLLLA
FT                   RLAISGGDQLKALGWLTGHRPDLASNLDYYATWAGLSQELGQHAEAADLYVKLLRQQPD
FT                   QGRWWLGLGVAEDGQGHSQRALDAYRNAQLHGNLGEASTSWLEQRIAQLAP"
FT   gene            411288..412997
FT                   /locus_tag="AHA_0392"
FT   CDS_pept        411288..412997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0392"
FT                   /product="type IV pilin"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM PF05157"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39289"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF99"
FT                   /protein_id="ABK39289.1"
FT                   /translation="MAQPRLKMRLGDLLVQEQIISDDQLQLALQQQRQTGRKLGTTLID
FT                   LGFISEVQLLQFLARQLDVPFFDLNNLTIDASAVPLLPEVQARRYRALAVNLTDNKVTV
FT                   AMSDPADLSALDAIAALLRPREMGLAVAREGQLLEYFDRLYRRTREIESFAEQLHEEYQ
FT                   DAGFELGSSNLGAGDEGEATVAKLLRSLFEDAVQVGASDIHIEPDEKVLRIRQRIDGIL
FT                   HENILSEVRIAQALVLRLKLVAGLDISEKRLPQDGRFNMKVRGRDVDVRMSTMPVQYGE
FT                   SVVMRLLDQSSGILSLTETGMPPEILTRFRRQLKRPHGMILVTGPTGSGKTTTLYGALS
FT                   ELNQASQKIITVEDPVEYRLPRVNQVQVNPKIGLTFSHVLRSTLRQDPDILLVGEMRDN
FT                   ETVEIGLRGAITGHLVLTTLHTNDAVTSALRLIDMGAPGYLVASALRAVVAQRLVRRVC
FT                   EHCVEEKAPDEGQATWLTVLSGEAPGQHVYHKGRGCQSCNFTGYAGRIGVYELLELDQP
FT                   MMDSLRRNDAEGFAKAARQHPHYRPLALTALDYARQGITSVDEVLRLAEDLG"
FT   gene            413051..414271
FT                   /locus_tag="AHA_0393"
FT   CDS_pept        413051..414271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0393"
FT                   /product="GspF family protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38845"
FT                   /db_xref="GOA:A0KFA0"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA0"
FT                   /protein_id="ABK38845.1"
FT                   /translation="MSSFAYKGRDSQGNAVSGVVDAANEMAAAEQLMRRGVMPTELKPG
FT                   KAKAAALDWSLLLERGVRLDELVVFSRQMYALTRAGIPILRAIAGLEESAHSKPLKRAL
FT                   HALGEDLGNGRPLSSSMQAHPRVFSSLFVAIIHVGENTGQLEEAFLQLANYFELELETR
FT                   KRIKTAMRYPSFVLIAIGIAMVILNIMVIPVFAGMFAKFGVELPLATRILLATSHFFVH
FT                   YWWVMLGVLLAMVFGWRRWVSTVKGKLTWHRWQLKLPIVGTIIERSLLARFARSFSMML
FT                   KAGVPLNTALSLVADAVDNAWMAGRIRDMRAGIERGESLLRTAGSSGLFTPLVMQMIAV
FT                   GEETGQVDDLLHEAAEYYEREVDYDLKSLTARIEPILIGIVAVMVLILALGIFTPMWDM
FT                   MRAVRGK"
FT   gene            414449..414913
FT                   /locus_tag="AHA_0394"
FT   CDS_pept        414449..414913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38179"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA1"
FT                   /protein_id="ABK38179.1"
FT                   /translation="MSRQSQQDEHWLGSYRRLAVGILLLIMVATLARSYLVHREEALAV
FT                   SLTLLGEQFAERAQRLHGLWLDQRRPAVLHVDGMAWQFDERGWPLGAGTVMTPSENCRW
FT                   LWEQLIGKAASTQPPVQALASLDGEGCQFGWENNWLIYQFSDGRVQQSPE"
FT   gene            414987..415658
FT                   /locus_tag="AHA_0395"
FT   CDS_pept        414987..415658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0395"
FT                   /product="msha pilin protein mshb"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37751"
FT                   /db_xref="GOA:A0KFA2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA2"
FT                   /protein_id="ABK37751.1"
FT                   /translation="MTTTRLVPRYSGVVSPHRAAGFSLIELVIVIVILGILAVTALPRF
FT                   LDVTDEAKKASVEGVSGGFATGVSLVRAQWEAEGRAKQDSLNTVLYDGSRFYLTTPTDT
FT                   QVSNGELSPGYPMDTSAGGGIDVDPANLTAPRCLKIWEGLLQNPPKATASFSEVRGSGN
FT                   DLKYYVSVTNNGLDSVCRYYLVNSLSKGSDGKYQDPQGSTDAFMSFSYRPASGQVTTNI
FT                   N"
FT   gene            416158..416649
FT                   /locus_tag="AHA_0396"
FT   CDS_pept        416158..416649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0396"
FT                   /product="msha pilin protein mshc"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37037"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA3"
FT                   /protein_id="ABK37037.1"
FT                   /translation="MRRGFTLIELVIVILLLGILAAFAVPKLLGKGGFETQTLRDELLT
FT                   RLRLVQTINMHEPADRCTQLVVEASRFAHITLAVAGGACPDPGPMTDWSDNQRTRGRLV
FT                   TPSAGMAVSLNNASSFVIRFDQMGRPFGSCATGCTLLVSDGRETGRLKIESEGYIHESP
FT                   "
FT   gene            416636..417199
FT                   /gene="mshD"
FT                   /locus_tag="AHA_0397"
FT   CDS_pept        416636..417199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshD"
FT                   /locus_tag="AHA_0397"
FT                   /product="msha pilin protein mshd"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36597"
FT                   /db_xref="GOA:A0KFA4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA4"
FT                   /protein_id="ABK36597.1"
FT                   /translation="MRAPERGFTLIELIVGIVLLAVALTGILGLLINQAPQAVDPVQQV
FT                   RAAQLAQRLAGEIQQTSFDEQSDHNGGRYRCGEVVAGVTIQACSTHYGPDGEPAPYMFN
FT                   DVDDFDTAGSWKDASFYTQTGGIIASDEYRNYQVRIAVSPVDFSDGTFKNTCTAPCSVG
FT                   KRIDLQVRLPDESVLDFSFYRGNY"
FT   gene            417199..418020
FT                   /locus_tag="AHA_0398"
FT   CDS_pept        417199..418020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0398"
FT                   /product="putative msha biogenesis protein msho"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36151"
FT                   /db_xref="GOA:A0KFA5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA5"
FT                   /protein_id="ABK36151.1"
FT                   /translation="MRTASGFTLIELVMVILLLGIMATFASQFIGIGTQIYGDASSREQ
FT                   LMSDARFAMERLNREVRDALPGSERIEALDGSWDDSGPCLRFWPISTSSRYLALNRAQS
FT                   GSTSTLELVMAIPASAANPLNQDANAVKVGDLMVVFPMPTSAAGSLVNGCEYGRCVARV
FT                   TEVLAPVSGAQTVRYISGETLAGISPGSRVYFANQQVRYCVEGSTMTRSSAAIDAPVAA
FT                   GVLMAESLRAGNFYREVSAFNAEGAFGVRLVFERQGEAVTFNHKLGVFNVP"
FT   gene            418483..422166
FT                   /locus_tag="AHA_0399"
FT   CDS_pept        418483..422166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0399"
FT                   /product="MshQ"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39533"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA6"
FT                   /protein_id="ABK39533.1"
FT                   /translation="MKWLWALALFTSQVWAFDPIDTGSLFPAVVQGHHGNNNDACHQIN
FT                   GYQLIQLNNAKINGSGGLPLNFCSIQPDQNNTRRCDDGAGGYKVCTVTGSDIRGLALNG
FT                   NNAFPSNNANTTQTCSSGSQSASSAAYDTMTVESCTMTFPSRSTYQFKTLTVRNNATLV
FT                   LGEGDYFIDRLNLDNGTIRLSGSGTTRIFVNQDVKLVNTVSINANNQGSLIWVNYNNMV
FT                   IDNSTTFYGYLYTDGLLNMNNNATVYGKVTAGYLKMDAQSSINTAVLPPMLTCFADGFD
FT                   SAQINPDSWVVAQRNNSTLPSVQNGRLRLTQNITDQATSATFQRLFPGAGNLVTVEFDQ
FT                   YAYKTSGTSGADGMAVVLSDATLTPQPGAFGGPLGYGYKTGISGFAGGWLGVGLDEYGN
FT                   YANEGGSTNLGSRPQAVSIRGSGSGTSGYRYLTGTASNLNPPVDSGTNGNRPHRYRITV
FT                   DSRVAGSSLATVERDTGAGYSSLIGPINMTSQTGQAAVPANFLLSLTGSTGSVTNFHEI
FT                   DNVRICALRSNPVGVQIDHFQLDHSGQALTCNPETVTVKACADAACTTLITDPVTATLS
FT                   LEPVSSSNGWVGGNTVTFSGGSTTVQLRNNTATSVTIGVSGSVPATKPFSTTLCKAGAG
FT                   TPSAAACTLNFADSGFFFDVPDTYSNQPQTVAIKAVKKSDVTKQCVPGFANQSKSVKFW
FT                   SSYVSPASNNYNSRMSVNNSVIGTSQGNATALSLSFDAQGQSSMTVKYPDAGKVQLDAR
FT                   YDGTGSEAGLVMLGSDQFVARPVGLCITPPQGVCAAGDSSCPVFKKAGDTFQVDIKAMA
FT                   WESVNDGDICAGNQTTPNFVLSNIALGSTLVAPNPGTNAAVGTATYNHVPASNSLNSVT
FT                   QTVSEVGVFRMTATPQANAYFTYTIPPASSVPVGRFVPWDFNLFSGTVTPACGGFSYMS
FT                   QPFGVKMRLQARNKQGGVTLNYRDAFARGLLYLVAADNKDGIDRTDRIGSLATNWQAGE
FT                   VIFDGSSRFARLAERTPSLTTPEEPFFKLRFGLRVIDGENPSITTLTGMNMNTGVSGDC
FT                   QVGVTCNAKQLSIPAVIDDTMVAYYGRVLAGTDRGAASEPLSLSLLMQYYQNGAWSRNE
FT                   ADVCSTLSLANDGVLFTDDTQHYDVASGDLVLGTTARIRVGLGAPSPGAVVGKADKGEL
FT                   LFHFGAPQFAVRVPYSIVLEKQPQQPRWLADPGNLNSLLGEAIFGSSRGNDRIIYRREV
FT                   MH"
FT   gene            422371..423411
FT                   /gene="mreB"
FT                   /locus_tag="AHA_0400"
FT   CDS_pept        422371..423411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="AHA_0400"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39102"
FT                   /db_xref="GOA:A0KFA7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA7"
FT                   /protein_id="ABK39102.1"
FT                   /translation="MFKKLRGVFSNDLSIDLGTANTLIYVKDQGIVLNEPSVVAIRQER
FT                   GNAKSVAAVGHAAKQMLGRTPGNISAIRPMKDGVIADFYVTEKMLQHFIKQVHDNNYFR
FT                   PSPRVLVCVPCGSTQVERRAIKESALGAGAREVYLIDEPMAAAIGAGLPVSEATGSMVV
FT                   DIGGGTTEVAIISLNGVVYSQSVRIGGDKFDEAIISYVRRNYGSLIGEATAERIKHEIG
FT                   SAYPGEEVREIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPPEL
FT                   ASDISERGMVLTGGGALLKDIDRLLMEETGIPVVVAEDPLTCVARGGGKALELIDMHGG
FT                   DLFHYE"
FT   gene            423454..424359
FT                   /gene="mreC"
FT                   /locus_tag="AHA_0401"
FT   CDS_pept        423454..424359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="AHA_0401"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by match to protein family HMM PF04085;
FT                   match to protein family HMM TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36685"
FT                   /db_xref="GOA:A0KFA8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA8"
FT                   /protein_id="ABK36685.1"
FT                   /translation="MKPIFGRGPSLQLRLFLAVIISIAAIVADSRFGVFSHVRVYLSSL
FT                   VSPLQYMANAPGIMLDTMSTQVQTRAGLIEQTKQQEQQLFTLRSRLLKMDHLEHENQRL
FT                   RELLGSPVHKESRKMVAELLSVDSDPFSHQVLINKGALDGVYNGQPVINDQGVIGQVLH
FT                   VGSTTSRVLLITDSSHGIPVRVLRNDLRAIASGSGELDKLELRNLPRNTDVQVGDLLVT
FT                   SGLGGRFPEGYPVATVTRSDYVEGKPFAQVEAKPLVALDRLRYLLLLWTDKKPEVHDDE
FT                   EAPTPAAAPAAAPSAAGATR"
FT   gene            424359..424844
FT                   /gene="mreD"
FT                   /locus_tag="AHA_0402"
FT   CDS_pept        424359..424844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="AHA_0402"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by match to protein family HMM PF04093"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36991"
FT                   /db_xref="GOA:A0KFA9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA9"
FT                   /protein_id="ABK36991.1"
FT                   /translation="MLQPASGRIWIWISILLALSLSILPLPFQLEPFRPDWLAMVLIYW
FT                   ALALPHRTNVGTAWVAGLLLDVLLGSTLGVRAMAMAITTYLAAFQFQKIRNFSLWQQAL
FT                   IIGCLSLVGKVTIFWAEHLFSRASLNFAYFWSTLSTMLIWPWVFLVLRKVRRRFNIK"
FT   gene            424896..425483
FT                   /gene="maf-1"
FT                   /locus_tag="AHA_0403"
FT   CDS_pept        424896..425483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-1"
FT                   /locus_tag="AHA_0403"
FT                   /product="septum formation protein Maf"
FT                   /note="identified by match to protein family HMM PF02545;
FT                   match to protein family HMM TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37586"
FT                   /db_xref="GOA:A0KFB0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB0"
FT                   /protein_id="ABK37586.1"
FT                   /translation="MNKHNELQLYLASGSPRRHELLTQLGYRFEVLKLDVPEQREEGEK
FT                   PQDYVCRLARDKATAGVAAAPTALPVLGADTIVVLGDRVLEKPSDLLDAKDMLEALSGK
FT                   VHQVMTAVALATPERCDVRLVTTNVAFRKLDEAEIEAYWRTGEPCDKAGAYAIQGIAGK
FT                   FVSRIEGSYSAVVGLPLLETDLLIKHHLEQSR"
FT   gene            425670..427139
FT                   /locus_tag="AHA_0404"
FT   CDS_pept        425670..427139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0404"
FT                   /product="ribonuclease G"
FT                   /EC_number="3.1.4.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37871"
FT                   /db_xref="GOA:A0KFB1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB1"
FT                   /protein_id="ABK37871.1"
FT                   /translation="MSVELLVNVTPSETRVALVENGLLQEVHVERQAKRGIVGNIYKGK
FT                   ISRVLPGMQAAFVDIGMDKAAFLHASDIVPHTECVAVKEKEQFQAGNIAELVRQGQDIM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGSAHVGVSQRIESEAERERLKRTVAGYVD
FT                   ELGGYIIRTAAEGVGEQELEQDAAFLKRLWRKILERKQKYPPCKILYEDPSLAFRVVRD
FT                   FVGAELDKIRVDSRQSFDQLKRFTEEYVPELANKLEYYSGESPIFDLYDVENEIQRALE
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNVEATAAIARHLRLRNL
FT                   GGIIIIDFIDMQSEDHRRRVLHSLEQALSKDRAKTNVNGFSQLGLVEMTRKRTRESLEH
FT                   VLCSECPECKGRGRVKTVESVCFEILREIIRVNRAYDADQFTVYAAPAVADYLRGEESH
FT                   SLAELEVFIGKQVRVVSEPLCGQEQFDVVMM"
FT   gene            427170..431039
FT                   /locus_tag="AHA_0405"
FT   CDS_pept        427170..431039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02099"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38887"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB2"
FT                   /protein_id="ABK38887.1"
FT                   /translation="MALGVFFVLLAILVSLVRFGGPLLNQHRQALLNTLLADSKLEASV
FT                   DRIGLDWTQLGPALELQQLVIAPNSGRFALRLGKVWAHLDFWRSLNELKPVFGQLILSD
FT                   GDIALDLGQPAEPETGNGSDQQQALLRFLLTQLSTFDIHDTRLSLTTALGEVRALDIAQ
FT                   LRWQNRGKRHQGVGKAYLINGVGESTLDLIVDVDAPQVRLDRLKGQLYLGARQLDISPM
FT                   LARTHSGEPKVSGQLDFQLWSEFKAGQLGDSLLAFGDNYLIWQDEKQGDLHRLGLQGGK
FT                   IQLRRDGKEWQFASHDVTFKLDGKPWLHSRLQLERVGDRIQGYVPAIDLDQIANLSQLV
FT                   SGIYPELTETLKRTRPTGKIQDLILQADAGWQGLSVSGQLSHIRVNAWHDVPGVRDLNG
FT                   EFWLTPTGGSARLQLANDAIDPARHFKEPIPIDRFSARLDWWQVPQGWVLYGQDLVLDN
FT                   PDLSLASRFRLDLFEHPFLALTGRIDVKNAANADRYYPLQVMDKSLVDYLSGAIKGGKA
FT                   KGADLLWYGEFRDFPYRKGEGIFQVAVPLQQASYEFFPGWQPLTDLQIDLLFQNASLDM
FT                   NSRATQLGKASSDSVHAWIPDLYPGAHLYVDAKVEGEGKAISDYLQDSPLGGSVGQALR
FT                   EVEIRGPMKGSVKLDIPLDGESEVKASGDALFSNNKVRVTSLDLPLEQVQGRLEYDNEQ
FT                   TRFSNLKASLWNQPLTLDYQGRQQPNRYQVDLKFKGQWDSRRQRQDIPALDILKGRGNW
FT                   AGSLGLTLPGDQPFSFQLALDSNLQGMGLDLPAPLAKAAGSRLPLKVTARGRDGSADIR
FT                   AVLGADVDMQSRLVYGDGVPYLSRVRVDVGQPGARVLRDRPMLLAINQQQADVAGWLAR
FT                   LKQWLPASTAPSGNAVVGPSFLPQEWWVDGRLARADIGSANLKAVHFTVGPVNQATEVM
FT                   IDSPDVMGVVRLPVSERQPIDAKFARIHWSGKSSDLSPDPDARQDRAIMDAIPWLTFSC
FT                   VDCRFGELPLGEVKGELIPGADKLSLKGLEMRLAGSQLNGSAEWLAGADGMQTRARAHI
FT                   SSNNSELLLKRLGYTSPIGDAPGKMALDLSWRDVPYRPNVPTLSGTADYQLEGGTLREV
FT                   NDKGARLLSLLSLDSLLRKLRLDFRDVFDKGFYFESMSASAKIKQGVVDNRDFYMKGAA
FT                   GNLRGEGIADLVRWRLDYELSFSPNLGGTLPVVAAFSLTPITGLYVLALSKLLEPVVDV
FT                   VTRIDFRVSGPLDDPKLIEAGRDRARIKLNQQQKEAVDAVAPNLPTQEVTPFLLTPKHA
FT                   GPAQR"
FT   gene            431074..431394
FT                   /locus_tag="AHA_0406"
FT   CDS_pept        431074..431394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0406"
FT                   /product="stress responsive A/B Barrel Domain superfamily"
FT                   /note="identified by match to protein family HMM PF07876"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39490"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB3"
FT                   /protein_id="ABK39490.1"
FT                   /translation="MIRHILLIAFKPGTQPAQIDAVRAAFLAIPHQVSGVLAVEWGRDD
FT                   SPEGRAEGFTHSVLMTFADEAARQRYLPHPDHDALKAIFRPVLERIIVLDYTLQAGDAV
FT                   SI"
FT   gene            431423..432229
FT                   /locus_tag="AHA_0407"
FT   CDS_pept        431423..432229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0407"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39820"
FT                   /db_xref="GOA:A0KFB4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB4"
FT                   /protein_id="ABK39820.1"
FT                   /translation="MWLAAIQLVSGRRWQDNREQIAAELALLPSERPLLVLLPENFALF
FT                   GERQGYLDGAEAIGAGPIQAQLAEWARDYGIWLVAGAMPTTIAGSDHIHTSTLVFDPSG
FT                   ERKGHYHKIHLFDVDVADNHGRYRESETFSPGEEPVLVDSPFGPLGLSICYDLRFPELY
FT                   RRLARAGARVLLVPAAFTAVTGEAHWEPLLRARAIENQCYLVAANQGGTHETGRQTWGH
FT                   SMVIDPWGRVLASLDSGRGTVLAPLDPGLVDELQRTMPVLGHARLL"
FT   gene            432389..433828
FT                   /gene="tldD"
FT                   /locus_tag="AHA_0408"
FT   CDS_pept        432389..433828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="AHA_0408"
FT                   /product="protein TldD"
FT                   /note="identified by similarity to SP:P46473; match to
FT                   protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36234"
FT                   /db_xref="GOA:A0KFB5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB5"
FT                   /protein_id="ABK36234.1"
FT                   /translation="MSQVSASLLAPHDLDEGRLQQLLGSLMSHQVEFGDLYFQRSWHES
FT                   WMLEDGIVKDGSYNIDQGVGVRAVSGEKTGFAYSDELSLLALQQSVTAARGIAAAGAQG
FT                   KVKAWARTEANLLYPALDPLQTLDKQQKIALLEQMDKFARSLDPAINQVMASISGVYEE
FT                   VLVAATDGTLAADVRPLVRLSVTVIAEKGDRRERGSAGGGGRFGYDYFLELDGLESRAF
FT                   GYVREAVRQALVNLDAIDAPAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNRKGSSAFAG
FT                   RIGEQVASKHCTIVDDGTLPGRRGSVSIDDEGTPGGYNVLIENGILKGYLQDKQNARLM
FT                   GVPLTGNGRRESYAALPMPRMTNTYMLAGQYDPAEIIASVKKGIYAPNFGGGQVDITSG
FT                   KFVFSASEAYLIEDGKITAPIKGATLIGNGPEAMSQVSMVGKDLALDRGVGVCGKEGQS
FT                   VPVGVGQPTLKLDQLTVGGTQ"
FT   gene            433861..434721
FT                   /locus_tag="AHA_0409"
FT   CDS_pept        433861..434721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0409"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37300"
FT                   /db_xref="GOA:A0KFB6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB6"
FT                   /protein_id="ABK37300.1"
FT                   /translation="MLTLSKISNIRSQLSPSELKIADYILACPEQVTHFSSQELAQQAD
FT                   VSQSSIVKFTQKIGFKGFTAFKLAVSEDLGRKHAIKTDNVGDLYNGIGRDDDLETMAKK
FT                   LAQEKINSIVETTQALDNATLARVLDVINQAGRVQLVGIGGSALTAKDLWYKLLKIGVT
FT                   TLFAQDSHVQISIAQTLGPGDVQLVVSYSGASRDVLAAAELAKRNGATLIAVTSFRNTP
FT                   LRQMADMVLDTVADENELRISSISSRTAQNTITDILFLGLVQRRDEAWALIDGTRGAID
FT                   RLNKE"
FT   gene            complement(434809..435414)
FT                   /locus_tag="AHA_0410"
FT   CDS_pept        complement(434809..435414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37636"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB7"
FT                   /protein_id="ABK37636.1"
FT                   /translation="MIHLPLLTTLLLLLALPTQAARLELADNLTLLASSRGKASPFERA
FT                   LTLPAGETRLLVRFDSPLDPGSTNESQGRVRSAPLLLTLTLPASGTLRLVTPPLPTPQA
FT                   IRRFAASPALQLATADGTRPLLTTALPRSQDSLLTDYQALLARYDGSASAATALPAVTP
FT                   VLPAATPGAVPVDPELQRRYLAADEAQRKAFLRWALAL"
FT   gene            complement(435464..436537)
FT                   /locus_tag="AHA_0411"
FT   CDS_pept        complement(435464..436537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0411"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39609"
FT                   /db_xref="GOA:A0KFB8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB8"
FT                   /protein_id="ABK39609.1"
FT                   /translation="MKQSMLALAIPALLAVGTAQAAVIYQADDGSNVDLYGRLGFNISD
FT                   KKSGNDQGDFDGRIGFTARQTVNEQVAVIGMAQYQVNAAEYANNVQKNSSDLTARYVWA
FT                   GLDGGQWGKLTGGRVSSGLIMFTDIGDVFAASDVSMARQASKVDSTAVQVFRQDGTLQY
FT                   QNTLGNLDLSLAYILGNGTSDLDYGYNGALRYTFDLGAAGKLAPVIAYQQSKAAQTGAS
FT                   KVDPNADEYRFSGIGTRYTLGPLMLGALYAKDQVSYRNGQADSEDKVWELTAVYDINQK
FT                   WAARAGYRHLDNDGGDGMSLRDTTLELQYKLTPRSSLYSAYVFRGGEDGLAGSTVTSFG
FT                   GSSNSEDFYHLGLRYEF"
FT   gene            complement(436639..438093)
FT                   /locus_tag="AHA_0412"
FT   CDS_pept        complement(436639..438093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0412"
FT                   /product="PTS system, IIBC components"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35861"
FT                   /db_xref="GOA:A0KFB9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB9"
FT                   /protein_id="ABK35861.1"
FT                   /translation="MAKITDTMVGQLIQAIGGRDNITHCGHCMTRLRLSLADSLHADRD
FT                   TIKRIAGVMGVIESDDQFQIVLGPGKAQTACELMNGMLSAGLGALEAPTAQSADLGEIA
FT                   AAKKQALKQKQTSAAHRFLAKFATIFTPLIPGFIAAGLLLGFATLIEQTLLLEGQQAGG
FT                   MLAEFVGYMKLFSKGLFSFLSILIGYNAQKAFGGSGVNGAILASLFVMGYDPQATSGIY
FT                   AGVSDFFGHQIDPRGNIIGVLIACIIGASVERQVRRFIPDSLDMILTSGITLLIMGAVT
FT                   FVLIMPLGVQLYNGMSWLFIHLNGNPFGTAILAGLFLISVMFGIHQGFVPVYFALMDAQ
FT                   GFNSLFPILALAGAGQVGAALALYSRAGKDSLLRTQVKGTIIPGILGVGEPLIYGVTLP
FT                   RVKPFITACCGGALGGFLVGLISWLGLPVGLNTVFGPSGIVALPLMTSAQGIFPGMLVY
FT                   AAGLAVAYLGGYLITLMFGCKNVDLS"
FT   gene            complement(438193..439089)
FT                   /locus_tag="AHA_0413"
FT   CDS_pept        complement(438193..439089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0413"
FT                   /product="putative glucokinase regulator homolog"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM TIGR00274"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36652"
FT                   /db_xref="GOA:A0KFC0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFC0"
FT                   /protein_id="ABK36652.1"
FT                   /translation="MTIDLSSMITETRNPASVEIDQLPTLEMLRVINQEDQQVALAVSQ
FT                   LLPEITRAVDAIAAAFGKGGRLVYIGAGTSGRLGILDASECPPTYGVSAEQVVGLIAGG
FT                   HKAILQAVENAEDDAELGAQDLKNIQFCANDVLVGIAASGRTPYVLGAMAHARAVGATV
FT                   CSISCNPGSPLAQAADISMVAVVGPEIVTGSSRMKAGTAQKLILNMLSTGAMIRTGKVY
FT                   GNLMVDVEATNAKLVERQKRIVMEATDCERAVAERALAQADNHCKTAIVMILAGLTADE
FT                   ARTRLQSSNGFISQCTH"
FT   gene            complement(439353..439607)
FT                   /locus_tag="AHA_0414"
FT   CDS_pept        complement(439353..439607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0414"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36984"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC1"
FT                   /protein_id="ABK36984.1"
FT                   /translation="MLGKFMDGHPLTSGDVQMEKMLTEIGSYSLFHEYLNVVGAASPAL
FT                   TRIKSRWEYKQSDRLVAQIRVDQQGNARFFIDARAISVN"
FT   gene            complement(439717..440436)
FT                   /locus_tag="AHA_0415"
FT   CDS_pept        complement(439717..440436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01914;
FT                   match to protein family HMM TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38158"
FT                   /db_xref="GOA:A0KFC2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC2"
FT                   /protein_id="ABK38158.1"
FT                   /translation="MMFFQVVFLALLALLPMVNPPTTATLLLGLSKGMSREHVRRQINL
FT                   AAIYLFCTLCVSFFIGSSILDLFGISIPGLRLAGGLIIAFIGFRMLFPAPSQAAGVDIN
FT                   QSIAFVPLTMPSMCGPGTMALVISGAAQIAELPDEYNRFTIYAAMVTAFALMSLLSWGV
FT                   LKLADPVCKILGATGIDAMTRIMGFLLVCMGMQFCINGIKEVAQDPVFHGAPAAQTAPA
FT                   LPHVSGALDQLPDPRQP"
FT   gene            complement(440568..441884)
FT                   /locus_tag="AHA_0416"
FT   CDS_pept        complement(440568..441884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0416"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38737"
FT                   /db_xref="GOA:A0KFC3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC3"
FT                   /protein_id="ABK38737.1"
FT                   /translation="MTTVTPAYDHSRPLNRQDYKTLSLAALGGALEFYDFIIFVFFAVV
FT                   IGELFFPADIPEWLRQFQTFGIFAAGYLARPLGGIIMAHFGDLIGRKRMFTLSILLMAL
FT                   PTLLIGLLPTYATLGIAAPLLLLLLRILQGAAIGGEVPGAWVFVAEHVPARRVGVACGT
FT                   LTAGLTAGILLGSLVATAINRGMSPSEVSDWGWRLAFVLGGAFGIVAMYLRRWLHETPV
FT                   FAEMQANKALAEELPLKTVLRSHKGSVVVSMLLTWLLSAGIVVVILMTPTYLQKVHGIS
FT                   PADALTANSLAILALTFGCIVYGRLIDALGSGPTFMLGSLLLAGASYAFYHGLATDTSQ
FT                   LVPLYALAGFSVGIVGAVPYVMVNAFPAVVRFSGLSFSYNVAYAIFGGLTPMLVTLWMK
FT                   EDVLAPSHYVVSLAALGFVLGLLLWLQQRSQRQSAPQAA"
FT   gene            442132..442803
FT                   /locus_tag="AHA_0418"
FT   CDS_pept        442132..442803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0418"
FT                   /product="domain of unknown function DUF71"
FT                   /note="identified by match to protein family HMM PF01902"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38452"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC4"
FT                   /protein_id="ABK38452.1"
FT                   /translation="MKTKVLLSWSSGKDSAWALHALRQDPAIEVVGLFTTLNQAFERVA
FT                   MHGVRKQLLLAQAECVGLPLTTIDLPWPCSNEDYARIMTDFIADVVAQGIRHMAFGDLF
FT                   LEDVRAYRERQLAGTGITPLFPLWGSKTDELAGEMMAAGLRARISTLDPRKLPATLGGH
FT                   EFDGALLAALPAGVDPCGENGEFHTLAWDGPMFQRPLAIRVGETVERDGFVFTDLLPAT
FT                   I"
FT   gene            complement(442800..444002)
FT                   /locus_tag="AHA_0417"
FT   CDS_pept        complement(442800..444002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0417"
FT                   /product="regulatory components of sensory transduction
FT                   system"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39902"
FT                   /db_xref="GOA:A0KFC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC5"
FT                   /protein_id="ABK39902.1"
FT                   /translation="MPWHICNKSGPSGPICSTKSEATIMLNLLDPDTKPTLLVVDDTPE
FT                   NLSLLSALLSPHYRVKVAISGQRALEILSAGTRVDLILLDVVMPQMDGYQVMQALQEMP
FT                   QAREIPVIFLTAKVEESAEAHGLALGAVDYIHKPITPAIVLARVRNHLELKAARDLLHD
FT                   QNAFLEQEVERRTRENELIQNITIHSLASLAETRDNETGNHILRTQHYVRLLAETLCEH
FT                   PRFRAELTPKTIDLLFKSAPLHDIGKVGVPDRILLKPGKLDADEFAQMKHHSILGKEAI
FT                   VHAEEALGVEVEFLRLAKEIACYHHEKWDGTGYPYGLIGDEIPLSARLMALADVYDALI
FT                   SKRCYKAAMSHQEVVPIILAGRGNHFDPDITDAFARIHQQFHEIALRYNDDKGERESNR
FT                   D"
FT   gene            complement(443941..446607)
FT                   /locus_tag="AHA_0419"
FT   CDS_pept        complement(443941..446607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0419"
FT                   /product="hybrid sensory kinase"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36886"
FT                   /db_xref="GOA:A0KFC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC6"
FT                   /protein_id="ABK36886.1"
FT                   /translation="MRQLIGETLLSGPAAALTARRKVIQVLTCLDRSPTFVAPLAGATS
FT                   ELVRQLVANAEPLQLQVWLEPHAQELWLSLSANAPISPEPDGRHSRGIRLVAHADNAIA
FT                   LVYRLPRWPDEPLLQQMQRQFAEPTRDELFAVMQAKNQELEVAYELAEGATRAKSDFLA
FT                   NMSHEIRTPMNAILGMSHLALQTRLDPQQFDYVSKIQRSAQHLLGIINDILDFSKIEAG
FT                   KLDLERIEFDLDHVLENLATLVGEKAEAKGIELLFEVDHQLDTLLYGDPLRLGQILINY
FT                   ANNAVKFTEQGEILVKVSCLEKQPQEVLLHCSVQDTGIGMSQEQQQRLFQSFQQADSST
FT                   TRKYGGTGLGLAISRKLAELMGGEVGVQSEPGRGSTFWFTARLGRGRRRSRYLPSLDLR
FT                   GRRMLVADDSASARTIMAALLRSMSFVVDTAESGQQALQMIAGAEQEGQPYEVVLLDWH
FT                   MPGLDGIETGRRLIARGMGQRPYRVMVTGYGREEVFRQADTAGFDRVLVKPVCASVLFD
FT                   TVIGLFGQQASPLTFKPPQATHHYRFDGLRILLAEDNELNQQVALELLRAVGADVSIAG
FT                   NGAIALEMVAQTHYDLILMDMQMPVMDGLAATRLLREREDVGQHTPILAMTANVMAGDR
FT                   ERCLAAGMDDHIAKPIDPDRLYAALQRWATSFSREVSSRLTASRASPATALLPQLRALG
FT                   LNAETALQRLMHNWEWYRDLLQRFARQGSQPMETLLAALQANDREEAHRQAHTLKGIAA
FT                   TLGAGSLQELSARLESALARGDDAASLLPLAELGLQQQQQLAAGLLTLLPAPAAAGLPE
FT                   ATPAELAPLLHQLTGLLLEDDAEAFILFQRNQARLAPLLGEAAPAMHDAMTRFRFADAL
FT                   AHLQQVRALRPDLFNQE"
FT   gene            complement(446608..447678)
FT                   /locus_tag="AHA_0420"
FT   CDS_pept        complement(446608..447678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0420"
FT                   /product="TorS-related protein"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37498"
FT                   /db_xref="GOA:A0KFC7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC7"
FT                   /protein_id="ABK37498.1"
FT                   /translation="MQLEQSVLEASYPLRHDIDLHLTVMAVRRLPFIANLSEVDRAMLS
FT                   TVVSELGSNILKYAERGEITLTLHHPRGRPCIDIVARDQGPGIGDVHQAMQDHYSTSGT
FT                   LGLGLPGVRRMMSELTISTPPEGGTLVQARKWLGAAPLVSRPIAPLASAGQLHAGLQLA
FT                   WASENRPCYPERVSGDLAFIRPGPEGVSLILIDVSGHGASANKLVQVLEAALQQTHEQE
FT                   PARLLQLLHQHCIGTRGAAAGVALVNGERGELSYAGIGNTRICLRGREPWRGISRDGVL
FT                   GERFPTPLLQRQPLVAGDVVMLYSDGISESLNLRDGALDLAAEPAQLARQVIAHSGRST
FT                   DDASCIVLRVLAGEED"
FT   gene            complement(447685..448059)
FT                   /locus_tag="AHA_0421"
FT   CDS_pept        complement(447685..448059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0421"
FT                   /product="sigma-B regulator RsbS"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37841"
FT                   /db_xref="GOA:A0KFC8"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC8"
FT                   /protein_id="ABK37841.1"
FT                   /translation="MLLNNDLGIADVADCIVVSMRPDLGDEGMQQLMQALSQRLMLGRQ
FT                   HAVLLDFSGVMLLDHHEFRQVRKLAEVCRLLGAVCLLVGLNAGIAAFLALADAEPGPLR
FT                   CFLDMDDAFAHVRTTLKDEE"
FT   gene            complement(448069..449460)
FT                   /locus_tag="AHA_0422"
FT   CDS_pept        complement(448069..449460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0422"
FT                   /product="chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF01740; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37271"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC9"
FT                   /protein_id="ABK37271.1"
FT                   /translation="MRVVAIPEVHDELPKSKAHPPAGSFGTSCPPLSPRWAITAVRLLM
FT                   TFKSIAPFIGDAMDVHTAAAHSNTVTPASPQARLEAIDQLMARLELAPDGLILDANPRF
FT                   LAIMGYQLAELKGQHYSMLLPAEAEESAEEVARWQALRTGQVQEGEFHRLDRQGRDIWL
FT                   RGSCSPQLDEQGALIQVIEYSMDLTEQKQLNANFEGQLNALSRVMGKVEFSLDGIILDA
FT                   NARFLETVGYQLEELKGQHHRLLVDPDYAQSADYRSFWETLRRGEFLAGEFCRLGKQGE
FT                   EIWIQGSYNPVLDLTGKPSKIVKFATDITAQVAQHRQLKRAMEEAEEAARVREELHKSL
FT                   QEMSTPVTPIWDGILLLPLVGIIDSMRTADVMNKSLTKIAETRARVFVLDIAGVATVDT
FT                   GVANQLIKITKATQFMGCEAIISGVSPAIARTMVELGVSVGDIRTTATLRDAFEIALKR
FT                   VGSTL"
FT   gene            449431..450123
FT                   /locus_tag="AHA_0424"
FT   CDS_pept        449431..450123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0424"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37878"
FT                   /db_xref="GOA:A0KFD0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD0"
FT                   /protein_id="ABK37878.1"
FT                   /translation="MNLWYRDYPQGALTALHCHGGSQFCYLHRGGGVISSQAAGVLLVA
FT                   GQLCLIPAGLAHEFRVLRHSRLSLIYLDDLDGGSELTTRQVSPLLAGLFERLADMAEPG
FT                   LRDAYLTVLAAELRQAPVAAGFMLSAALDVRLLRVLERVCRHPSIEYGLAELAADSGAS
FT                   VRTLNRLFSQQLGCSFRQWRQQVVMGRARQLQQQGQPLSRIALELGYGDFSAFSHAFNR
FT                   FLREPAGP"
FT   gene            complement(450089..450508)
FT                   /locus_tag="AHA_0423"
FT   CDS_pept        complement(450089..450508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38431"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD1"
FT                   /protein_id="ABK38431.1"
FT                   /translation="MDYKQRLQDCLNRVICDPDFTPAELDHWFCPDYVQLVDDQRLDRA
FT                   AFEQHLLVLRQSLARCEIHFVSLLAEGNRVHSQHRVRAWRHDGAQIECKVSALFTFQGE
FT                   RLSHTDELTCLLAGEPADRDLGSRLTAPPAPARSD"
FT   gene            450541..451434
FT                   /gene="aphA"
FT                   /locus_tag="AHA_0425"
FT   CDS_pept        450541..451434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="AHA_0425"
FT                   /product="HAD-superfamily (subfamily iiib) phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF03767;
FT                   match to protein family HMM TIGR01672"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39054"
FT                   /db_xref="GOA:A0KFD2"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR010025"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD2"
FT                   /protein_id="ABK39054.1"
FT                   /translation="MGPVVGTGLGAHAMLFGDCAKMGACRGDACHLALFCGGFHGFRCR
FT                   HGAGSAPCFLHVTSRIMSLSPRFALLASLVAASLTLPAVAVEAPASPAGVTAVTLAQQA
FT                   PIHWVSVTQIAKSLDGLPPMAVGFDIDDTLLFSSPGFYRGKQEFSPNDESYLKNPAFWE
FT                   KMNNGWDAFSVPKEVGKALIAMHLERGDHIYFVTGRSATKTETVSQTLQQTMNIPADQL
FT                   NPVIFAGDQPGQNTKVQWLKEKQMKIFYGDADGDIKAAQELGIRGIRLLRSANSTYRPL
FT                   PLAGALGEEVIVNSQY"
FT   gene            complement(451497..452342)
FT                   /locus_tag="AHA_0426"
FT   CDS_pept        complement(451497..452342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0426"
FT                   /product="zinc protease"
FT                   /note="identified by match to protein family HMM PF04228"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38453"
FT                   /db_xref="GOA:A0KFD3"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD3"
FT                   /protein_id="ABK38453.1"
FT                   /translation="MRWQDRRESNNVEDRRQQGSGGGIPIGGKGRLILLVVVMVAGYYG
FT                   VDLSPLLSEPTTQSQPQRQEMSQPAKDPLARFTSVMLASTEDAWGEIFQQSGSRYQAPK
FT                   LVLYRGATRTGCGQGQSVMGPFYCPADRTVYIDLSFYQEMRDKLGADGDFAQGYVVAHE
FT                   VGHHVQNLLGIERKIREQQQGLSRAEQNKLSVKLELQADCFAGVWGHYMQQEQVLEHGD
FT                   LEEALNAAQAIGDDRLQQQSQGRVIPDSFTHGSSAQRYAWFKRGFDSGKPASCNTFAAR
FT                   "
FT   gene            complement(452450..452713)
FT                   /locus_tag="AHA_0427"
FT   CDS_pept        complement(452450..452713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36698"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD4"
FT                   /protein_id="ABK36698.1"
FT                   /translation="MSEPTEFFDEQTLLEMVDNQLSDGHPLQVKATLMRLVMKGTPREE
FT                   TLQYIACALGAELMAMEADQGPFNLERYGQFLDSLPEMPWAE"
FT   gene            452830..453708
FT                   /locus_tag="AHA_0428"
FT   CDS_pept        452830..453708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36120"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD5"
FT                   /protein_id="ABK36120.1"
FT                   /translation="MGLLSANNNHHKIAWTDINMPTIDSLLSKPQNLPNVPEVMRELVQ
FT                   TFNEKEPDILLIAKKINKDPVISAKLLRLANSAKFGGSRQVATVNEAVVRLGVDVVRNM
FT                   VLACGLTGSINAVPGIDLKHFWGKVFDVAELARRLAKLKGMKGEEVFTCALLYDMGRLI
FT                   MHVGLPENMVNHIKDLEPSKGRAKAEELVVGFNYAQTGAEMARRWQFPLSICHAVEYHY
FT                   NPLLAKEFSVEAALIHLAIALAAQSDVGDEAPPEWPAQVAERLGLSWSDCAAVFVALRE
FT                   QGNGYAGLLAA"
FT   gene            453826..454347
FT                   /locus_tag="AHA_0429"
FT   CDS_pept        453826..454347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0429"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37901"
FT                   /db_xref="GOA:A0KFD6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD6"
FT                   /protein_id="ABK37901.1"
FT                   /translation="MILSERLELRELTIADAPFIVELLNDPDFHRYIGDRGIRTLQDAE
FT                   NYIQQGPAVSYARHGHGLYLVARRSDGAKLGICGLIKRDTLPCEDIGYAFLPAYRGQGY
FT                   GIEAAQAALQDGRERLGIERVVAIVTPGNERSVALLAKLGLVQSRLVKLAEDADECLLL
FT                   EVQGAQACRV"
FT   gene            complement(454474..454650)
FT                   /locus_tag="AHA_0430"
FT   CDS_pept        complement(454474..454650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37846"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD7"
FT                   /protein_id="ABK37846.1"
FT                   /translation="MMKVVQTHKPLRRSKPINLPVQEHDDDGFLIQFSTRFSGGFAISC
FT                   DGIAGEFSIEDLN"
FT   gene            complement(455122..456399)
FT                   /locus_tag="AHA_0431"
FT   CDS_pept        complement(455122..456399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0431"
FT                   /product="NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38924"
FT                   /db_xref="GOA:A0KFD8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD8"
FT                   /protein_id="ABK38924.1"
FT                   /translation="MSVYYTLCFLAALAIFIAFANQYVVKIQTTIAITAGSMLISALLV
FT                   LFGKLGWFNLEPLAVKTMESIDFQNFLLKGILGFLLFAGGLGINLKALRSQKWEITILS
FT                   IVATLLSTFMVGYGFWFIAKLLGWELPLVYCMLFGALISPTDPIAVLAIVKKMKAPPQI
FT                   AIQIEGESLFNDGVGLVIFATVFAVAFGGVEPTFGSVAGLFLHEALGGILFGAVLGLIT
FT                   HVMISATDDGSLELLLTLCIPTAGFAFANMIGVSGALAMVVTGIMIGNWTRHSGFSEQS
FT                   SHHLDHFWELMDQFLNALLFLLIGLALVLLDLAWRDWILLVIAVPLCLAARFISVSLPY
FT                   MAFRRYRSYNKFSVRILTWGGLRGGLAMAMALALPSGVMMLPEHGVDLREVILVMTYSV
FT                   VMFSIVVQGMTITPMITAAKKASGHY"
FT   gene            456603..460286
FT                   /gene="metH"
FT                   /locus_tag="AHA_0432"
FT   CDS_pept        456603..460286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="AHA_0432"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM PF02310; match to protein
FT                   family HMM PF02574; match to protein family HMM PF02607;
FT                   match to protein family HMM PF02965; match to protein
FT                   family HMM TIGR02082"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39635"
FT                   /db_xref="GOA:A0KFD9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD9"
FT                   /protein_id="ABK39635.1"
FT                   /translation="MSNKKSDVTNKLEACLKERILIIDGAMGTMIQGYKLGEADYRGAR
FT                   FADWHTDIKGNNDLLVLTRPAVIREIHEQYCAAGADILETNTFNATRIAMADYEMEEFS
FT                   AEINCEAARLARAVADEWTAKEPHKPRFVAGVLGPTNRTASISPDVNDPGKRNVTYDQL
FT                   VAAYTESTHALIEGGADIILIETIFDTLNAKAAAFAVEGVFEALGYSLPVMISGTITDA
FT                   SGRTLSGQTTEAFYHSLRHVKPVSFGLNCALGPDELRQYVEELSRISETHVSAHPNAGL
FT                   PNAFGEYDLDAVEMAEHIREWAASGFLNLVGGCCGTTPTHIRAMADAVAGIKPRALPEL
FT                   PVACRLSGLEPLIITPESMFVNVGERTNVTGSAKFKRLIKEGLYDEALDVAKQQVESGA
FT                   QIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPVMIDSSKWEVLEAGLKCVQGKPVV
FT                   NSISMKEGEEKFIQQARLLRRYGAAVIVMAFDEVGQADTRARKFEICQRAYRILVDRVG
FT                   FPPEDIIFDPNIFAVATGIDEHNNYAVDFIDAVKDIKQNLPHAMISGGVSNVSFSFRGN
FT                   EPVREAIHAVFLYHAIQNGMDMGIVNAGQLAIYEDIPSDLKEKVEAVVLNLNPDATEAL
FT                   LAIAERYRGGGAQTEDPRDQAWRSWPVGKRLEHALVKGITDFIEEDTEEARSKAEKPLH
FT                   VIEGPLMDGMNVVGDLFGAGKMFLPQVVKSARVMKRAVAYLQPYIEAEKSGGSSNGKIV
FT                   MATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVSCETILKTAREVNADIIGLSGLITP
FT                   SLDEMVHVAKEMERQGFKLPLLIGGATTSKAHTAVKIEQNYSEPVVYVSNASRAVGVAQ
FT                   SLLSPELKPAFVARIDKEYEIAREQHARKQPRSKPVSLAHARANRHQLDWVGYQPPKPR
FT                   EPGVQTFEDVPVSVLRPYIDWTPFFLSWELAGKFPRILEDEVVGEEATRLYADANAMLD
FT                   QLEQDRSVRCAGIIGLFPANAVGDSIEVYTDESRREVRKVLHHLRQQSEKQGFPNYCLA
FT                   DYVAPKESGKPDWIGAFAVTGGIGEEAIAKAYKAEHDDYNAILIQAVCDRLAEAFAEYL
FT                   HEQVRKVHWGYAPNEALSNEELIRENYRGIRPAPGYPACPEHTEKGSIWELLGVEQAIG
FT                   MKLTESYAMWPGAAVSGWYFSHPDSKYFAVAQIQQDQVEDYAQRKGMTLAEAERWLGPN
FT                   LH"
FT   gene            460466..461422
FT                   /locus_tag="AHA_0433"
FT   CDS_pept        460466..461422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0433"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /note="identified by match to protein family HMM PF02655;
FT                   match to protein family HMM TIGR00768"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38151"
FT                   /db_xref="GOA:A0KFE0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFE0"
FT                   /protein_id="ABK38151.1"
FT                   /translation="MAPYTLPPHPAQALPSSGIVMKIAILSREPNNYSTRRLVEVAQAR
FT                   GHQVEVLDTLRCYMNIASHNPSIHYEGRELESYDAVIPRIGASITFYGTAVLRQFEMMN
FT                   TMALNSSVAISRSRDKLRAMQLLSRHGIGLPVTGYAHSTHDVPDLITMVGGAPLVVKLL
FT                   EGTQGIGVVLCETQKAAESVIEAFIQTNNNILVQEYIREANGADIRCLVVNGKVVAAMR
FT                   RQAQPGEFRSNLHRGGTAEAIKISPEERATAVQAAKIMGLDVAGVDILRSARGPLVLEV
FT                   NSSPGLQGVEAASGKDVAGKIIEFLELKASRKHKPAE"
FT   gene            461811..463145
FT                   /gene="brnQ-1"
FT                   /locus_tag="AHA_0434"
FT   CDS_pept        461811..463145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ-1"
FT                   /locus_tag="AHA_0434"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by similarity to SP:P37011; match to
FT                   protein family HMM PF05525; match to protein family HMM
FT                   TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38708"
FT                   /db_xref="GOA:A0KFE1"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE1"
FT                   /protein_id="ABK38708.1"
FT                   /translation="MNNQKLTSRDIVALGFMTFALFVGAGNIIFPPMVGLQAGEQVWGA
FT                   AAGFLLTAVGLPVLTVVALAKVGGGVDALSAPIGRKAGLLLATVCYLAVGPLFATPRTA
FT                   TVSYEVGLAPLFGDDGSALLIYSLVYFSLVIGISLYPGRLLDTVGHVLAPIKILALAAL
FT                   GLAVLLWPAGSAIPAVESYQHQPFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVSSA
FT                   KLLTRYTVLAGLIAGMGLTLVYLSLFRLGSVSGELVPHAQNGAEILHAYVQHTFGNMGS
FT                   GFLALLIFIACLVTAVGLTCACAEFFAQYLPLSYRTLVLLLGGFSMLVSNLGLSHLIQL
FT                   SVPVLTAIYPPCIVLVVLSFTLRWWGNGTRVVGPVMLISLLFGLIDGLKASALAGLLPA
FT                   WSLALPLNEQGLAWLPPSLCALLLAALWDRLQGRPQVASVSKSAA"
FT   gene            complement(463220..464431)
FT                   /locus_tag="AHA_0435"
FT   CDS_pept        complement(463220..464431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0435"
FT                   /product="sensory transduction protein kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37713"
FT                   /db_xref="GOA:A0KFE2"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE2"
FT                   /protein_id="ABK37713.1"
FT                   /translation="MSLPSLRRRLILTLSGAGLLLLVIISLLMVVAEDKMEELSLRHWL
FT                   EAEVTRYSDDWLRLGMAAPAPSPRQFSSYWTEAGRLPVWLKPYQSPGFYEHVLGDEDKH
FT                   FLVRPHPSGEGLLYLVFNDDADDYLDPYEDQLHLATRLIGLVLLLGCIGFGIWLVRHIT
FT                   RPLQRLQQRVAHLTPDQADFVPDAPWQELRDIELALLAGKQEVAAVFAREQEFSRFASH
FT                   ELRTPNMVIQGSAALLGKVSDLPAPAARATTRIRAAADEMALLTETFLLLGRKEPVERP
FT                   PQQVAPLIRQELARLAPLLQREELDIRLQLDDESEALAPLSLLAIALGNLLKNALSYAE
FT                   GHIDIELAGPVLTISNPTAAAPDQILGYGCGLTIIQRICEKLGWQIETRLEGGIFSARL
FT                   AMRE"
FT   gene            complement(464475..465746)
FT                   /locus_tag="AHA_0436"
FT   CDS_pept        complement(464475..465746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0436"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37522"
FT                   /db_xref="GOA:A0KFE3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE3"
FT                   /protein_id="ABK37522.1"
FT                   /translation="MRVIAKGPWSNRARFNYGPSCTIFPPAPRRPGSVILAAAAQAHAV
FT                   KLALQLQPASFERGQAVVRSDITPDPPLLHRPFQIHLVILLQLLDLPDQPQLALDHPFQ
FT                   VNPGTAEIVLSQPVLEAGLLIEHKGDAVDHQLAQLPGGAAGQFELRRLRSAKWQQDQQQ
FT                   ESAERLLHRGSSGLHCHTGCLIRCEMTVKCRSRPGDQSMKILVVEDNPQVAETIMDYLE
FT                   LAGHRLDCAYHGQAALQLLAEQRFDVIIMDVMMPRLDGLSTVARLREQGIPTPVLFLTA
FT                   RDSLDDKLAGFKAGGDDYLVKPFAMEELEVRLQALALRGPRSDMGALCVGELTLDPASG
FT                   RATRAGVELKLGKIPFQILTLLARRAPALVTRQEVLDTVWGDEEPDSDALRSHIYALRN
FT                   ALDKPFPTPMLETLHGQGYRLVTP"
FT   gene            465736..466215
FT                   /locus_tag="AHA_0437"
FT   CDS_pept        465736..466215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35842"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE4"
FT                   /protein_id="ABK35842.1"
FT                   /translation="MTRTSLLLLTLPLCALAADGELWLVELEHNDGLRLQFQGAELELG
FT                   NAALSGVAGNDELRPGMRLAILSRDGVAERIGMADAIAGFLPTSQWRRAEASLLAVTGR
FT                   ALRLQGLGVLAFDDDTRWLNGSPADLQPGRKLVLSRNEQGCLTEILIANPEDEPE"
FT   gene            466510..467991
FT                   /locus_tag="AHA_0438"
FT   CDS_pept        466510..467991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0438"
FT                   /product="hemolysin"
FT                   /note="identified by match to protein family HMM PF01117;
FT                   match to protein family HMM PF03440"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36425"
FT                   /db_xref="GOA:A0KFE5"
FT                   /db_xref="InterPro:IPR005138"
FT                   /db_xref="InterPro:IPR005830"
FT                   /db_xref="InterPro:IPR005831"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR037015"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE5"
FT                   /protein_id="ABK36425.1"
FT                   /translation="MQKLKITGLSLIISGLLMAQAHAAEPVYPDQLRLFSLGQEVCGDK
FT                   YRPITREEAQSVKSNIVNMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPV
FT                   TGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDM
FT                   DVTRDGDGWVIRGNNDGGCEGYRCGEKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKT
FT                   VVGWAINDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIE
FT                   IAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLT
FT                   LSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWT
FT                   IQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAADSKVRRTRSVD
FT                   GAGQGLRLEIPLDAQELSGLGFSNVSLSVTPAANQ"
FT   gene            468494..470485
FT                   /locus_tag="AHA_0439"
FT   CDS_pept        468494..470485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0439"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39508"
FT                   /db_xref="GOA:A0KFE6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE6"
FT                   /protein_id="ABK39508.1"
FT                   /translation="MSTNVSDTAKSSRREQRSSAQTFIDNLKGMAHPNSRRIFIEGSRA
FT                   DIRVPLREIQLADTFVGGTKEAPQFEPNEPVPVYDTSGRYGEEGVAIDVRRGLPRLRED
FT                   WVLERADTEALEGLSSTFTQERLADEGLDHLRFEHLPSARRAKPGRRVTQLHYARTGIV
FT                   TPEMEFIALRENMGRERVRSELLRTQHPGQGFGARLPQNITPEFVRDEVAAGRAIIPSN
FT                   INHPEAEPMIIGRNFLVKINANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYI
FT                   HETREWILRNSPVPIGTVPIYQALEKTNGIAEDLTWELFRDTLLEQAEQGVDYFTIHAG
FT                   VLLRFVPMTAKRLTGIVSRGGSIMAKWCLSHHKENFLYQHFREICEICAAYDVALSLGD
FT                   GLRPGSVYDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMHMIERNMTEQLEH
FT                   CHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWYGCAMLCYVTPKEHLGLPNKEDVKQ
FT                   GLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPDTARAYHDETLP
FT                   QESGKVAHFCSMCGPKFCSMKITQDVRDYAAKLEAVEIKMVGMDGQQERVVAEVESGMA
FT                   RMAETFKETGGEIYHQAAALKQAAGEEA"
FT   gene            470482..472098
FT                   /locus_tag="AHA_0440"
FT   CDS_pept        470482..472098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0440"
FT                   /product="thiamine monophosphate synthase"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00097; match to protein
FT                   family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38267"
FT                   /db_xref="GOA:A0KFE7"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE7"
FT                   /protein_id="ABK38267.1"
FT                   /translation="MSSASGAVSPADLSPVTDSRPVVWTIAGSDSGGGAGIQADLHTLH
FT                   DLGVHGCSVISAITAQNSVAVKMVDPVLMQTFTAQIDALGLDLPPAAIKVGLLPTRLHV
FT                   EVLARRLPTVDAPFVVYDPVAIASTGTPMAEPNMLEAVREQLLPRLSLITPNGPELEAL
FT                   TGLPATSPELVRLAARRLRELGARAVLVKGGHLAWSGDLCLDYYQDETREFWLTAPRLD
FT                   TRHGHGTGCCYASAIAAVVAQDYPVEDAITLARAYLQQGLAAAQGVGAGPGPIAHLGWP
FT                   ADLAHFPRAVLAGSALDRRFGLYETSSARLPQGPFAPTEHNLGLYPVVDSVKWLKRLLG
FT                   AGVKTIQLRIKDLPAAQVAPAIRDAVALGRRHGARLFINDYWQQAIEAGAWGVHLGQED
FT                   METADLAAIQAAGLRLGISTHGYFELMRARELAPSYIALGHIFPTNTKAMPSRPQGLKR
FT                   LHRYRALMCDWPTVAIGGISEERVAAVKESGVGSIALVSAITASDDWQGATERLLAAVG
FT                   AGDEPRSALLMTDMQEAAHAL"
FT   gene            472161..472919
FT                   /gene="thiF"
FT                   /locus_tag="AHA_0441"
FT   CDS_pept        472161..472919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="AHA_0441"
FT                   /product="thiazole biosynthesis adenylyltransferase ThiF"
FT                   /note="identified by similarity to SP:P30138; match to
FT                   protein family HMM PF00899; match to protein family HMM
FT                   PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38994"
FT                   /db_xref="GOA:A0KFE8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE8"
FT                   /protein_id="ABK38994.1"
FT                   /translation="MLADAEYLRYGRQLMLAEVGEEGQARLKDKSVLIVGLGGLGSPLA
FT                   LYLAGAGVGTLWLADGDTVDSSNLPRQILFDSEAVNHSKAELARERLAAHNPLVELIAI
FT                   NQRLDAASLPEFVAEVDLVIDCCDNLATRQAINAACVAQGKPWVCAAAVGWQGQLMVRT
FT                   SSEHACYACLYPLDTEIKESCETSGVTGPLVGVMGSLQALEALKLLFGMQSPVAGTLRR
FT                   FDALAHQWQTLTLAPDPDCPVCGPHKEITP"
FT   gene            472889..473122
FT                   /gene="thiS"
FT                   /locus_tag="AHA_0442"
FT   CDS_pept        472889..473122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="AHA_0442"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36503"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE9"
FT                   /protein_id="ABK36503.1"
FT                   /translation="MRAAQGNHPMTLTIQLNDKAQPLAAGQSVADLLAAQDVNPQGVAV
FT                   ALNGAVLPRSRWAETRLNDGDELHLFTAIAGG"
FT   gene            473109..473891
FT                   /gene="thiG"
FT                   /locus_tag="AHA_0443"
FT   CDS_pept        473109..473891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="AHA_0443"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38057"
FT                   /db_xref="GOA:A0KFF0"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF0"
FT                   /protein_id="ABK38057.1"
FT                   /translation="MPEADMLKIADHTFSSRLFTGTGKFARPALMAAAIEASGSQLVTM
FT                   AIKRLEPGKAHDDILSPLLQLGVKLLPNTSGAKTAAEAVFAAHLAREALGTNWLKLEIH
FT                   PDPRYLLPDPIETLKAAEQLVKEGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSN
FT                   QGLVTREFLSIIVEQANVPVVVDAGIGAPSHAAAAFELGADAVLVNTAIAVSGDPIAMG
FT                   RAFALACTAGRSAYEAGLGARAQQAQASSPLTDFLGAL"
FT   gene            473927..475198
FT                   /gene="thiH"
FT                   /locus_tag="AHA_0444"
FT   CDS_pept        473927..475198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="AHA_0444"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR02351"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39165"
FT                   /db_xref="GOA:A0KFF1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF1"
FT                   /protein_id="ABK39165.1"
FT                   /translation="MSSFSVSPEADVFSPPLPLGEGLGVRAEADSVLEGGEPCTPPPPK
FT                   GEAGRGLDFANRWQELEWDDIGMQIRAKTAADVARALSAPRRTLADFMALISPAAEAYL
FT                   PQMAAEAERLTRQRFGNTIGFYVPLYLSNLCANDCTYCGFSMSNRLKRKTLNAEEIERE
FT                   CLAIKARGFDSVLLVTGEHEHKVGLAYFREVMPIIRRHFSTVGMEVQPLSQDEYAELKS
FT                   LGLDSVMVYQETYHAPTYARHHLRGNKREIAWRLATPDRLGRAGIDKIGLGALIGLSSD
FT                   WRADSYFVAEHLAWLERHHWQSRYSLSFPRLRPCTGGLEPAVVMSDRQLAQLICAWRLF
FT                   SPTLDLSLSTRESATFRNGAVRLGITQMSAESRTQPGGYAEGDAEELEQFAIHDDRPVG
FT                   EVAAAVRQAGLQPVFKDWEPFLGR"
FT   gene            476309..478207
FT                   /locus_tag="AHA_0445"
FT   CDS_pept        476309..478207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF2"
FT                   /protein_id="ABK38863.1"
FT                   /translation="MVYVMIRQITITNFRSIRKETISTEEITTFVGKNDAGKSNLLRAL
FT                   NLFFNGKTDADTDYNFQSDFNINAIVQQRKAKEIKVELVLKLPRSYRKPDQPDTVYWSK
FT                   IWRADGFHDEVQQHCEVKGGAVVNKRNFPKRSKIPSLLKSINYIYIPAIKDANFFRDLQ
FT                   GKLYDVLAISSEQGLHASANSFEQEINEHISELMGEIDTVFASSNNEIKLPQNLRNIFG
FT                   ALEFKADNIPLSRRGDGIKIRHIPMMLSFIALKQQSIGAKITIRPQIWGFEEPENNVEF
FT                   STCFELNNQLIEAAKKHTQMFITTHSPAIYSLSFNASLPSGLKSISYYVDKKGHDTKLQ
FT                   SCSEQDLHGNTGFLNLVTPLIEEHRKVWQERESEYKKTLGVLSSQLAASSKPRVFLEGM
FT                   SDSVVINRILQFLNKADEIFIDVPDNAHNSANAASDRAKAFYLLQKHEKTKVLGLLLLD
FT                   DDPAGKEAKNQFTEFFKGQQSTVSAATYPPHDAPKKLKLKGYIWRVELEHLYPECIWQH
FT                   ALEQSWIEEVTDEEQKFTDNKRKELFNTGVSPITYKADLTDYQRFIVDYAFTHQGKRDV
FT                   SQYIDNMTDDELFEKGLVAAFEPVIEMILKKLKLSPIASEISASEDSETSPIWTGT"
FT   gene            complement(478359..479021)
FT                   /locus_tag="AHA_0446"
FT   CDS_pept        complement(478359..479021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0446"
FT                   /product="putative acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38262"
FT                   /db_xref="GOA:A0KFF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF3"
FT                   /protein_id="ABK38262.1"
FT                   /translation="MLPPISQGGRLLFSGQPPVWAATKPPLGRAPLLSDNAGQPMTFQP
FT                   LANTTLVIRPFEPGDADEFVCAAHESIETVGSWMSWCTPSFNREQALAWFATCDQDRAA
FT                   GRAFDMGLFCATTGQLLGGAGINQLAPHHRYGNIGYWVRQSRQGCGIARQAVALLRAFG
FT                   FQQLGLFRLEIVMGVGNTASEAVAIAAGATFECLARNRIFLHDQPLDAHIYSLGPTE"
FT   gene            479239..479820
FT                   /locus_tag="AHA_0447"
FT   CDS_pept        479239..479820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37462"
FT                   /db_xref="InterPro:IPR014094"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF4"
FT                   /protein_id="ABK37462.1"
FT                   /translation="MKLRSLLMVGALLLGGCAVNPYGGTQAPVSEPDQPVSQPDKPVTK
FT                   PDAGAPLPKPVAPTGLALAMADAFVQAPEVRELAQTGQPVLLLTPPQNGTGEPVDTRAM
FT                   AAAMSKRIQSKSGFRFVDPGQVAAITGQLEYQQGRMNPASLVRLGRQTGAGYMLYGDLV
FT                   AEGSRYRLSMTLMELRSGELLWSGSRSASH"
FT   gene            complement(479899..480315)
FT                   /locus_tag="AHA_0448"
FT   CDS_pept        complement(479899..480315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0448"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36853"
FT                   /db_xref="GOA:A0KFF5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF5"
FT                   /protein_id="ABK36853.1"
FT                   /translation="MHLTPPQPPAEQDVDALRIGLSGYNIGQAGTHLREHIASFIKDEA
FT                   GKVHGGITADLKWGWLHVDWLWIDERIRQDGWGGRLLATMEQYARSKGISNFHLETTSF
FT                   QALPFYQKQGYQVFGELPDMPPGHTTYFLRKMES"
FT   gene            complement(480428..480745)
FT                   /locus_tag="AHA_0449"
FT   CDS_pept        complement(480428..480745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39519"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF6"
FT                   /protein_id="ABK39519.1"
FT                   /translation="MKRAIVKARFDAISIEGEQLTVKIAIRAPEPDPKSAGGDWRCKVK
FT                   LDGLGNKTFIYGVDALQALSLALKFVESELRAFTDAGWHFYLPGCPDHPVDMAACYFPQ
FT                   L"
FT   gene            481080..481985
FT                   /locus_tag="AHA_0450"
FT   CDS_pept        481080..481985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0450"
FT                   /product="GGDEF family protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38934"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF7"
FT                   /protein_id="ABK38934.1"
FT                   /translation="MALSVKQLYEVMAQLPDPVFILSEDGYYIEYIGGVEQQSYQDGNP
FT                   LAGKRLADVLPAAMTRWVMEQVTLALDSGQVQVVEYELAAVEVEGIDASVGPQGMQHFE
FT                   GKIAPLPSRYDGKRAVAWVTRNITRQYELQQRLKLQSETDQLTGLYNRRYFFEHCRQRR
FT                   AGEAPCALVMLDIDHFKQINDRFGHQQGDRALQRFCACVAAQLRADDMFVRSGGEEFLI
FT                   LLPGMSEPDLLALAERIRAAVAALPADPAAFTVSLGTTLVRPGEEINQALARADEWLYR
FT                   AKRAGRNRVAHCPVATGAQG"
FT   gene            482444..483718
FT                   /locus_tag="AHA_0451"
FT   CDS_pept        482444..483718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0451"
FT                   /product="serine transporter"
FT                   /note="identified by match to protein family HMM PF03222"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37080"
FT                   /db_xref="GOA:A0KFF8"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF8"
FT                   /protein_id="ABK37080.1"
FT                   /translation="MSVAIAEKSNPASKLKWEKSDSVWTMGLYATAVGAGTLFLPITVG
FT                   SNSPVILLFILLMAFPLSYYSHRALSRFVLSSSHREGDITHVVEEHFGARAGKLLMLVY
FT                   LMAFYPIILVYSISITNAIQSFVVHQLGNAEIPRGLLVLGVMLGLHLVLLAGKQIVVSA
FT                   ISVLALPMVAFLIGLSIYLLPQWSLSYFSESQGVDWRDPAFWKSLWLIVPVMVFSFSHA
FT                   PIISSFSAAQKKRCQASADQRAKRIIKCSSLLICGSVLFFVVSCVMSLSQAEMAQARID
FT                   NISVLSALANKFSNPLIAYVGPLIAILAMSKSFLGTSMGVSEGTVSMVNGACQGLGLSL
FT                   REATIARVSSVILFVVTGVITYLNPNVLEIIEKVSGPLIAVILFLLPACSIYRLPVLKR
FT                   YRGASTLFVLVIGLLAISALIYDLL"
FT   gene            complement(483782..484489)
FT                   /locus_tag="AHA_0452"
FT   CDS_pept        complement(483782..484489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0452"
FT                   /product="protein ExoD"
FT                   /note="identified by match to protein family HMM PF06055"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39808"
FT                   /db_xref="GOA:A0KFF9"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF9"
FT                   /protein_id="ABK39808.1"
FT                   /translation="MPRMLTRNRLMVSRFNSPEGHQGMVAAQLNDPQNKLSDTLRATAH
FT                   AIEESHISLRQMLALVGEQGMLLFCVLLTVPFLLPVSIPGVSTPFGLLILFIGIGITLN
FT                   RVPWLPAILMERRFAAEQLKPTLHKGADLLARIDRFIRPRLLLLTGSSTINRCNGLLIM
FT                   LAALLLMLPLGAIPFTNAMPAWAILLLAIGMLQRDGLFVASGYLLVSATLIWFSALAIG
FT                   LLMAGQSVSTLLG"
FT   gene            484671..485291
FT                   /locus_tag="AHA_0453"
FT   CDS_pept        484671..485291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36126"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG0"
FT                   /protein_id="ABK36126.1"
FT                   /translation="MKRAGIMMMGLLLPLGQAWSAEGEAALGWQVTPFFGYSSAIDFEA
FT                   NDDPKPTPVSTRLESLQGERSGSWGLFISKEVDDPGMIELLYSHQSTRLSPDQPDRLTV
FT                   DTLHFAGALTLSDNLMAPYIGAGIGATRFAAYDSEVAPSMSLALGVQPRLTEHLALRAE
FT                   VRGYGSLVNDNSQFLCNPDQCVFKVRGELVTQWQANIGLTLRF"
FT   gene            485288..485839
FT                   /locus_tag="AHA_0455"
FT   CDS_pept        485288..485839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0455"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39632"
FT                   /db_xref="GOA:A0KFG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG1"
FT                   /protein_id="ABK39632.1"
FT                   /translation="MSLVHRGALPPLPRTLPSLSTPRLLLRAFDARDSADLFAIYGDPL
FT                   VMRFVGEPPFPSLATVAQMLASVARLLAAGESLEWGLVARDSGRLIGTCGLHSFAGEAG
FT                   LRQAEVGCMLARSHWGEGWMAEALTALIVYARQLGIATLLADIEPDNLPSQRLFRRLGF
FT                   VWQQASCYRLSLEGVTPDHG"
FT   gene            complement(485820..486125)
FT                   /locus_tag="AHA_0454"
FT   CDS_pept        complement(485820..486125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0454"
FT                   /product="putative mono-oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39083"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR014910"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG2"
FT                   /protein_id="ABK39083.1"
FT                   /translation="MPSLLQIHFNFPAEMMGPALTAAAMPLAESITKEPGFISKIWTEN
FT                   PRTGEAGGIYLFEDETSALAYATMHEQRVLAMGASAVQFKLFDVNEPLSRLTRGLV"
FT   gene            486247..486612
FT                   /locus_tag="AHA_0457"
FT   CDS_pept        486247..486612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0457"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37876"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG3"
FT                   /protein_id="ABK37876.1"
FT                   /translation="MSPLPCPAYRVLRLLAGKWKPAILFHLRAQILRFGDLRRSLPEVS
FT                   QKVLTAQLKELESDGVIIRTLYPDVPPRVEYSLSPLGIALLPLLQQMHDFALSHGSLLA
FT                   QSEAGAAREEPHLGEPG"
FT   gene            complement(486609..487043)
FT                   /locus_tag="AHA_0456"
FT   CDS_pept        complement(486609..487043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0456"
FT                   /product="acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38476"
FT                   /db_xref="GOA:A0KFG4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG4"
FT                   /protein_id="ABK38476.1"
FT                   /translation="MQIRPFTPADTEAVLAIWLEASLQAHHFIEPAYWHANLAPMREIY
FT                   LPAADSQLLCLGEQVLGFYSLHEGTLAALFVAPARQGQGLGKALLEHAKQRLPTLRLQV
FT                   YQQNRTACDFYRAQGFQVAAGGVDPHTGCAEWVMIWPARD"
FT   gene            complement(487169..487858)
FT                   /locus_tag="AHA_0458"
FT   CDS_pept        complement(487169..487858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36111"
FT                   /db_xref="InterPro:IPR016878"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG5"
FT                   /protein_id="ABK36111.1"
FT                   /translation="MGGKPIPPHSRLNGGFNFYSSQIDKLRVSLNATPRSHDRMKLLTK
FT                   TLFTKQSGLVLVLLAASGSLSAAQIANNNITEAEIKAAQDAWGKALIQISDDYRSGGID
FT                   KARATATAVLDGAYGYHHGPVLFKPTLAGGEQTFRINQAGALAYFVGNNQAYPADTGFA
FT                   LKNWQSYNYDNAAVYINGDMALTMGKVHLTDRDNKQTTVDKTWGFKKGDDGKVRIVLHH
FT                   SSLPYAG"
FT   gene            complement(487871..488908)
FT                   /locus_tag="AHA_0459"
FT   CDS_pept        complement(487871..488908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0459"
FT                   /product="fucose 4-O-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36734"
FT                   /db_xref="GOA:A0KFG6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG6"
FT                   /protein_id="ABK36734.1"
FT                   /translation="MRISSIECGRVVAIMAVMAIHLSPFSNPFDPTLWDGTLYFWLGGV
FT                   INQLCRFAVPLFFLCAGYFLQPALAAGHPLTVALRYCRPLLGLWLAWSLLYVLIPFNPL
FT                   AAVSEGYLPAMASQWQMQLGDPLNAWWVGGMIHLWFLPALMLAVLILALCQQARLPRLA
FT                   LLLGVLLYGLALLGGSYGPPLLGDEWALLTRNGPFFSLLFVALGAELRLRAWQPDARRC
FT                   ALLMAAGMGLYALEAAGLLHFAAVPLNRHDFLLGSLPWALGLFGLLLANPGWGRGSWLE
FT                   RQAPKVLGLYCLHMMLVVWLMIFGPQGKQVWWELLKVPALLALSLLGYRLLALGTASRW
FT                   LLRAR"
FT   gene            complement(489085..489720)
FT                   /locus_tag="AHA_0460"
FT   CDS_pept        complement(489085..489720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0460"
FT                   /product="PepSY-associated TM helix family"
FT                   /note="identified by match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36069"
FT                   /db_xref="GOA:A0KFG7"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG7"
FT                   /protein_id="ABK36069.1"
FT                   /translation="MKHRAMKRRKLPLHNNKWVRRIHAWAGFATLTLMLLYGLTGLWLQ
FT                   HRAVLPLPGPHTEKSSEEIVLSAPLSSPDELKSLLQQRYPAGFEEGRVQLTPPQTLPTP
FT                   DSPLTLPARWEMRGVTLSQSVAASYVAGTLLVRTELQQANFASSLNRLHRGMGTGLPWQ
FT                   LVGDLAALAMLLLALTSLLMWNKLHGPAARGIALLLLGALVTVLVALL"
FT   gene            complement(489771..491813)
FT                   /locus_tag="AHA_0461"
FT   CDS_pept        complement(489771..491813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0461"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36630"
FT                   /db_xref="GOA:A0KFG8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG8"
FT                   /protein_id="ABK36630.1"
FT                   /translation="MHTPHHPRTLLSVALLALSAGAHAEDETMTVVGKRSQHEEVATAT
FT                   RTNTPAKLVPQAIDSVKASELTAFGQPTLSEALTGIPGVNASGDTRFDGVNIRGFSASN
FT                   DFYLDGFRDDMQYTRDLGNTERVEVLKGPAAVLYGRGSTGGIVNRVSKKPQKGLESSVS
FT                   AQVGSFDSRRLAADLNGEAGEQVQVRLNLAQEDKDSFRNGVTSKRTLLAPSVNWEISDK
FT                   LNWLVQYERNEHDRTPDRGIPGVNGRPADVPKEYVYSDTRRDFIDDVAQSTRSRLTWDI
FT                   NDQWQLRQQLGYTSLDSQFDNTYVTSVKGDQVTRSRWQQDLKANSLISNTEAEGQLQTG
FT                   PVEHRLLVGFEQNWQERTPKLYQNATAIPAGNLYDPGSLPTYDGAMKLSSDANHKVRGY
FT                   GLYVQDQLSLGDWHLLAGLRRDDFTVTSRRNDLNKEETVSVTSLSPRLGLVWNPIEEHA
FT                   FYASYSKTFTPVGGELIGITPGDKNNNLDPQHTRLYEGGVKSDWLDGRLATTLSLYRLE
FT                   MYNKRSKDPLDPTKVILTGLQRTEGIELSARAQLTDELYLRGGIAIQDAEQVKADADLQ
FT                   GKRPMNVSRQNGELFAGYQSGKQGWFGETGVTAVGDRFADNANTTTLPGYARFDARAGY
FT                   RWQQWETQLSVENLTDHDYFVSATSASQIMPGTPRQLHLSAAYRF"
FT   gene            complement(492040..492951)
FT                   /locus_tag="AHA_0462"
FT   CDS_pept        complement(492040..492951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0462"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37809"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG9"
FT                   /protein_id="ABK37809.1"
FT                   /translation="MPLRLLICCCLLCALPVQALTIAMVLWRGETDAERGFRDELNRLG
FT                   HHPTFVTFNANQDRTVLATLLRQQLLPSLADYDYIYCFGTTATAMVKSLVGNRKPLIFS
FT                   IVSDPVGAGFLSDDKTENQMVAGTSNMVPMALQLANARRYLPAGKGMLLPFNPREQNTL
FT                   LTGELLLREARRYQWELTTWRIAPDKRRLASELKRLQHDAKESIVFLAADSYLLSIAPE
FT                   LLAALNEAGIPTICSAELYVEHGCTVGTISSYRALGQMAANIIHRNLQGTPLQDIPLQT
FT                   DPAPRLVLGKQLAEIAPSTADH"
FT   gene            complement(493069..494283)
FT                   /locus_tag="AHA_0463"
FT   CDS_pept        complement(493069..494283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0463"
FT                   /product="hypothetical outer membrane protein"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37964"
FT                   /db_xref="GOA:A0KFH0"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH0"
FT                   /protein_id="ABK37964.1"
FT                   /translation="MAVRHTKHGPFTNLTSNRHRHFTRVSPRCHPPCLAWPPSFTTKLA
FT                   TQGIKMKKLTVVALALTAAFQAHAVEVYKNDTTTLDLYGRIYAGQFFGDKKEGVDSTHP
FT                   NGTQEYSDKQGANQFVRFGAKVDSQINSQLKALAQYEVQMYINDSEKTISENSDNLRTR
FT                   LAFAGVGADWGNITFGRQKGAPGFLADWTDVSLSDGYGNDALGAKTDTFATNRAGSVLK
FT                   YSGLFNGFQVDTSYKFDGGDTEETTSKDSDAAYGAAVAYTFPFNLALGTAYNVGIRDKN
FT                   GEEDAKLWLLSAKYDNKAVYAALSYADGTDFLATGKDHTGWEGALGYNFENGFGLMALW
FT                   NKQKVEQDGKADYDSIDYYTLGAQYKFNKNLRVIGEYRINNLDSKESGKLNVKDDFQLA
FT                   ARYDF"
FT   gene            494354..495364
FT                   /gene="glpX"
FT                   /locus_tag="AHA_0464"
FT   CDS_pept        494354..495364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="AHA_0464"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF03320;
FT                   match to protein family HMM TIGR00330"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38386"
FT                   /db_xref="GOA:A0KFH1"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH1"
FT                   /protein_id="ABK38386.1"
FT                   /translation="MRRELAIEFSRVTEAAALAGYKWLGRGDKNIADGAAVAAMRHILN
FT                   QIQIDGEIVIGEGEIDEAPMLYIGEKVGTGLGDAVDIAVDPIEGTRMTAMGQANALAVL
FT                   AVGDKGSFLKAPDMYMEKLIVGPKAKGAIDLDEALELNLKAVAKALGKPLSRLTVITLA
FT                   KPRHDKAIKEMQGLGVRVFAIPDGDVAASILTCLPDSEVDMLYGIGGAPEGVISAAVIR
FT                   ALDGDMQARLVPRHQVKGDSPEVRALGEQEIARCEALGIDVSKVLKLEDLAKNDNVIFS
FT                   ATGITKGDLLDGITSDGVMATTETLLIRGKSRTIRRIKSIHFLDRKDSVVRDIIL"
FT   gene            495522..495773
FT                   /locus_tag="AHA_0465"
FT   CDS_pept        495522..495773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0465"
FT                   /product="proteinase inhibitor"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39082"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH2"
FT                   /protein_id="ABK39082.1"
FT                   /translation="MECRQGCGACCIAPSISSAIPGMPDGKPAGVPCVQLDARLGCKIF
FT                   GQPERPAVCGGFRPMQDVCGYHREEAIWLIGELERMTS"
FT   gene            complement(495930..497093)
FT                   /locus_tag="AHA_0466"
FT   CDS_pept        complement(495930..497093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0466"
FT                   /product="HemY protein"
FT                   /note="identified by match to protein family HMM PF07219;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39531"
FT                   /db_xref="GOA:A0KFH3"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH3"
FT                   /protein_id="ABK39531.1"
FT                   /translation="MIRLIVLVAAMVAGLIFGPQASGNKGYVLISLGNYTVESSVTSAV
FT                   ILAVLFYGALLIVEWLLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQAE
FT                   KLMLKGASNSDTPLLNYLSAAKAAQARGDDVRRDQYLQKAQEENPKAELALTLTQTQLQ
FT                   IEQGQYDTALAMLESVYALNPRHPMVLDQLRQVHLAREDWAALIDLIPVLHKVGKLTPK
FT                   QEEDLLQQAWRGRLDAASGALETLRPIWQELPRKLRQDPDLLAAYGDRLRQLGADNEAA
FT                   ELWLDALRKQVSPQLLARLPKLKLDSYQPMLTLLQKIQDQPGVDAALAQVYLLAGQLDD
FT                   AQRLLEQEVAKAPNAAVYHALGQVMDKRRLTNKANEYYRQALQLADV"
FT   gene            complement(497104..498180)
FT                   /locus_tag="AHA_0467"
FT   CDS_pept        complement(497104..498180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0467"
FT                   /product="putative uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="identified by match to protein family HMM PF04375"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37042"
FT                   /db_xref="GOA:A0KFH4"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH4"
FT                   /protein_id="ABK37042.1"
FT                   /translation="MTEQQEVQPSAAASVADNKQPGQKVANNKKGSSGAVVGGIAILLA
FT                   LGLTGGLYLHGHKSAVAQQGELNQLKLQLAEAMNKLDQSNSKDGEQLAALGKQQQLLQD
FT                   ELKGLQTRVLDLNDKRPNDWMLAESEYLVRMAGRKLWLEHDLVSAITLLGNADERIKAL
FT                   NDPSLMPIRKALAEDIAQLKGMPRIDREGLTLKLAALSDQIELLPLSTVSMPEAKSEPD
FT                   QAVSTNPDEWESNLKKNWVKFTENFITIRRRDGAVEALLSPQQEIFLRENLKTKLLQAQ
FT                   LAVYREQQALYDDSLDKAQRWLTQYFDTDNSATHYMQSELDKLKGEQIQFNYPDRFKTQ
FT                   AMLEEVLTERLQRILASN"
FT   gene            complement(498177..498911)
FT                   /gene="hemD"
FT                   /locus_tag="AHA_0468"
FT   CDS_pept        complement(498177..498911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="AHA_0468"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37538"
FT                   /db_xref="GOA:A0KFH5"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH5"
FT                   /protein_id="ABK37538.1"
FT                   /translation="MIPLVVRPAAQAAELAALLRQHGHAPLCCPLLETVAGSELHRLPE
FT                   LLPQADIVIAVSVHAVNFTHHFLLQTGQTWPNIDYFAVGQASADAFSEVGIQALSPDDP
FT                   RSEGLLALPSLQQVNGKQVLILRGNGGRDLIARTLASRGALVHYCAAYERHYPALDGDA
FT                   LTCHWQAAGLDSLLVTSGELLQRLLELVPDQQLPWLHDRLLVVPSPRVAEMAAAAGFTH
FT                   ITIAQGASNQALTAALELRKME"
FT   gene            complement(498908..499900)
FT                   /gene="hemC"
FT                   /locus_tag="AHA_0469"
FT   CDS_pept        complement(498908..499900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="AHA_0469"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="identified by match to protein family HMM PF01379;
FT                   match to protein family HMM PF03900; match to protein
FT                   family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36245"
FT                   /db_xref="GOA:A0KFH6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH6"
FT                   /protein_id="ABK36245.1"
FT                   /translation="MKAPAKGGKIVFLLKMKQLIDMAARTLKIATRKSPLALWQANFVK
FT                   DRLEALYPELQVELVPMSTQGDKILDTPLAKVGGKGLFVKELETAMLEGRADIAVHSMK
FT                   DVPVEFPEGLGLHTICEREDPRDAFVSNRFGQIDELPQGAVVGTSSLRRQCQLRAARPD
FT                   LVIRDLRGNVNTRLAKLDAGEYDAIILAAAGLKRLEMAHRITAFIEPEQSLPANGQGAV
FT                   GIECRLDDHELHALLAPLEHPETRIRVLTERAMNRALQGGCQVPIGAYALVQGEEVWLR
FT                   GLVGSPDGSRVIRDEIRGPLADGEALGHTLAQRLLADGADVILAEVYRA"
FT   gene            500161..502695
FT                   /gene="cyaA"
FT                   /locus_tag="AHA_0470"
FT   CDS_pept        500161..502695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="AHA_0470"
FT                   /product="adenylate cyclase, class I"
FT                   /EC_number="4.6.1.1"
FT                   /note="identified by similarity to SP:P00936; match to
FT                   protein family HMM PF01295"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36798"
FT                   /db_xref="GOA:A0KFH7"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH7"
FT                   /protein_id="ABK36798.1"
FT                   /translation="MLVKLDTLVARYDELNRLKTQRALGLMSRYGQQVFQLLPVMLHFN
FT                   HPLLPGYVAGDVPHGIWSFTANDAQQAFIEDLCQNANCLNGLTTHDKSIQGLYSMGSTS
FT                   SIGQCCHSDLDIWVCHVAGLSQERLELLDLKCQQLSKWAEQRGVDLNFFLIPEDKFRQR
FT                   NDAQMQGESCGSAQHLLLLDEFYRSAMLIAGKRLLWYLVPSEYDDHYDDYVNGLFAHGK
FT                   LSQDDWLDLGGFNRIPAEEYFGSALWQLYKGIDSPYKAVLKSVLMEAYSHEYPNTRLLS
FT                   VTSRDWFQHNEGMHYRLDNYCLMLDKVTNYLKSIGDMQRLDLVRRCFYLKVCDGLSHPK
FT                   EEHSPAWRREQMTQLVSYWGWSQERLHHLDHRQEWKVEDVKVAHAELLEALMQSYRNLI
FT                   QFARRNNISESINPEDIGILSRKLYAAFESLPGKVQRINLKIAPDLSEPDLSFVQVPHG
FT                   RLNRAGWYLYKHSLEPADIIGRAPLEYNGYISKLVSWAYFNGLLTPQSRVHLFNQGSDL
FT                   HIDNLHQFCRDLSGTFPVKYPRATNLALSRPCEIRQLSIFLNLETDPTSHWVGQVIEFD
FT                   ANAADVFSFGRNQECLVGSVDLVYRNSWSEIRTLHFQGDEAVVDALTTILGKMHQDAAA
FT                   PEMIEVFCYSQHFRSLVRTRFQQLVAECIELRLARDKQQLVKTLALGKEKYGIFFERRG
FT                   VSVKKLENAVDFYRHISHNKLDHLPLRLDKTHSQHLPGIVDAYASEGLVQFFFDTRDAG
FT                   TNIYILDEANRVEIYQHFAGNKDELVQGVNRFYTSSHERFSDAGQFSNFNLPQYYEIVQ
FT                   INGELEVIPYRSQGQLRDGGQGRELGSAAGAG"
FT   gene            complement(502819..503490)
FT                   /locus_tag="AHA_0471"
FT   CDS_pept        complement(502819..503490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0471"
FT                   /product="carboxylesterase 2"
FT                   /EC_number="3.1.1.1"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38937"
FT                   /db_xref="GOA:A0KFH8"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH8"
FT                   /protein_id="ABK38937.1"
FT                   /translation="MMVQPAVIDLHPEGARHAVIWLHGLGDSGAGLAPLVDALALPADL
FT                   PVRHLLPDAPERAITINMGYKMRGWYDIKSFDNPADRAVESHVRESAAHIAALIEQLVA
FT                   EGFAPERIVLAGFSQGGVIASFTALRLPQQLAGLLCMSTYLAAPDALLGEMSEAARSLP
FT                   ICYMHGIYDDVVSLSMGWDAKNRLEAAGLSPEWHEYPMRHEICRPQLDDIRQWLLARLA
FT                   G"
FT   gene            complement(503487..503801)
FT                   /locus_tag="AHA_0472"
FT   CDS_pept        complement(503487..503801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0472"
FT                   /product="protein CyaY"
FT                   /note="identified by match to protein family HMM PF01491"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39479"
FT                   /db_xref="GOA:A0KFH9"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFH9"
FT                   /protein_id="ABK39479.1"
FT                   /translation="MKDHEYHALTDAFFQYVEDTVDAGYPDIDCERAGGVLTLSFENKT
FT                   KVIINKQEPLHQIWVATRENGFHFELQGESWIDNRFGHELKTLLSKACTTQAGEPVQFP
FT                   "
FT   gene            504072..505322
FT                   /gene="lysA"
FT                   /locus_tag="AHA_0473"
FT   CDS_pept        504072..505322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="AHA_0473"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784; match to protein
FT                   family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38622"
FT                   /db_xref="GOA:A0KFI0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI0"
FT                   /protein_id="ABK38622.1"
FT                   /translation="MDHFNYDADGQLQAEHTSLQQLAEQYGTPLYVYSRATLERHWHAF
FT                   DKAAGDIPHLICYAVKANSNLALLNLLARLGSGFDIVSGGELSRVLAAGGDPAKVVFSG
FT                   VAKSEAEMRLALDKEILCFNLESEAELERLNRVAGGMGKKARVSVRVNPDIDAGTHPYI
FT                   STGLKQNKFGIPIEQAPAIYRKAAAMANIEIVGVDCHIGSQLTELNPFMEAADKLLRLI
FT                   DGLAVEGIHIHHLDVGGGLGVNYGAEQPPHPSEYAEALKQKLAGRDLTLLFEPGRAIVA
FT                   NAGVLLTRVEYLKPGETRNFALIDAGMNDLLRPSLYGAWMNIIEVDSRTAHEPALYDVV
FT                   GPVCETGDFLGKERTLAIAEGSLLAVRSAGAYGFTMSSNYNTRPRAAEVLVDGAQSFLI
FT                   REREQLADLWRGEHLLP"
FT   gene            505388..506218
FT                   /gene="dapF"
FT                   /locus_tag="AHA_0474"
FT   CDS_pept        505388..506218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="AHA_0474"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by match to protein family HMM PF01678;
FT                   match to protein family HMM TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38916"
FT                   /db_xref="GOA:A0KFI1"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFI1"
FT                   /protein_id="ABK38916.1"
FT                   /translation="MLIDFSKMHGLGNDFMVVDGVTQKVFFSNEVIKKLADRHFGIGFD
FT                   QLLLVEPPYDPELDFHYRIFNADGSEVEQCGNGARCFARFVRLKGLINRDRIAVSTARG
FT                   RIVLQLEGENQVTVNMGVPQFEPGKIPFRAQKAEKTYLLRAQEHTVMCGAVSMGNPHCV
FT                   IEVPSVADAPVATLGPIMERHERFPERVNVGFMEMVNASEIKLRVFERGVGETLACGTG
FT                   ACAAVVVGISQGKLKERVTVTLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEL"
FT   gene            506329..506979
FT                   /locus_tag="AHA_0475"
FT   CDS_pept        506329..506979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0475"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF04340"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37215"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI2"
FT                   /protein_id="ABK37215.1"
FT                   /translation="MDEATVLEYLARYPEFFQRHAAMLDRIRIPHERKGTVSLVERQLD
FT                   RQRERIEQLEQEITELMGIASENERIFRVYADLYGELYGCQSLFEVSAVMGKAFVQRLR
FT                   LTGLRLWLSPKKFQLSGPEQKFMAEGRQLEQLLGQRLPGQDYYFGRLNQSEKQALFGHD
FT                   VLVNSVALMRLGDLGVLAFASSDPSHFTPHNDTLLLGQLGRLLQLRLPELARG"
FT   gene            506972..507949
FT                   /gene="xerC"
FT                   /locus_tag="AHA_0476"
FT   CDS_pept        506972..507949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="AHA_0476"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02224"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38032"
FT                   /db_xref="GOA:A0KFI3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI3"
FT                   /protein_id="ABK38032.1"
FT                   /translation="MAKTPARSPAKAPPAAEPLPAALADELAGFIEYLRVERQLSPHTR
FT                   SNYQAHLEAMTAELVKLGVDDWARLEASQVRSLVTRMHKAGLAPRSLATKVSALRSFCD
FT                   WQVRQGRLVANPARGIVTPKQGRPLPKNLDVDEMYQLLNITDEQDPLAVRDRAIMELMY
FT                   SSGLRLAELVGLNLADVKLDERQLRVTGKGSRERVLPVGRMAVEWLHKWLKLRPLLAGD
FT                   ELEALFVSKRKQRLSARSVQERLDGWGNKQALNAHVHPHKLRHSFATHMLESSGDLRAV
FT                   QELLGHADLSTTQIYTHLDFQHLAKVYDSAHPRAKRDPATPDDE"
FT   gene            507990..508700
FT                   /locus_tag="AHA_0477"
FT   CDS_pept        507990..508700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0477"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1 family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37756"
FT                   /db_xref="GOA:A0KFI4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI4"
FT                   /protein_id="ABK37756.1"
FT                   /translation="MQFYRRWQPVAAISFDLDDTLYDNGPAIERAEQWMLSHLRSEYLA
FT                   TAMLDKPRWQALKHNLLLEQPALRHDVSLARRHGIQAALMAGGMAQGLAEREAASVFAG
FT                   FLAERSKIEVSDETHALLARLAERYPLVVITNGNLDLTRAGLADYFTLVCKAGLGSRMK
FT                   PAPDMFVEAQRALKLAPGQILHVGDHPQTDVLGARLHGFKAAWLNERGQPWRELQLLPD
FT                   VELTALGELAELLL"
FT   gene            complement(508799..509209)
FT                   /locus_tag="AHA_0478"
FT   CDS_pept        complement(508799..509209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38422"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI5"
FT                   /protein_id="ABK38422.1"
FT                   /translation="MHFMLLTALALSATLQFDCPATIETRQQLLGASPGWQAVTRNDMG
FT                   EQHQPLSHRLDNLALFDGDPDERAQLKPDNGDSDALHYWSLDRRNPRPFYLVCHYRETA
FT                   ITLQQALPTGISYCRVNQPDPYQLRGLICRNE"
FT   gene            complement(509242..510768)
FT                   /locus_tag="AHA_0479"
FT   CDS_pept        complement(509242..510768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0479"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel (MscS) family"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37369"
FT                   /db_xref="GOA:A0KFI6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI6"
FT                   /protein_id="ABK37369.1"
FT                   /translation="MFSDNLVALPTLLWIGEHPFWTLLTLFLLFTHFLRSPGRRRELVS
FT                   ELGFVMISLVVILLIQFEGGWFRLPLPHRWLVEISSLLAGLVLVKIWGILLFQFLLPLC
FT                   QIRIPRIIADIVITVGYIGWCLFRLYASGMALGEIVTTSAVITAVIAFSMQDTLGNLLA
FT                   GVSIQLDNSIAIGDWLQVETTQGRVVEINWRATTIETRNWETVVIPNSHLLKQRFTVLG
FT                   RRQNAPLQWRRWVWFDITLDTLPTQIIALVEQSLRETRIRHVSASPQPDCLLMNVENGI
FT                   ARYAVRYWLTDLAVDDPTDSAVRTLIDAALRRNDRRLTPPIFNVFMTTDQDHKDQRHKR
FT                   HTAERTDTLRRLPLFAMLQEEELLRLADQVKFAPFVNGDRMLSQGEVSGWLFVLVKGDA
FT                   QMLVEVEGRELPLGTLNAGDFFGELSLLTGEPSPFTVRALGTVETYRINQAMFQELVAQ
FT                   RGSLLEPLYKVLSARQQEQQELLAREAEAMKQITPPRDLLDKLMALFGGR"
FT   gene            510884..511297
FT                   /locus_tag="AHA_0480"
FT   CDS_pept        510884..511297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0480"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36907"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI7"
FT                   /protein_id="ABK36907.1"
FT                   /translation="MRTLNKMVWIAGAWLLTGCDQLADKYRVEFRDGSWREIAITPFAD
FT                   EARWREGCATGEVLSDMMLPLKRGKTVNGREQLLIGGELFELDDSALYRSNGMVFGHTP
FT                   DHIQRGLKGLEVCRTLRPDRGALPKLKARGFGD"
FT   gene            complement(511307..512077)
FT                   /locus_tag="AHA_0481"
FT   CDS_pept        complement(511307..512077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0481"
FT                   /product="glutamine amidotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07722"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38360"
FT                   /db_xref="GOA:A0KFI8"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI8"
FT                   /protein_id="ABK38360.1"
FT                   /translation="MTRSPHTPRKPVVLMTTGAQPRNGHAYQVMTHKYIKPLVEISGCV
FT                   PLLVPTCCGTEDLAQYLDLADGVYLSGAGSNIDPALYGQENLTPEKQQDRDRDLFDIPL
FT                   VRAALDRGLPILGICRGMQEINVALGGDIHQKVYSEPGYDDHREDADDPVDDQYGESHQ
FT                   VELVPGSWLAELMGQPSIPVNSLHGQGIKTLAKGLEPLAHAEDGLIEAIHAPTLSPFLL
FT                   AVQWHPEWKASENPHSIKIFEAFGDACRARLSGL"
FT   gene            complement(512439..513248)
FT                   /locus_tag="AHA_0482"
FT   CDS_pept        complement(512439..513248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0482"
FT                   /product="phosphatase YidA"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37698"
FT                   /db_xref="GOA:A0KFI9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI9"
FT                   /protein_id="ABK37698.1"
FT                   /translation="MYKLIALDMDGTLLNSQGQISPRTHAAIAAARAKGVTVVLASGRP
FT                   LEGMSRYLVELGLTGQDDYVICYNGALVQQVADQRIIRSQLLTGSDASAIAALADELGV
FT                   NVHGFSVSRGLISPRVSPYTEHESRLIDMPIKLLDFATLPADEQILKVMMIDPEPLLSP
FT                   AIAKLPAELYQRYTVVRSAPYFLEFMNKQSNKGTGVAALAEHLGLDASQVIAVGDAGND
FT                   HHMIEYAGLGVAMGNATDDIKALAQHTTGRNDEDGVAQVIERFILNA"
FT   gene            complement(513353..515047)
FT                   /locus_tag="AHA_0483"
FT   CDS_pept        complement(513353..515047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03961"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39247"
FT                   /db_xref="GOA:A0KFJ0"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ0"
FT                   /protein_id="ABK39247.1"
FT                   /translation="MRTKEGIRVLSKEWLLLSADMEYACLRIVPGLTNPISESDIQTLL
FT                   LASNCRRYQPLTEGIKQAISLLNTLLSNPTAPLPGNPVPIAQRHDASVLLVVEKDRMSA
FT                   TAQITADWGGKYLTSEQLEQAIQSSEISQGVQAPLIAAAVLAAKEATPGTLLRLPVAQG
FT                   KAAVNGQDTRFERLVETPAERILKPQELDHGRVDMRDLGTILTVKAGAQLMRRHPATQG
FT                   VPGFTVTGQELPAKHGKDSPMVAGEGTFLSPDDPDLLLASRPGLPRQEKNGMKVDDVLS
FT                   VKQVDIRHGHVIFEGALIVAGDVTPGMKIKTSGDVVIGGFVEGGYIESSGTITVRNGII
FT                   GRKSEQSDEFLCHLNAQGEIHASYAQYAKLEAGGDIHILTQLSHCYSRSGQDLKVGDSG
FT                   MRKGHLLGGISIANRLIMAPILGASAHNQTRLQILGGYFTHKEQEQALRQRKQECREQL
FT                   DKLQDLLLKLLQLPSDKRNPQTLQKIKLIRTQRLEESKLLDEQLEAAQEELQKLMAEMD
FT                   IIATQHAFPGVEVEMAHHHYRVDIEHGPIHFAIREDQLQLTPYEPHK"
FT   gene            515309..516283
FT                   /locus_tag="AHA_0484"
FT   CDS_pept        515309..516283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0484"
FT                   /product="membrane-fusion protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36046"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ1"
FT                   /protein_id="ABK36046.1"
FT                   /translation="MSTLRHCLLPLALTGLLSACQPQASTTALGTLERDRVLLTATAGE
FT                   IIRALPVAEGSRVEEGTLLARLDDRRQQAVLARARAQQAQARAVLARLTNGERPEDIAA
FT                   ARASLDKAQANVRESERNFERIDRLVRRKLVSPADLDKARAQRDSALAEQDGARQQLDK
FT                   LARGVRREDIDEAQAALLAATAEVALAERELADLSIVATRSGRLDSLPYHLGERVAVGA
FT                   VLAAIQADEAPYARVYVPEPSLAGYRVGQPVRVQVDGVAEPFTGRLRWISKEPAFTPYY
FT                   ALNEQDRARLVYLAEIDLPAGAQDLPSGLPLQAEPAAQGEGHE"
FT   gene            516276..517205
FT                   /locus_tag="AHA_0485"
FT   CDS_pept        516276..517205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0485"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39446"
FT                   /db_xref="GOA:A0KFJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ2"
FT                   /protein_id="ABK39446.1"
FT                   /translation="MSELAIRALGVSRRFGDFLAVDGLDLCVPKGQIHGFLGPNGCGKS
FT                   TTLRMLTGLLTPSAGEVEVLGLHIPREAETLRRRIGYMTQKFSLYDELTAWENLEFMGR
FT                   IHGMGGTVLAARLHELLATYELAPLARQRAGAMSGGQKQRLALAAAVIHRPALLLLDEP
FT                   TSAVDPQNRRDFWEKLFDLSEGGTTILVTTHYMDEAERCHQLAIMEAGRVRAQGAPQAL
FT                   MDAMSTRVVEVLAADLRLLKQQLVQLAPVRSAAQLGQRLRVLVDKELAEPVAWLQQACP
FT                   ALAGASLALVRPSLEDVFVSCTGQEPRA"
FT   gene            517312..518406
FT                   /locus_tag="AHA_0486"
FT   CDS_pept        517312..518406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0486"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38101"
FT                   /db_xref="GOA:A0KFJ3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ3"
FT                   /protein_id="ABK38101.1"
FT                   /translation="MNSLRRLWAITQKELRQLARDRLTFGMVVMIPLIQLLLFGYAINT
FT                   DVRQIPVGLVEMSQSVPGRLLVEAVKASQVVHIKQQYVGVQQAEAALTRGEVRAVLVLP
FT                   ADLSRRLSAGETAGQWLVDGSDTMIAGALLGLRNMPLSDLKPDLKTAPPTFETVLYFNP
FT                   ARRSAVNIVPGLLGVILTMTMIMFTSAAIVRERERGNLELLITTPVGSMELMLGKILPY
FT                   IGVGLIQVAIILGLGHFIFDVPINGALSQVLLATLLFIAASLTLGLLISTLAQTQLQAM
FT                   QMTVFILLPSILLSGFMFPYEGMPLPAQWIAEVLPATHFMRLIRGIVLRGGELSELLPD
FT                   VLWLAGFTLLVLTLAAHRFKKSLD"
FT   gene            complement(518484..519641)
FT                   /locus_tag="AHA_0487"
FT   CDS_pept        complement(518484..519641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0487"
FT                   /product="competence/damage-inducible protein CinA"
FT                   /note="identified by match to protein family HMM PF00994"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37416"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ4"
FT                   /protein_id="ABK37416.1"
FT                   /translation="MRIEIISTGDEIVTGLVVDTNAAWLSALLLEQGWQVRRRVTVGDN
FT                   LKDLKTVLAESASRAEVVLVCGGLGPTADDLTAQAAAEAFDQPLTLFPDWLATIEARYA
FT                   SRGRPMPASNAKQAWLPQGGEILDNPVGTACGFVVTHTGHQGPSLLFFTPGVPFEFKQM
FT                   VREQIMPRLKALAGAQTDTELRRFYTFGVSESALSDMLDAAPWPAGIELGYRSSMPLIE
FT                   LKLIGHGASAADMDAAEARLLAAIEPWLVGRGDKEPAQQILDLLGDKPLTLLEGESRGA
FT                   LLAMCHPHPALTASFSHALASELAQLAAPAAPLSLTIGRAGPDGVPLLLCVDGQLYGQT
FT                   LKVSHPDPDSGRRIIAFAALDMLRRQLQGLPVLGDYRTLARTASR"
FT   gene            complement(519702..521000)
FT                   /locus_tag="AHA_0488"
FT   CDS_pept        complement(519702..521000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0488"
FT                   /product="HD-GYP domain"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36755"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ5"
FT                   /protein_id="ABK36755.1"
FT                   /translation="MYSPPPLTSIRLSVSLASKTMTGIKISVDRLQVGNYVSLPLGWRE
FT                   HPFLFSSFKLKNEEEIELIRRLGLKLVTIIPDKSDAPPKPLNQIQAQPVEAPDTSQRQA
FT                   EMQLEKERRIEQLQQYRRDLQQCEKQFQQSLAQVRNVMSKIQSRPLNAIGEAQELINAM
FT                   TEQLLSVDEMVLHLVSDSEDGNNLYFHSLNVSVLSMLLAKECNMSADEIRQVGMGALFH
FT                   DIGKLKIPSQILRKTEPLTKPEQNLMAQHPRYGLDLLNLAKDFPAEAKGIVLHHHEYLD
FT                   GSGPEGLKKGQLDPLTQIVSLINEYDNLCHMQAKVPYSALSGLYKQRKAQFNPEYLSML
FT                   IRLMGIYPPGSVVQLSNGQVGLVMSVNASRLLYPSVLVYDPRIPRQEAAIIDLQQAELS
FT                   IAKVIHPKRLPPAVFEYLNPRTRISYYFEHTKP"
FT   gene            521085..522038
FT                   /gene="metA"
FT                   /locus_tag="AHA_0489"
FT   CDS_pept        521085..522038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="AHA_0489"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="identified by match to protein family HMM PF04204;
FT                   match to protein family HMM TIGR01001"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39388"
FT                   /db_xref="GOA:A0KFJ6"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFJ6"
FT                   /protein_id="ABK39388.1"
FT                   /translation="MPIKIPDQLPAAEVLGQENIFVMTESRAVTQNIRPLRVLILNLMP
FT                   KKIETEIQLMRMLSNSPLQVDVDLLRIDDRESKNTPQAHLENFYHDFEQVRGNNYDGMI
FT                   ITGAPLGLVEFEEVVYWPRIVEIIEWSHQHVTSTLFLCWAVQAALKALYGMEKQTHGEK
FT                   LSGVYRHHRLDEHEPLLRGFDDEFVAPHSRYAAFDGDLIRAHTDLQIFAESAEAGVYLA
FT                   ATKDCRQVFVTGHPEYDALTLDGEYQRDLAAGLEPVIPVNYYPDNDPTRTPRASWRSHG
FT                   HLLFSNWLNYYVYQLTSYRVEDIGKVFTYQQNSPSR"
FT   gene            complement(522047..522619)
FT                   /locus_tag="AHA_0490"
FT   CDS_pept        complement(522047..522619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0490"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39697"
FT                   /db_xref="GOA:A0KFJ7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ7"
FT                   /protein_id="ABK39697.1"
FT                   /translation="MAHSKTGSSPACLAIAGVIRIFMHPSHPFWSQEVPRVDGQLLLTP
FT                   CPGTQQVALPLALGQLKLAGAHGVLTLMTDAELARLELGRLGQQIEAAGMRWFQLPIED
FT                   DQAPDAAFEAAWQQTLPDLIGLLRDGKHLVIHCKGGSGRTGLVAAALLMSLGQPQQEAM
FT                   AAIRAHRPKAFTLACHRQWLDGLAEGD"
FT   gene            522713..523183
FT                   /locus_tag="AHA_0491"
FT   CDS_pept        522713..523183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0491"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38216"
FT                   /db_xref="GOA:A0KFJ8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ8"
FT                   /protein_id="ABK38216.1"
FT                   /translation="MRNLDQLDLDILAHLFRDAGMTNKDLAALVGVAPSTCLERVRKLQ
FT                   QDGVLKGAHCEVDYQALGGHIQAMVSLQLARHSRQIIDAFRDAILALPEVISLFHMGGK
FT                   DDFLVHLCVADTEHLRNFVFDHFTSREEVVHLETSLVFEHKFSRSLPCFLNT"
FT   gene            complement(523241..525205)
FT                   /locus_tag="AHA_0492"
FT   CDS_pept        complement(523241..525205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0492"
FT                   /product="sulfatase"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38012"
FT                   /db_xref="GOA:A0KFJ9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ9"
FT                   /protein_id="ABK38012.1"
FT                   /translation="MTTIRRWLGPFWPIAVFSLIALVSLSISRLALGLWQLERVDAVAG
FT                   WQEMLLQGLRVDFATLCWLWGVPAVFTLLLAGPHAVGRAWLQFIRVWLTLGLWLLLFLE
FT                   ISTPSFVTEYGVRPNRLYIEYLIYPKEVFAMLWAGRKGELLLALLFSGAVLAGGWWLSG
FT                   RLLRGISFPRWYWRPAFALLILAIGFLGARSSLGHRALNPAMVAFASDPLVNALTVNSS
FT                   YSLFFAIKQMRAEEDASQFYGELPRQRILDLVRQESGRESHEFSSDTLPSQTFNEASYG
FT                   GKPKNLVILLQESLGAQFVGSLGGLPLTPNIDALSKEGWAFEQLYATGTRSVRGIEAVL
FT                   TGFTPTPAQAVVKLGRSQTNFFTIADLLKQRGYDTSFIYGGESHFDNMRSFFLGNGFTT
FT                   IVEQKDFKNPVFEGSWGASDEDLMAKADETFQALSKQGKPFFSLVFSSSNHDPFEFPDD
FT                   RIALYEQPKQTRNNAAKYADYAIGEFFKKAKQSDYWKDTLFLVIADHDSRVSGASLVPI
FT                   PRFHIPGVIVGDGIAPRQDPRIVSQIDMAPTLLSLMGISADYPMLGKDLTRMPADWPGR
FT                   AIMQYDKNFALMRGKDVVILQPERAPEGFIYEDATETLTPAPQPATMKDAALGLALWGS
FT                   LAYQQGLYRTAPDTRTVLN"
FT   gene            525465..525722
FT                   /locus_tag="AHA_0493"
FT   CDS_pept        525465..525722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39527"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK0"
FT                   /protein_id="ABK39527.1"
FT                   /translation="MPVFIDVEYLQGWSLFVVLSDGTTGALDLTPWRTQPLFAALDSER
FT                   RCARVFINRHHQLEWPAGCILSAHEVYHLIKPIDEREAFS"
FT   gene            525968..527935
FT                   /locus_tag="AHA_0494"
FT   CDS_pept        525968..527935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0494"
FT                   /product="TonB-dependent copper receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01778"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38178"
FT                   /db_xref="GOA:A0KFK1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK1"
FT                   /protein_id="ABK38178.1"
FT                   /translation="MACHMRTPLALLVGGFACHGAAGQEPVQQLEPMVVVASRPASTLE
FT                   VTLDPKKPGSPMPAADGAGYLKNVTGMSMVRKGGLGGDPVLRGMGMSRLNVQMDGGMLA
FT                   GGCGGRMDPPTAYVFPQSFDRIRVLKGPQSLEQGATLAGTVLFERDRPEFTAPGVKAEA
FT                   SALYGSFGRDDQMLDATVGAPQGYLRGQFTHSDSDDYRDGHGDKVRSFYRRENGTAQLG
FT                   WTPSEHTWLELTAERSNARAAYADRTMDGPMFDRESFGLKLRQEQISRHWQRSELTLWD
FT                   NDIDHIMDNFSLRPNSGMKMLSNPDRRNTGGRWANDIALPADWLLTAGFDANRDQHRAR
FT                   SGVDYASQPRQRTLRFEQQGGFAELGRQQGAHSYKGGYRQDRVETTRYGAGDQTLYSDT
FT                   LTLDSGFGRYEYQWSPAWSSYLAWGQAKRAPDYWERSKDSVPFTLNPERSRQWDAGLAL
FT                   RSRELDLTLSLFSADIQDYLLYNNKSNKVRNIDAQTRGGELEGRWQFAEQWRLDGGLAV
FT                   VYGENRSDHQPLAQMPPLDGKLALGWQPAEAWNLTLLGRAVAAQERVDVGSGTVAGQDQ
FT                   GETPGFFTMNLSAAWQFQPGWQLSAGVDNLFDTFYYEHLSKSVHASQAGLGYEQVGRIP
FT                   EPGRAYWLSVSYRFASAGVL"
FT   gene            528005..529678
FT                   /locus_tag="AHA_0495"
FT   CDS_pept        528005..529678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0495"
FT                   /product="glycosidase"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38833"
FT                   /db_xref="GOA:A0KFK2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK2"
FT                   /protein_id="ABK38833.1"
FT                   /translation="MAPVWRFGRRYHHSGNITMKQGTLRHGGLIGAALLLTACGSGGGS
FT                   GSSEPQQPPVTNPPPATASRACYGNDQPACNLRTYQVMVESFVDGDGSANYGVGYGPSQ
FT                   HNGDLQGIIDSLDHIKSLNVNAIWLTPVFDSCAGQGGDDKLDATGYFACDFFNVDPNFG
FT                   SNVQLKQLVDGAHQRGLYVFLDGVFGHVNKVGVSKPSPEGRLPALKSGGAGYPGQLVDY
FT                   SQPQSLAYFKEVARYWVEQYGIDGWRLDQAYQLGLDDWRAIRSEVERASAARKTAGQQW
FT                   GTLGYMVGEVWKGADEIRAQAYGPSDNPALSSAFDFPLRYGLVQALAVEESGKGGQGAS
FT                   VLDASWNKVENYPNHAMPNLMLGNHDLVRFGDLLERGNFNPADYWQRHKAAFSFLAARS
FT                   GPITLYYGEEFGDEVPGFAKQVGGDCAAQGLCDDHVARSDGKVPGATGFVPSSEQSELK
FT                   QWLSQLLALRAAHPALYQGERVKLVAEGSVYGDIKQTAAEQVVYLLNVSSTPQSYAVPV
FT                   GKLRSASALVDLQSGESLAIGGSSVTVDLPPLSGRFLLVR"
FT   gene            complement(529733..530263)
FT                   /locus_tag="AHA_0496"
FT   CDS_pept        complement(529733..530263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0496"
FT                   /product="putative transporter, putative Mg2+ transporter-C
FT                   (MgtC) family"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37155"
FT                   /db_xref="GOA:A0KFK3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK3"
FT                   /protein_id="ABK37155.1"
FT                   /translation="MTTDWWDIAPLGWENILVCLVCGTLVGLERQLRGKPVGIRTSSLI
FT                   ILGTYCFLAIGAAVSPQSADQARVLGQLITGIGFLGAGVMMTRDGQVLGVTSAATVWML
FT                   AALGALIGMQMLHQALLLTGVTLSILVGVDYLETSFKSLRRGVHNRLESWRHGNGNVQA
FT                   APHQDELGSGIEK"
FT   gene            complement(530291..531733)
FT                   /locus_tag="AHA_0497"
FT   CDS_pept        complement(530291..531733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37004"
FT                   /db_xref="GOA:A0KFK4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR025839"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK4"
FT                   /protein_id="ABK37004.1"
FT                   /translation="MSTYVIVEEPGDWPCHADYLLTARTYLQHGVPTTGGRPRIINLCR
FT                   NLEHLSAGYYCSLLAQARGHHCLPGLQAISQLQPQQPPAKLWRKLQGWLAQQSEDRIRV
FT                   RAIFGQCEQSELAGLARYYYGLSQLPLQELTLKRGRHGWSVRQQQSLSPLELSTSEKEL
FT                   MLHHAQALVGTGDEEQAAPLYQLAILVDPNDGRASSDALALERFIQAAAAQGIRAEILA
FT                   PSAIERLPEFDTLWLRSETAVGHYTFEFARRAEQLKMPVIDSSRAILACSNKLYLYELM
FT                   VRSGVPMPPTMVVTRRGRHHVDELVQRLGLPLMVKVPDGAQGRDLAMASDEQQLARLLD
FT                   EGLARSALLLVQSRIPAEFDWRIGFLDGSPLFACRRFRPEPGNRIRRRKHPLDMSRIEA
FT                   LPLNEVPERVLQTARRAVHQLGNGLFGVDLRQQGRDCVLLEIIDNPWIRGDIEDREAKD
FT                   LYERLARAFRQRLENRGQSAAG"
FT   gene            531920..532378
FT                   /locus_tag="AHA_0498"
FT   CDS_pept        531920..532378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0498"
FT                   /product="Pab N-terminal acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36874"
FT                   /db_xref="GOA:A0KFK5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK5"
FT                   /protein_id="ABK36874.1"
FT                   /translation="MLTVRAARTDDLGAIVKLERYCFPPEVAFGRSRWHYLLTHAKGRT
FT                   LLVLDQQEQLMGYLCLLEHRGWDRLIIQTLAIRWTIRRQGWARRLLEQVIQEGKEAGWG
FT                   AIRLEVGDANEEAQALYRELGFRPRQKLLDYYGHGQHAHRLVLALKQA"
FT   gene            532393..532638
FT                   /locus_tag="AHA_0499"
FT   CDS_pept        532393..532638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36552"
FT                   /db_xref="GOA:A0KFK6"
FT                   /db_xref="InterPro:IPR022072"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK6"
FT                   /protein_id="ABK36552.1"
FT                   /translation="MSCDNCLATAIKAKLGRCPVCAGQTFVIGLVGWLVWWWCGADTSV
FT                   NALTGLLFALGGSGLLLLHLLVFVWRRATGRELSDE"
FT   gene            532695..533441
FT                   /locus_tag="AHA_0500"
FT   CDS_pept        532695..533441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0500"
FT                   /product="NADP-dependent l-serine/l-allo-threonine
FT                   dehydrogenase ydfg"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35974"
FT                   /db_xref="GOA:A0KFK7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK7"
FT                   /protein_id="ABK35974.1"
FT                   /translation="MIAMVTGASSGFGESISRQLVQAGYRVIGTGRRGERLAALADELG
FT                   AQFLPLVFDVQDKAATRAAIDGLPAEWREVDLLVNNAGLALGLEPAHKADLEDWEQMIA
FT                   TNISGLTLLTRLLLPGMVARNRGHVINIGSIAGTYPYPGGNVYGATKAFVKQFSLNLRA
FT                   DLAGTAIRVTNVEPGLCGGTEFSNVRFHGDDAKAATVYQGVQAIQPEDIANTVLWISQQ
FT                   PAHVNINSIEIMPVAQTFGPLNISRR"
FT   gene            complement(533503..535107)
FT                   /locus_tag="AHA_0501"
FT   CDS_pept        complement(533503..535107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0501"
FT                   /product="cytosol non-specific dipeptidase"
FT                   /note="identified by match to protein family HMM PF03577"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39780"
FT                   /db_xref="GOA:A0KFK8"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK8"
FT                   /protein_id="ABK39780.1"
FT                   /translation="MDEMFASSTMSSTIPRQRIGGRSLCGRPASHRLAFTHSYASGNPM
FT                   KKHTLSLLSATLLTLLGTSADACTGLIVGKGASADGSVMIARNEDFGVNNWNKYLAFRS
FT                   AQQNEGKVWKLGNGLEVPMPKAFFAYSAIRDWDATSSDPAGKYYEERGINEFNVAISAT
FT                   TSAEVNDKAQKADPLIEKGVIEAIIPTLILPQAKTAKEGVALLGRYVEQYGAGEGNSLY
FT                   LADVNEAWLMEIGSGHHWIAVRVPDDSYAMVANGLRIHGVNLDSADVLHSPKLLEFVRE
FT                   HKLLDNADPKEFNFAKAFGVIADPYNVDREWLGQKMLTASHPQPTRQAQYPLFMKPDAP
FT                   IAVPDVARLLSATYEGTPLAGKAERPIRIDRQLESHVIQLRKEMPKELQGLIWQSYGVL
FT                   AESVMVPLYNTLESYPLPYRTGSDSYSDDSAYWQFRSLTALASADPDKYLPLLRGVWSK
FT                   ESSKLYQEVALLDQSLKQAYASDKATAIGLAADYSYGQLEQTYQMAKELRYKLMTDLTK
FT                   RTEQKYSPEEFKKIMSL"
FT   gene            535441..535893
FT                   /locus_tag="AHA_0502"
FT   CDS_pept        535441..535893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39537"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK9"
FT                   /protein_id="ABK39537.1"
FT                   /translation="MDIKPYSQQLAQSASNNRALATLSSADSGQGGGWEDLVNLSSQRI
FT                   TGQAQQALTYEHLAKNSKLPPALDIGSDKGGVMQQLVDKALGFDRKKFNEIEEKLKTIA
FT                   DNKQLSAEERAEQSKPLNEQRDAMLQDAMDRLTGKKSSAKEETKSA"
FT   gene            complement(536092..536673)
FT                   /locus_tag="AHA_0503"
FT   CDS_pept        complement(536092..536673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38071"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL0"
FT                   /protein_id="ABK38071.1"
FT                   /translation="MKLKHAWIAGLLSLSTCLAQAAEVATEVATAPGKANLVEAVSAQA
FT                   TVTAIDMASRKVSLKNAAGEAFDIVAGEQVTNLANLKVGDVVALRYLQMLDLELLKGTA
FT                   GVRKRIVEVAAGKAEAGEKPGAGIGKKVTLYGDVIAVDKGQQTITVKGVDHTLVLKVHN
FT                   PAQFALIAKGDQIKAVQTQAVGIGILPEKK"
FT   gene            536885..538060
FT                   /locus_tag="AHA_0504"
FT   CDS_pept        536885..538060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0504"
FT                   /product="NADH-dependent iron-containing alcohol
FT                   dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38651"
FT                   /db_xref="GOA:A0KFL1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL1"
FT                   /protein_id="ABK38651.1"
FT                   /translation="MHSTEGSAVYNFQYANPTRVCFGEGQIAKLPELIPAGSRLLVLYG
FT                   GGSIKQNGVYEQLTQALAGREWLEFPGIGANPQYDQLMEAVALVKRERIDFLLAVGGGS
FT                   VVDGSKFVAAAACFEGADPWEILLHKAPIKAALPLGCVLTLPATGSESNPAAVVSRGEA
FT                   KLSFMNPLVQPVFAVLDPTTTYSLPPRQVGNGVVDAFVHIIEQYLTFPVGGEVQDRLAE
FT                   GLLQVLVDNGPRALAEPTNYQVRANLMWAASLALNGLIGRGVPQDWSTHAIGHQLTALH
FT                   GLDHAQSLAVVLPSLLREQSGQKQEKLAQFAERVWHSSREDKALRIEEAIIRTEQFFQQ
FT                   MGVGTRLADYGLSESCIPGICSNLKRFGLTALGEQQDIDPDKVARILSHAL"
FT   gene            complement(538265..538963)
FT                   /locus_tag="AHA_0505"
FT   CDS_pept        complement(538265..538963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0505"
FT                   /product="glutathione S-transferase III"
FT                   /EC_number="2.5.1.18"
FT                   /note="identified by match to protein family HMM PF00043;
FT                   match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37784"
FT                   /db_xref="GOA:A0KFL2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL2"
FT                   /protein_id="ABK37784.1"
FT                   /translation="MASGEPATALLRITAFRHCVEVSMIVLHHLNKSRSQRIIWLLEEL
FT                   GLPYEIKAYQRDAATFLAPPELKAIHPLGKSPVIEFDGRVLAESGAITEYLIARHAPER
FT                   LAPAQDSPDYAEYLQWLHFAESSGILPLLLDMFVRKDGSPMRFLPDYAKAECAKVLGYL
FT                   NDVLATRQYLVGGRLTGADILNSFLVDLLAQSGQLAQFPHLQAYWQRLNTHPARQKAAA
FT                   RERELDRSAG"
FT   gene            complement(539003..540271)
FT                   /locus_tag="AHA_0506"
FT   CDS_pept        complement(539003..540271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0506"
FT                   /product="O-acetylhomoserine sulfhydrylase MetY"
FT                   /EC_number="2.5.1.49"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01053; match to protein
FT                   family HMM PF01212; match to protein family HMM TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37755"
FT                   /db_xref="GOA:A0KFL3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL3"
FT                   /protein_id="ABK37755.1"
FT                   /translation="MKDATLALHHGFTSDPTTKAVAVPIYQTVAYEFESAQHGADLFNL
FT                   AVPGNIYTRIMNPTNDVLEQRMAALEGGIAGLVVSAGSAAITYAIQALTAAGDNIVSTP
FT                   QLYGGTYTLFAHMLPSFGVEVRFAKDDSAEAIAALIDDKTKAVYCESIGNPAGNIVDLA
FT                   AFAKVAHARGVPLIVDNTVATPVLCKPIEHGADIVVHSLTKYVGGHGNSLGGVIVDSGK
FT                   FPWADHAERFPQLTKPEPSYHGVVYTEAFGPAAFIGRVRTVPLRNTGAALAPMNAFLLL
FT                   QGLETLSLRMERHVDNALRVAHHLKHHPKVAWVSYAGLPGHPHYLLAEKYMAGRPSAIL
FT                   SFGLKDGYEAGVRFYDALKIFKRLVNIGDAKSLACHPASTTHRQLSEAEQAKAGVKPEM
FT                   IRLSVGIEAIEDILADLDQALEA"
FT   gene            complement(540428..540604)
FT                   /locus_tag="AHA_0507"
FT   CDS_pept        complement(540428..540604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38369"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL4"
FT                   /protein_id="ABK38369.1"
FT                   /translation="MSHANPIKPNRIQQILRRYFKRILPRPLTLIEDPMSQLNRLMQWD
FT                   MNQIDDREYRRRL"
FT   gene            540675..542438
FT                   /locus_tag="AHA_0508"
FT   CDS_pept        540675..542438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0508"
FT                   /product="bacterial extracellular solute-binding proteins,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37974"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL5"
FT                   /protein_id="ABK37974.1"
FT                   /translation="MTFSNRISPFMPTSRLYQQFQRLAQQLGCDEREISLAEVADLLCC
FT                   TPRNARLLLRRMQDQGWLSWAAEAGRGRRSRLTLLDNQESLTRRRLRDLLSQGQLAQAV
FT                   RLAEDRLDLLTPLLIEQLGQATREGRQILRVPYYRPLPRLLPTGPLRRSEIHLSRQIFN
FT                   GLTRRNEENGEIEGDLAHHWECLGPCHWRFYLRPAVRFHHGRELVVEDVVESLLALRDR
FT                   PLFAHLARLESPWPRTLDLHLDSPDPLLPQLLAEPVAAILPRELKEEAGFALQPVGTGP
FT                   YRVTANDPLQLCLEAFDDYFGLRALLDEIDIWMLPELAERLESHLQLGRDSPELGTMRG
FT                   ESELESGCYFLLQDDRSASLQDPALRQWLAGLLNPIALMARVAPELQRGWTSALGLLPH
FT                   WREAQPAPLPMPEQLPRQLVLACFNQHLEFNECANAMSSLLAEQGIRLEVRTLDYGRWV
FT                   SGVDEDVDLWLGTLNLEHEHAFAPYAWLQGTPLLRKVWGSQQRLWQGLTQWRASGEEPG
FT                   PRALLASVQQQGWFVPLFHHWLELESRVGVHGVRMTALGWFDFRSAWLRPELAVGGGDT
FT                   TGELESKGGPR"
FT   gene            542474..542869
FT                   /locus_tag="AHA_0509"
FT   CDS_pept        542474..542869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0509"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37087"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL6"
FT                   /protein_id="ABK37087.1"
FT                   /translation="MLEMQIQPRFQETDALGHINNTVPAVWFESARDPLFRIFSPELDV
FT                   HNWHLIIAGYTVQFKRELFYGQQVLIKTGVRRIGSSSFTLWQEAWQGDELAVTAETTLI
FT                   HFDYQSRQSIPLSDRHREGLRAWLIES"
FT   gene            542901..543614
FT                   /locus_tag="AHA_0510"
FT   CDS_pept        542901..543614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36351"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL7"
FT                   /protein_id="ABK36351.1"
FT                   /translation="MRNTVIALSLGLGLGLCSLPSVAASLAEQFSLMEKGAESALDTRL
FT                   FSHDGVDIKAWVDGAPVIIAVPIMNEQGKLEGESRYYFKGGKLFGVKEPAAQFAFDDGG
FT                   KLTQWLDEKGQPAEFVSKMSMQQREVWLTKRAAELGKLFAQSPAEQKAAKGGVKLKGAE
FT                   LAHWLCNGKLMALAGGDKVTFEQAKLKTRAEGIEGEVSLRQEKGWQDLSLKCEVQGSQV
FT                   TRLTWQPLPGANKPQ"
FT   gene            complement(543679..544422)
FT                   /locus_tag="AHA_0511"
FT   CDS_pept        complement(543679..544422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0511"
FT                   /product="lipase chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37620"
FT                   /db_xref="GOA:A0KFL8"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL8"
FT                   /protein_id="ABK37620.1"
FT                   /translation="MNKAWLMAAPLGAALLLGGWQLWPAPNSTPATPPVDEAGPSSPLA
FT                   RQAASSPDESSLQARYEAFLAAEGSLTVPTDPGLASLQVLFDEREQLRQQSFTPAEQEQ
FT                   LFAEDRLMEQWTLRRKALAEAGDADKPLLASELELWLAEQPQWFREAEANSRLLGDLQS
FT                   LERLPAAERDAVLREQLGPEAADRLHQLAESQQGFEQQLAGYLAESKPLPAERRAEQQP
FT                   EILARWFEPDQWRRVEALTRLRLGE"
FT   gene            complement(544419..545420)
FT                   /locus_tag="AHA_0512"
FT   CDS_pept        complement(544419..545420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0512"
FT                   /product="lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37008"
FT                   /db_xref="GOA:A0KFL9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL9"
FT                   /protein_id="ABK37008.1"
FT                   /translation="MQMSRSIMLVGTGMRPVVAAAATLFTRMDKMKKWLLVLLCALPML
FT                   GQAAGYTQTRYPIVLVHGLFGFDKLLGVDYFYGIPQALTRDGARVYVAQVSATQSSELR
FT                   GEQLLKQVQQVLAITGAEKVNLIGHSHGGPTIRYVASVAPELVASATSVGGVNYGSEIA
FT                   DLVRANVAPGSVAEKLAVAAASALSGVISLLSGGSQLPQDPLAALDALTSAGAQRFNQR
FT                   YPEGLPNQYCGEGPMQAANGVYYFSWSGRGTMTNILDPVDPALALTGSFFKEPNDGLVG
FT                   VCSSHLGKVIGTDYRMNHLDEVNQSFGIRHLFETDPISLYRQHANRLQRLGL"
FT   gene            complement(545500..545622)
FT                   /locus_tag="AHA_0513"
FT   CDS_pept        complement(545500..545622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36183"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM0"
FT                   /protein_id="ABK36183.1"
FT                   /translation="MLLSLSSVPTHPLTQLAAMILNTTNDNNYYLTYVSGEHKG"
FT   gene            545621..546046
FT                   /locus_tag="AHA_0514"
FT   CDS_pept        545621..546046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35849"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM1"
FT                   /protein_id="ABK35849.1"
FT                   /translation="MVHWKVQTMSGNRHFDAGEHGKALSCYQQALWLARQQFTGWHDVD
FT                   EAVAALVVAHHNLADLLVAMARPERAADLLCHIHDCLLATSQSPASPDPLRDAALRHTR
FT                   STHAELLAFLRKHGNHDGIRRCLGQCLCQTESARQLH"
FT   gene            546068..546682
FT                   /locus_tag="AHA_0515"
FT   CDS_pept        546068..546682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0515"
FT                   /product="superoxide dismutase (Mn)"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by match to protein family HMM PF00081;
FT                   match to protein family HMM PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39737"
FT                   /db_xref="GOA:A0KFM2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM2"
FT                   /protein_id="ABK39737.1"
FT                   /translation="MSHTLPALAYAYDALEPHIDALTMEIHHSRHHQTYINNLNAALAD
FT                   LPELAALPVEELLARFDSLPGKVQGAVRNHGGGHANHSLFWQVMSPQGGGEPGGELAAA
FT                   ILRDLGGLEAFKQAFTQAALSRFGSGWAWLVVDRSGKLQVVSSANQDSPLQDGQVPILG
FT                   LDVWEHAYYLKYQNKRPDYIAAFYNVIDWSEVARRYVAALA"
FT   gene            complement(546736..547761)
FT                   /locus_tag="AHA_0516"
FT   CDS_pept        complement(546736..547761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0516"
FT                   /product="sanA protein"
FT                   /note="identified by match to protein family HMM PF02698"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36644"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM3"
FT                   /protein_id="ABK36644.1"
FT                   /translation="MTLCHLLLQTRTAPRMKKFAKILLACLCLLLASVATLLGYSEWTV
FT                   SDARHYTYDDVNAVPYNRVALVLGTSKYLIGGSPNHYFKYRIKAAAELYNNGKVDYILV
FT                   SGDNATVQYNEPRQMRRALIQAGIPANAIYSDYAGFRTLDSIVRAKEVFGQAHFTVVSQ
FT                   AFHNERAIFIARHFGIEAVGFNAVDPSAYQGIKTRVREVFARLMGLLDLYVLDKGPKFL
FT                   GEPIVIGGPVPCQALSTIGASQPCLPIAPPPHKPKAKPAAAVSAATATSAAAATSGAVA
FT                   TSAAVPNEAAPVDNPAAASAATPAGNIPATNTAVPSEVTPVDNPAAASAAPPTSSALTP
FT                   Q"
FT   gene            complement(547928..550675)
FT                   /locus_tag="AHA_0517"
FT   CDS_pept        complement(547928..550675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0517"
FT                   /product="collagenase family"
FT                   /note="identified by match to protein family HMM PF01752"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38430"
FT                   /db_xref="GOA:A0KFM4"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM4"
FT                   /protein_id="ABK38430.1"
FT                   /translation="MNNLGTRLLLLAAPGLFATSALANYSPSDWQQYQLKGESSRQLGD
FT                   RLTEVTYELSARSGGAPYQQLRVYRRFDWSDANLAALAEQQCGEPQLKIELGWQIRYLS
FT                   CEEVVPAGKAVPASSYDYGYGMKQGRWEPLAGTPTAPRQDRLPLAERVILGHSEQELDR
FT                   CELNAEGRCAEQAWQYQPQNWQQLKVLEETPNERDGRLEQIFFRLQPIVGSQAAKQVSE
FT                   LHVWRQYTWLLEQAKTQQECDEPQTRQEGDKTISYRVCRQTLPAGSEVQVVLKDTGYQY
FT                   PVGGSEWQTLPETTEWQESRVLNHPIVLASKEEQLDCRRADGRACSEPDLPGTELLDAE
FT                   AAKIVQDASGQPAPVWQENYGHDDTKLLAVSRGIQSLLAANQPAHPAMKLLLEYVRAHN
FT                   YHNYGKHKEDGPAAAEALAEALTALGAHPLLFPEQASDEVGAVMGAWSIALHGQFKSPA
FT                   VQSRFGTLLGEFNQMLAYSTRHASEINGQHAWATGLFDLLNFLDFASDYSDPFANDFRQ
FT                   QDGELRKQLHALGMSELALWKGRDGADLFLLNNVLDAYTRLYRVARYTRPDELDGYRKL
FT                   LDDSVIALVRHHNLIPGGQQSQDLLEDMSLTLSTYYLTYTDRTSEACISGDFAGLCTPV
FT                   RVEDVLPFEHTCSPTLRLRAQDLTMDQAEGICRELGAEEQQFHQQMETGWQPVADDHNE
FT                   ALELVVFNSSADWKRYGSALFGGVSTDNGGIYLEGDPARPGNQARFFAYEAEWKRPAFQ
FT                   VWNLRHEYVHYLDGRFNQYGSFGHYPLNRTTWWSEGLAEFIAHGQCFARGLDNVAGRPA
FT                   SDRPALADILHLDYDKGGEMVYSWSYTVHRFLNETGRGASWLAMAQALRNPDQQQAMST
FT                   FEAELDQLIANDSEAYQQWLGRELLPWWEANKDSDECKANDSSH"
FT   gene            complement(551179..551550)
FT                   /locus_tag="AHA_0518"
FT   CDS_pept        complement(551179..551550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0518"
FT                   /product="putative fimbrial protein"
FT                   /note="identified by similarity to GB:CAA54702.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37893"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM5"
FT                   /protein_id="ABK37893.1"
FT                   /translation="MRCPFRTTTCDEKDIKMNTSTASVRNSAIRFASSAAAAMLLGAAL
FT                   LPATASAADGTITFTGTIYEAPCDFADNSVTCYSGTQRQTLDLASLQQAGSLNTISSTM
FT                   QYKLSAGSSNMAIVTVSYL"
FT   gene            552789..553331
FT                   /locus_tag="AHA_0519"
FT   CDS_pept        552789..553331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0519"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39596"
FT                   /db_xref="GOA:A0KFM6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM6"
FT                   /protein_id="ABK39596.1"
FT                   /translation="MKANKILVAMGVGSMLLCGSAVAAGGAGSGKVTFNGEIINAPCSV
FT                   APESVDQVVEMGQISTKELASGGESNSKPFSIKLLNCEISDKEDAVKVTFSGAKDPVDS
FT                   SLLVIGGGDAAGAGIKMTAPGGAPIVLGTPTAAFGLVNGDNELPFSAVLKGYADQTANP
FT                   LKAGAFTAVTNFTLSYE"
FT   gene            553413..553820
FT                   /locus_tag="AHA_0520"
FT   CDS_pept        553413..553820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39039"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM7"
FT                   /protein_id="ABK39039.1"
FT                   /translation="MIMKTSMMAAMVLQLVMMAGSVHANELTDGLAESGCTLEVLRSIP
FT                   LQARQPGTLKISGCQVEGATEASLPFISMSVRGAMSDELGILNNGQYHKVSGERFIVSD
FT                   IVNSDLEFNLGLTSSQLFFQDSTTLFELNYM"
FT   gene            553888..556422
FT                   /locus_tag="AHA_0521"
FT   CDS_pept        553888..556422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0521"
FT                   /product="outer membrane usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39706"
FT                   /db_xref="GOA:A0KFM8"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM8"
FT                   /protein_id="ABK39706.1"
FT                   /translation="MSVSTSDSVRKKHYSKMVFMLCVPGLMAVANHAWAETEFNIDALD
FT                   LDERTKIDLSQFADEGYILPGDYYLEIEVNKNKLPLQKIPFYETDTGKGKGGVACLPQE
FT                   VIPKLALTDEAIAKIDTWHDGQCANLLALDGVVIANDIGNGLLRIAVPQAWMKYSDPNW
FT                   IPPEQWDEGIPGMMLDYNINAQVNEGDGYSNRNISSYGTLGFNYGAWRLRGDYQANAYW
FT                   GDNERTTSELNRIYAYRPLPDMAAKLTVGEQQLNSQLIDGFRYTGVNLANDERMLPPSL
FT                   QGYAPEVSGIAKTNAKVTISQSGRILYETNVPAGPFRIQGLDSSVRGRLDVRVEEQDGS
FT                   VNSFQVDTATVPYLTRPGYVRYNLAVGAPSEQTDSVHDVHGPAFVTGDFSWGVANSWSL
FT                   YGGSLVAGEYNSMGLGIGRDLYAFGAISADLTQSIAKLPGLSTKIGQSVRVNYAKQFDE
FT                   YNSSITFAGYRFSQHNFMTMSQFLSNKERLEKNETTSSDDYNTWGDKELYTITANKTFW
FT                   AEDAAKALTVYLDYTHRTYWEHDAEDRYGLTINKNVNIGSFKDVSVYVSAYKTKTENYE
FT                   DDKSVMLTLSMPIGDRKSAGYSVQSSNGKVTHLATYQDYSRPDDTYQLGAGVQSNGHAV
FT                   ARGYYNHNSDIGAVSLNAYSVQSEYTSVGASLRGGLTATQHGAALHQATRRGGTRMMVD
FT                   TDKTSGVSFNNGRAVTNRFGVAVISDMTDYRKSDTRVDVDQLSDDIDAMNAIKQGTLTE
FT                   GAIGYNAFEMAEGFKLLANVKLPDGSVPPFGATVVKDSGRVLSVVDEDGLVYLTGVKPN
FT                   EAFELSWGGARQCKIVAPQQVTDLSMKTLTCK"
FT   gene            556433..557164
FT                   /locus_tag="AHA_0522"
FT   CDS_pept        556433..557164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0522"
FT                   /product="fimbrial chaperone protein"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39049"
FT                   /db_xref="GOA:A0KFM9"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM9"
FT                   /protein_id="ABK39049.1"
FT                   /translation="MKKLLSYTCLAVLGMTSLNVSAAIVLDRTRVVYPGGAKSISLNIK
FT                   NENQKLPYLAQSWIEDAQGQKIASPFAVLPPVQRVDANQKSIVRIASVPAIDSLPKDRE
FT                   SIYYFNLREIPPKSEKSNVMQIAVQSKIKLFYRPEAILPERGAIWQDQVLITKLGKALK
FT                   VNNPTPYYITYVGLGHPQGKGRTAMKGFSAFMVAPKSEQTVTIPEALGNEFVISYVNDY
FT                   GGYMDIKYQCKGDRCESVKEK"
FT   gene            557169..558203
FT                   /locus_tag="AHA_0523"
FT   CDS_pept        557169..558203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0523"
FT                   /product="fimbrial protein"
FT                   /note="identified by similarity to GB:AAV78666.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36767"
FT                   /db_xref="GOA:A0KFN0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN0"
FT                   /protein_id="ABK36767.1"
FT                   /translation="MLRKASIAGLLLSLLYPALSYGNGYVYPDGGTYEYDIDLGNSSIK
FT                   NEKGYETKPPLEWDLKRQYNASIDCSNGRIKGPTYFKAIMNESIPPVGGGFMKLNEFLD
FT                   MKVEIWFEGNRRTYVTAPFTEESNRLEWTCYSPSDRFSYRSGSKGKVTFRVRKPIINGV
FT                   QIEDRKVVEMFGRLGGSAANGYGPMAMSRIIIKSALLYVPEECTINGGQTIEVEFGDLP
FT                   GNGLDGNNFEKTVPLTFQCKGGEFEGNALKINLGISGKAASFSDEYLRTTKDGYQGGAV
FT                   IPDLGIKFKQLDGSQMSINKFYPVSMQGNIGDWGFIAAPVSPAGADVAAGDFYATATIV
FT                   AEFQ"
FT   gene            558215..558766
FT                   /locus_tag="AHA_0524"
FT   CDS_pept        558215..558766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0524"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36075"
FT                   /db_xref="GOA:A0KFN1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN1"
FT                   /protein_id="ABK36075.1"
FT                   /translation="MLRTLLISLMLSPLIAVAAIPRAGDGLELRGDKLNLHGRIIDQPC
FT                   VVAPESLEQEVEMGVVDVKQLYANGAGEQVPFSIRLTNCKPGIFRMAKVTFTGSKDAQL
FT                   SGGLAFTAGIAKGAGIRLYDVTQTPLDLGTPSRGYLLGGSADNELQFFARVEGHPDALA
FT                   AKNIQPGDYSAVANFIVAYE"
FT   gene            complement(558769..559452)
FT                   /locus_tag="AHA_0525"
FT   CDS_pept        complement(558769..559452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN2"
FT                   /protein_id="ABK37919.1"
FT                   /translation="MTSETEKALNVKIDSLIPLIQRISRKADEQVSILVGKEAISYFSI
FT                   DNNSRKLSENVFLLRSGHPVAEEVQCVITTMTQQGDNVSHNYYNNPDTTVRYHSNCQAP
FT                   DNWVEMTRKSKFIVTMNREIVVATVIATDNQGKTLFNLDSVGDLERDDGDISVEVKNTI
FT                   VNFIDQQALTSNGMVATLVAALTPPKQTAQFVQLPGGIYLSNYLGGVITWPSLGNSKVI
FT                   QRNDL"
FT   gene            complement(559449..560009)
FT                   /locus_tag="AHA_0526"
FT   CDS_pept        complement(559449..560009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0526"
FT                   /product="transcriptional regulatory protein, C terminal"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39625"
FT                   /db_xref="GOA:A0KFN3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN3"
FT                   /protein_id="ABK39625.1"
FT                   /translation="MSNKNYKIAEEIFFSAAIFRLSKGEKDIKLSNKEAELLEMLCDEA
FT                   GSVIPRSKLQDALWPNQDNTDTNLNRQILSLRRKLESFGLMDAIDTIPRVGYIFCAPIE
FT                   AAGETEEAAPNEETQAANPSHAPQARRQYTRRKYDRYFSPKRILLFALLLVSLTSLAIV
FT                   IYNYATANTLRTINLSQISLYSI"
FT   gene            complement(560311..561717)
FT                   /gene="menE"
FT                   /locus_tag="AHA_0527"
FT   CDS_pept        complement(560311..561717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="AHA_0527"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /note="identified by similarity to SP:P37353; match to
FT                   protein family HMM PF00501; match to protein family HMM
FT                   TIGR01923"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37569"
FT                   /db_xref="GOA:A0KFN4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN4"
FT                   /protein_id="ABK37569.1"
FT                   /translation="MPPLSDHHHPLQPCPVRHWARSASDRIAIHAADPLTYQQLDIRLN
FT                   GLCRQLGQAGLQAGDRLAAVVRGALPDLLLAWACVRSGIVFCPLNPAFPLARQAELAAL
FT                   LAVRACWSAGEIPTGNWQPLRLDFTHELVADEGDCMLDPARLNNMILTSGSSGTPKAVV
FT                   HRLANHLASARGSAAVIPLDAECGWLLSLPLFHVGGYAILFRVFLAGAALVLDDRRRPL
FT                   RERLEQQPITHLSLVPTQLWRLLAEGFDPARTRLRELLLGGAAIPQPLVNRLSAMGLVP
FT                   KVSYGLSEMGSQVCTGQPSTAGVVGKALPGREVCIQQGEICVRGDTLFAGYFKQGGLER
FT                   PLDEAGWFHTRDKGHFTVDGELVVEGRLDNLFISGGENIQPETIEQRLVDHPAVAQALV
FT                   VPVPSDEWGQRPAAFIEWHGEPVPPAELAAWIRQTLPGFMVPDQWHPWPDLGGHLKPQR
FT                   RQYQNILKAQ"
FT   gene            complement(561728..562657)
FT                   /gene="menC"
FT                   /locus_tag="AHA_0528"
FT   CDS_pept        complement(561728..562657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="AHA_0528"
FT                   /product="o-succinylbenzoic acid (OSB) synthetase"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM TIGR01927"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37251"
FT                   /db_xref="GOA:A0KFN5"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN5"
FT                   /protein_id="ABK37251.1"
FT                   /translation="MTLALYRYQLPFTQPLTFHGKVEVAREGLLVRVDDGWGEIAPLPG
FT                   FSRESLAEAQAEAIASLEQLAAGQEIAPQLPSVQFGLDCARRCWPAQTTPLPEPYPLIQ
FT                   GSPQELLKHWKNWLHTTPSKAKLKVARYPMRDELALIRLLCDRIPTLKLVLDANQGWTR
FT                   EEAWAFCGHLDPNRIEYLEDPCANFADIAFVANRTGMPVAIDELLAQGKPWEPIPQLRA
FT                   LVLKPTLLGSLAHCEALVARARELRLKVIVSSCFESGLGLNQLFHLAGEWAPDQAPGLD
FT                   TRRWLAADLLDATGKPDLSLLEPLFHRD"
FT   gene            complement(562657..563517)
FT                   /gene="menB"
FT                   /locus_tag="AHA_0529"
FT   CDS_pept        complement(562657..563517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="AHA_0529"
FT                   /product="naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="identified by similarity to SP:P0ABU0; match to
FT                   protein family HMM PF00378; match to protein family HMM
FT                   TIGR01929"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38664"
FT                   /db_xref="GOA:A0KFN6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN6"
FT                   /protein_id="ABK38664.1"
FT                   /translation="MIEAMTEAELYAPVEWRDCSAGYEDILYHKSDDGIAKITINRPQV
FT                   RNAFRPRTVKEMLQALADARYDDQIGTIILTGFGEKAFCAGGDQKIRGDYGGYRDDEGT
FT                   HHLNVLDFQRDIRTCPKPVVAMVAGYAVGGGHVLHMMCDLTIAADNAQFGQTGPKVGSF
FT                   DGGWGASYMARIVGQKKAREIWFLCRMYDAKQALDMGLVNTVVPLAELERETVRWCREM
FT                   LQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKRRPDFSK
FT                   YKRNP"
FT   gene            complement(563510..564280)
FT                   /locus_tag="AHA_0530"
FT   CDS_pept        complement(563510..564280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0530"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38232"
FT                   /db_xref="GOA:A0KFN7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN7"
FT                   /protein_id="ABK38232.1"
FT                   /translation="MAASADQPTLVLLHGLLGDAHDWQPVQAALAGLPSLALDLPGHGS
FT                   NRAVRVAGFEQAHRWLCDELAARDIDRYQLVGYSLGGRLALYHASQSLVGLQALLLENC
FT                   HPGLPPAERPARLAHDEGWARRFEQEPLAAVLADWYRQGVFADLGEDARARQIARRLGN
FT                   DGEAVAAMLRATSLGQQPNLGPWLAQGALPVTWVSGKRDHKFHQLACLMASQHRKINHL
FT                   ELDGGHNLHAHQPETFARLLAEWVNQQQEEKRHD"
FT   gene            complement(564270..566000)
FT                   /gene="menD"
FT                   /locus_tag="AHA_0531"
FT   CDS_pept        complement(564270..566000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="AHA_0531"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.71"
FT                   /note="identified by similarity to SP:P17109; match to
FT                   protein family HMM PF02776; match to protein family HMM
FT                   TIGR00173"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38545"
FT                   /db_xref="GOA:A0KFN8"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFN8"
FT                   /protein_id="ABK38545.1"
FT                   /translation="MSARQEFASHHATFNHVWSSLLLEELFRLGVRDIALASGSRSAPL
FT                   TMAAAAHPGFRRHLHFDERGLGFMALGLAKGSGRPVAVIMTSGTAVANLWPAVAEAQLT
FT                   GVPLIILSADRPPELIDNGANQAIDQQGIFGRYPVYQQNLPSPTATIPAAFVLSSVDQA
FT                   LAQQARTPGPVHFNCMYPEPLYPGDAYLDFSAYLAPLGDWLRSSEPWSPWQLTQAPCPC
FT                   QPDWDELQGKRGLIVAGRIQDPVQAKAVAALAERLGWPLLADLQSQLRFDGRNLVHADL
FT                   ALQHSGFVAELARAEVLLQFGARLISKRLGQFIKQQPWQAYWLIDPQPARLDPDYRLRR
FT                   RLLCDPAAFAAAHPVAHPHLPWHRLAERQQAVSQQVRSACERFSELGVCHRLNQLIRGQ
FT                   LFVGNSMPARLMDMLGEAGKGPSRVMTNRGASGIDGLIATAYGFAQSVQPGSNEPTTLL
FT                   LGDLSALHDLNSLALLGKSSRPLVVILLNNDGGSIFRMLPVPTQDALLETYYCLPHGLH
FT                   FEHAAAMFGLHYRTPASLADFERDYTTALEKGVTLIEIKVPSSEVAEDLKALGSAIRGS
FT                   "
FT   gene            complement(566035..567381)
FT                   /gene="menF"
FT                   /locus_tag="AHA_0532"
FT   CDS_pept        complement(566035..567381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="AHA_0532"
FT                   /product="menaquinone-specific isochorismate synthase"
FT                   /EC_number="5.4.4.2"
FT                   /note="identified by similarity to SP:P38051; match to
FT                   protein family HMM PF00425; match to protein family HMM
FT                   TIGR00543"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38715"
FT                   /db_xref="GOA:A0KFN9"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN9"
FT                   /protein_id="ABK38715.1"
FT                   /translation="MLAQTHIKQQLDALRHGNASGFVRLRVAIEVGSFLGWLAAQTLYP
FT                   RIYWHARGHDRPEYVALGCLRELTEPQAIRQVCEHTSQPHDDSPRYYGGLAFDPTQPGW
FT                   QGFGPCRFVLPRIELVRRGECVTLCLNLWLPEQTGSDAFEVELQAAAAALDALRPEAPL
FT                   PPLTRHSWQREDCPSQPQWQTLVEQVTAPEFQAHTPKVVLSRQSRLTHDGATLTADPQA
FT                   VAPWSLLASWAQHGQDCFHFGFQFSPEQSFIACSPERLYRREQQHLFTEALAGTIRRSG
FT                   DEATDAALAAELLADSKNRLENRLVHADILSRLAPLTTDATLTEPRILKLRLLQHLKCD
FT                   IEAELKPGVCDWQLLEALHPTPAVGGAPREAALAFIREREPYDRGWYAGACGMLSRETS
FT                   EFSVAIRSARITAQAITLFAGAGIVAGSEPAAEWAELDNKIANVLSLLG"
FT   gene            567571..568494
FT                   /gene="menA"
FT                   /locus_tag="AHA_0533"
FT   CDS_pept        567571..568494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="AHA_0533"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by similarity to SP:P32166; match to
FT                   protein family HMM PF01040; match to protein family HMM
FT                   TIGR00751"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39485"
FT                   /db_xref="GOA:A0KFP0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP0"
FT                   /protein_id="ABK39485.1"
FT                   /translation="MFGHHNMTNTLSIWLLAARLRTLPLACSSILLGSGLAASRGAFDG
FT                   TIMALSLLTAILLQILSNLANDYGDAVSGADNGERIGPQRAVVSGLITRRQMCVAMALT
FT                   ALAAVVSGLALLGCAFGDQWLQILTFVLLGGAAIVAAITYTVGKTPYGYRGFGDISVFL
FT                   FFGLLGVLGSYYLFTKTLQWDLLLPATACGLLATAVLNINNVRDIETDAVSGKITLAVR
FT                   LGRNRAIAYHWVLLGAALLTTIAFLLTQPASFWPWIFLPAMKPLTDAAKTLRQSFDGEV
FT                   LTGALKKTAISAFLFSLLLSIGLALS"
FT   gene            568547..568816
FT                   /locus_tag="AHA_0534"
FT   CDS_pept        568547..568816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38883"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP1"
FT                   /protein_id="ABK38883.1"
FT                   /translation="MLVGVCWPANHSSGRNAAMRDSLKQKIIQVCHQKIAQKGEAVGVS
FT                   FYAFFTNRNDDPELLMEAATWWIQTQRLDHFEKATKILQLVEQA"
FT   gene            complement(568896..570293)
FT                   /locus_tag="AHA_0535"
FT   CDS_pept        complement(568896..570293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0535"
FT                   /product="propeptide, PepSY amd peptidase
FT                   M4:PepSY-associated TM helix"
FT                   /note="identified by match to protein family HMM PF03413;
FT                   match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37297"
FT                   /db_xref="GOA:A0KFP2"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP2"
FT                   /protein_id="ABK37297.1"
FT                   /translation="MKNRDANHYQRIWRWHFYAGLFVAPFLILLSLTGIVYLFKPQLDN
FT                   LMYPELMKVAPVSQPLSADQLLVKAMVTMPDASLSKYLPPVSPEASAQFIVRQGGNELT
FT                   LFLDPASGTLLGTLDNKWNLQAVARALHAELMIGTVGDRLIELAAGWGIVLLISGLYLW
FT                   WPRKGPGVGGILWPRWSQRGRLWWRDLHAVVGFWGAGFLLLLLLSGMTWTGFWGDQFAA
FT                   VWNRFPAAMWNEVPKSAPLARSLNHAHQQTVPWAVENTPIPSSAEPKAHDHSAMGHGGE
FT                   HDGMVMTEHRIPLQQVVEIATARQVTPGYSITPPAGASGVYTIAISADDPRNDATLHID
FT                   QYSGKVLADVRWQDYGPVAKTVETGVMLHMGKLYGWPHQLAMLLICLLVLLSSVSGLWI
FT                   WWSRRPSGRLAAPPLPASLPPMRGAIALLILLGICFPLVGGSMLVIWLLDCLLFARRRA
FT                   PRLARVS"
FT   gene            570566..570961
FT                   /locus_tag="AHA_0536"
FT   CDS_pept        570566..570961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38999"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP3"
FT                   /protein_id="ABK38999.1"
FT                   /translation="MKLQPHGHFEMQRRGQVLICRPSGPFNLAGAMAYEAQFSQQIASL
FT                   RDAPWGIVEVATEFEAAGPEVLTRFRRQFGWCASNGCAFLAVVLAGSFKQYLADQVFSG
FT                   LPFQGVRYFEQTDEALQWLERQLAGLV"
FT   gene            complement(571145..571435)
FT                   /locus_tag="AHA_0537"
FT   CDS_pept        complement(571145..571435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36379"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP4"
FT                   /protein_id="ABK36379.1"
FT                   /translation="MTQTTRPEVSCQNCEACCCRLEVMLFTDTGVPDRYVEEREGEVPV
FT                   MHRLEDGWCAALDRNTMMCRIYEVRPLICREFEMGEPDCIDERDKWFIKLN"
FT   gene            complement(571508..572884)
FT                   /locus_tag="AHA_0538"
FT   CDS_pept        complement(571508..572884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0538"
FT                   /product="ATP-independent RNA helicase DbpA"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF03880"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36285"
FT                   /db_xref="GOA:A0KFP5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP5"
FT                   /protein_id="ABK36285.1"
FT                   /translation="MNNEFSSLNLSPALQDNLASLGYLQMTPIQAQSLPLVLDGKDLIA
FT                   KAKTGSGKTAAFGLGLLANLDVNRLEVQALVLCPTRELADQVATEIRRLARTLPNVKLV
FT                   TLCGGTPTAPQSATLSFGAHIAVGTPGRILKHLEQGTLELDGLKTLVLDEADRMLDMGF
FT                   GEDINRVISHAPRDRQTLLFSATYPEGIAQMSRGVQRNPVEVSVESLHEDSAIEQKLYE
FT                   VPAGQRLDALGWLLSHYQPSSCVVFCNTKRACNDVADHLAAKGFSALALNGDLEQRERD
FT                   QVLVRFANGSATILVATDVAARGLDIKELGAVINYELTYDPEVHVHRIGRTGRAGQQGL
FT                   ALSLYQPNEAQRVNFIEEYQQAPIPQGDLAGIGRDIKPIAPQMVTLSIDAGRKSKVRAG
FT                   DILGALTGEGGIAGADVGKIQISEQYSYVAVKRQVASAALKRLQEGKIKGRSYRARKLG
FT                   "
FT   gene            573287..574654
FT                   /locus_tag="AHA_0539"
FT   CDS_pept        573287..574654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0539"
FT                   /product="nucleoside permease NupC"
FT                   /note="identified by match to protein family HMM PF01773;
FT                   match to protein family HMM PF07662; match to protein
FT                   family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37802"
FT                   /db_xref="GOA:A0KFP6"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP6"
FT                   /protein_id="ABK37802.1"
FT                   /translation="MIRCLRERLINLKTFVLSNMHIFTADCDGYLIFKYANVYDGAGQK
FT                   ITNYSGATGMEYVHFVLGLVMVLALALLANRHNWKQIKLRYIGQLLVVELALAWFMLNS
FT                   EVGLAVVGGFAAGFTKLMEFAKQGTDFVFGGLVNEGAFSFFLMVLMPIVFISVLIGILQ
FT                   YIRLLPLVIRGIGTVLAKINGMGKLESFNAISSMIVGQSENFIALKNILPHLNEKQMYT
FT                   LAATAMSTVSMSIVGAYMQLIEPRYVVAALVLNMFSTFIVLSLINPYEPDNTVTDAKAL
FT                   AEGDEHHSPKKENFFEMLGEYIMAGFTVAVIVGAMLVGFIALIALINYLFEMAFGVNFQ
FT                   FVMGYLFYPIAWILGIPSGEALQAGSIMATKLVTNEFVAMMDLGKIAAQLSPRTIGILS
FT                   IFMVSFANFSSIGIIAGAVKALNEEKGNMVSRFGLKLVYGSTLVSLLSAVIAGVML"
FT   gene            complement(574747..575247)
FT                   /locus_tag="AHA_0540"
FT   CDS_pept        complement(574747..575247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0540"
FT                   /product="putative hydrolase"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36162"
FT                   /db_xref="GOA:A0KFP7"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="InterPro:IPR016956"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP7"
FT                   /protein_id="ABK36162.1"
FT                   /translation="MTAQGHLLFSVTCTLLAHKLQLTPALADASLWHTIPAALASALLP
FT                   DLDHPRSVLGQRLPWISKPLSRLFGHRGFTHSLLAVAAAIWGLDQSLAPALLPTGVKDA
FT                   LIIGYLSHLLGDWLTPAGIPLLWPSKRRYRLPGWPLKSGSAVETSFCTLTLLAAGYWAH
FT                   WPG"
FT   gene            complement(575340..575894)
FT                   /locus_tag="AHA_0541"
FT   CDS_pept        complement(575340..575894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0541"
FT                   /product="cytochrome B"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38696"
FT                   /db_xref="GOA:A0KFP8"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP8"
FT                   /protein_id="ABK38696.1"
FT                   /translation="MTTSEVKVWDPLIRVFHWATVTLCLLNFFVLEEGSKPHKYAGYTV
FT                   GILLIIRLLWGLVGPHYARFGQWWPTPARVRYYLRQLAQGSHPYYLGHNPVGALMIWLL
FT                   LLSLVGTVVTGWLTTWDAFWGEDWLEELHGIIANTLMAAVGVHAAVVILTDRLTRSDLV
FT                   RAMVLGKKRVPADAKVEDPRS"
FT   gene            complement(575943..576212)
FT                   /locus_tag="AHA_0542"
FT   CDS_pept        complement(575943..576212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAY38542.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38244"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP9"
FT                   /protein_id="ABK38244.1"
FT                   /translation="MKLTPLLLLIPLLSGAALADPQCTQADKSKWMSEADAQQQIKAMG
FT                   YDIKKFKVTKTNCYEIYGWDKEKRKVEIYFDPTDLKKVKEEIDE"
FT   gene            complement(576334..576786)
FT                   /locus_tag="AHA_0543"
FT   CDS_pept        complement(576334..576786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0543"
FT                   /product="YaiI/YqxD family protein"
FT                   /note="identified by match to protein family HMM PF02639"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39838"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFQ0"
FT                   /protein_id="ABK39838.1"
FT                   /translation="MPIWVDADACPIPVKEILYRAAHRAQVVTTLVANQGLRVPPSPFI
FT                   KTQQVEKGFDVADHVIAQQVKPGDLVITGDIPLASWVIDAGGEALNPRGEIYTRETIKA
FT                   RLGMRNFMEELRSAGVQTGGPAPLNAADKQRFANALDKWLIRGKLS"
FT   gene            576898..577884
FT                   /locus_tag="AHA_0544"
FT   CDS_pept        576898..577884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0544"
FT                   /product="transporter, CorA-like family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39346"
FT                   /db_xref="GOA:A0KFQ1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ1"
FT                   /protein_id="ABK39346.1"
FT                   /translation="MSKKDEQMDRVPSDVIYGLTLDGRGGMQPLVAGSEIPAQQPGWLH
FT                   LDYGNPEAARWLLQTPLLNDAARESLLGQSNRPKLVRMGETVLLILRGINHNKDHRPEE
FT                   MVALRIYITPDLIISSRRRPLLSEQDVFNQLKLGGGADTPADWLVEICDALTDRAGEFV
FT                   EELHDQILDLEEMVLMRDLPANGRLALIRKQLIMIRRYLSPQRDLVARLANEKISWLDE
FT                   DDRRRLLDIADRLRRWLDDLDAGVARTAVLADEINNLMAEATNRRAYQMSVMALLFLPA
FT                   SFLTGLFGINLGGIPGAESPTAFWIFCGSLVALATGLAVWLKHRRWW"
FT   gene            577894..578412
FT                   /locus_tag="AHA_0545"
FT   CDS_pept        577894..578412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36447"
FT                   /db_xref="GOA:A0KFQ2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ2"
FT                   /protein_id="ABK36447.1"
FT                   /translation="MTTWESFGVTLLLLLGHTLVRGLIHKSLLALAQTRQVSENRVLYV
FT                   EHVFHFLLGCATLLILAGVWGLDFSRLVVLASSFFAVLGVAMVAQWSILSNITASITIF
FT                   FAFPYKIGDRIRILDKDDSVTGVITEIGLFYVRVRDDNGDLVTYPANLILQKPVRRLEG
FT                   KGVEPLQPE"
FT   gene            complement(578455..578703)
FT                   /locus_tag="AHA_0546"
FT   CDS_pept        complement(578455..578703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37214"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ3"
FT                   /protein_id="ABK37214.1"
FT                   /translation="MTVSELRQLYQQQAFKEAEILQDAILPGWIVEFRGQDGKLYEMTD
FT                   TLGCPRYFGSVEEARQHVHLVADCPIQVEHLYRFFER"
FT   gene            complement(578767..579342)
FT                   /locus_tag="AHA_0547"
FT   CDS_pept        complement(578767..579342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0547"
FT                   /product="molecular chaperones"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39462"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021059"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ4"
FT                   /protein_id="ABK39462.1"
FT                   /translation="MSETRPNPLLAPLLTLLRQASGSYKVHELLAELRRQEVIPPLPGD
FT                   EQLQLFRLNFLIMNALYHLQAELHGEGWWLVISTLDIRLEPLAIREGASALAQGEALRS
FT                   YYLDWQVFWQTDREEVEALLGSFWRACERDEHRAEALTLFALPTGAQPDAIRRRWRELA
FT                   LQHHPDRGGDADTFIRLRWAWEHLKSAK"
FT   gene            complement(579339..581294)
FT                   /locus_tag="AHA_0548"
FT   CDS_pept        complement(579339..581294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0548"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37889"
FT                   /db_xref="GOA:A0KFQ5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ5"
FT                   /protein_id="ABK37889.1"
FT                   /translation="MAAVSGHTPPLSRGHAPVTPAVARSASPLVPAADWCQSDHLPHYT
FT                   SSRFIALIEVCMIALSLAGIALVSVLAQWLAWSLRVPAILFLLLTGLLLGPVSGLLDPD
FT                   ALLGDLLFPLVSLSVAIILFEGALTLHLAELKGIGKVVRNLCSVGMLASFAVIGSAGYF
FT                   LLGLDWRVAMVLGAVLVVTGPTVVAPMLNVIRPTREVDRILRWEGIVIDPIGALFAVLV
FT                   FEAVRLGSQGDLIGHTLLALAKTVGVGSLIGVGAGWLTTLLIRKDWLPVSLHKFGVLAL
FT                   VLVTFSLSNWLSHESGLLAVTVFGIWLANQEGLDLEEVLAFKEDLAVILISSLFILLAA
FT                   RLDLAQLWQLGPMVLALLCVVQFVARPLCILVSTWGSDLSWRARALLGWIAPRGIVAAA
FT                   VSASFAISLHQAGIPDADKLVPLVFAVIISTVVLQSLTSAPLAGLLKMRQSAPNTWLII
FT                   GANSVARAIGKALADQGVPVQLCDPAWEFCKQARMSNLPCYFGNPQSEHAELHLPLTSI
FT                   STVLALSPNRHNNALGVLHFAHLYGEEKVYSLRSSEQHGKANRESATFRARQNLFGPDI
FT                   NYARLSGLLSRGGQIKATRLSEAFDWTQYQEANPGAIPLFVLDGKGRARIVTGPVEPLA
FT                   GELLIALQPPKETATP"
FT   gene            complement(581303..581824)
FT                   /gene="mtlR"
FT                   /locus_tag="AHA_0549"
FT   CDS_pept        complement(581303..581824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="AHA_0549"
FT                   /product="mannitol operon repressor"
FT                   /note="identified by similarity to SP:P36563; match to
FT                   protein family HMM PF05068"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39006"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ6"
FT                   /protein_id="ABK39006.1"
FT                   /translation="MTTHQEDEVLERLNEQDGPRGFFLEVVTILEEAVDSLMRRAFRQE
FT                   EYAVKYAIEPLLNQSGPLGQLEVRLKLIFALGLISLERYQDLEAYLKIRDFLVRDPKDY
FT                   RFSDKPIRDLLARLHGVSQGGMMPQEAPANEEDWPFYQMQLNRLDQVVRSALVLAVADC
FT                   VTELHKESPI"
FT   gene            complement(581933..583201)
FT                   /locus_tag="AHA_0550"
FT   CDS_pept        complement(581933..583201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0550"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /note="identified by match to protein family HMM PF01232;
FT                   match to protein family HMM PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36112"
FT                   /db_xref="GOA:A0KFQ7"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ7"
FT                   /protein_id="ABK36112.1"
FT                   /translation="MNPASSTGWPAPRIPRSSWICWVPNRLPDRPSSSLVQEVNIMKTL
FT                   HFGAGNIGRGFIGKLLADASHQVTFADVNETLIDQLNHRQEYKVHVVGADQKLDVVRNV
FT                   AAVSSAGHEVIARIITADLVTTAVGPNILDKIASTLAKGLQARFDAGNLTPLNVIACEN
FT                   MVRGTSHLKQEVLKYLPVAYHATLDACIGFVDSAVDRIVPPAAANDDPLEVTVESFSEW
FT                   IVDQTQFKGELPQVAGMEPTDNLMAFVERKLFTLNTGHIVTAYLGKLRGYRTIREAIED
FT                   PLIRSKVRRAMEESGAVLVQRYGFDPRLHAAYIEKILARFANPYLVDEIDRVGRQPLRK
FT                   LAAGDRLVKPLLGTLEYGLPSDHLQEGIAAALHYRNADDPQAVELQQLLAELGPAQALA
FT                   RITGLAADSDIVSAIVTRYGNLK"
FT   gene            complement(583116..585038)
FT                   /locus_tag="AHA_0551"
FT   CDS_pept        complement(583116..585038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0551"
FT                   /product="pts system mannitol-specific eiicba component
FT                   (eiicba-mtl) (eii-mtl)"
FT                   /EC_number="2.7.1.69"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF02302; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00851"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36841"
FT                   /db_xref="GOA:A0KFQ8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ8"
FT                   /protein_id="ABK36841.1"
FT                   /translation="MLSPDTKVKIQNFGRFLSNMVMPNIGAFIAWGFITALFIPTGWLP
FT                   SETLAKLVGPMITYLLPLLIGYTGGKLMGGERGGVVGAITTMGVIVGTDIPMFMGAMMV
FT                   GPLGGWAIKRFDKAMEGRVKSGFEMLVNNFSAGLIGMLLAILAFFVIGPFVKVLSGVLA
FT                   GGVGFLVDNNLLPLTSIFVEPAKILFLNNAINHGIFSPLGIQQATEHGRSIFFLIEANP
FT                   GPGMGVLLAYMVFGRGAAKQSAAGASIIHFFGGIHEIYFPYVLMNPRLILAVIAGGMTG
FT                   VFTLTLFNAGLVSPASPGSIFAVLLMTPKASLIGVLLSIVASTTVSFLVAAVFVRAQQP
FT                   EADEADALGEATRKMKAMKGAKPETAAAKKPGGELMAVRNIVVACDAGMGSSAMGAGLL
FT                   RKRVQAAGLDISVTNRAIDQLDDQVDWVITHKDLTERARRHAPHAHHISLTNFLDNGLY
FT                   QELVQSLTQAVNDDVANPQLLVAANDDSYEPQAAEVFTLSRHDVHLGLKADNKEAAIRA
FT                   AGKLLAERGYVAPDYVNAMLEREQLVSTYLGESIAVPHGTIAAKEFVKRTGIVICQYPA
FT                   GVAFGEEADEVARLVIGIAARNDEHMQVITRLTNALDEPGLIDRLASTQDPQEFLDLLG
FT                   AEQAA"
FT   gene            complement(585493..586539)
FT                   /locus_tag="AHA_0552"
FT   CDS_pept        complement(585493..586539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0552"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37478"
FT                   /db_xref="GOA:A0KFQ9"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ9"
FT                   /protein_id="ABK37478.1"
FT                   /translation="MTTPHNRLEGLDLARAMALIGMVLVNFRIAMGVLAGGPTWLKPLL
FT                   DALEGRSAASFVVLAGIGLGLSTRKLAWSAAMSHTARRALFLLIVGLLNYLVFPADIIH
FT                   YYAVYFLLGACCLRLPSPWLLALIPLLAASFVGLLFLLDYDRGWQWHSFSYPEFWTLAG
FT                   FIRNLLFNGWHPVVPWLGFLLYGLWLSRQSLANPVTQRWLLAGGVSAMALAKGLSLWLP
FT                   TLLPAPELAPLLATQPIPPAPLYLLFGMGAASTLIALCLWLGRALPEARWWRVWLPVGR
FT                   QTLTLYLAHIMFGMGVLEAIGWLQGQDLPEVVLAASLFALAALLFANLWSLRFERGPLE
FT                   WLMRRLCG"
FT   gene            complement(586561..587286)
FT                   /locus_tag="AHA_0553"
FT   CDS_pept        complement(586561..587286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0553"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37931"
FT                   /db_xref="GOA:A0KFR0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR0"
FT                   /protein_id="ABK37931.1"
FT                   /translation="MPPAESGDHFLYAPSLPVARYGHRVNPQMNERSLMLSFQARGIPM
FT                   TTNNLRLEQRREQIIQAALGCFIERGFHQTGMRDIAAAAGVSLGNLYNHFARKEELIAL
FT                   IASLEAAELQPLLDELVQGPARAALARFAAGYLAWSLTPENLLLGTEILAELTRHPEMA
FT                   ATFASNQRQLCDTLAAAVRRGQQAGELAAHLQPDLTAQLLLDALEGQAVRHALALHPEQ
FT                   APVEQRLPSLLDQLLGPAR"
FT   gene            complement(587343..589364)
FT                   /gene="rnb"
FT                   /locus_tag="AHA_0554"
FT   CDS_pept        complement(587343..589364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnb"
FT                   /locus_tag="AHA_0554"
FT                   /product="exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /note="identified by match to protein family HMM PF00773;
FT                   match to protein family HMM PF08206; match to protein
FT                   family HMM TIGR00358; match to protein family HMM
FT                   TIGR02062"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38105"
FT                   /db_xref="GOA:A0KFR1"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011804"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFR1"
FT                   /protein_id="ABK38105.1"
FT                   /translation="MFQDNPLLAQLKQQIRENIPKKEGVIRASDRGFGFLEVDEKTSYF
FT                   VPPPYMKKVMHGDRVSALIRTEKEKEVAEPDALLEQSVTRFVARVKMFRDRLNVVADHP
FT                   LIKDAIKARVKKGLDEKEFKEGDWVVATLKRHALVDGNFSAEITQTIASQEDHNVPWWV
FT                   VLARHNLAQVEPADLPEWKVIEEEELPRTDLTATPFFTIDGAKTKDMDDALAIRKLDNG
FT                   WELLVAIADPTAYVAEGSELDKEAAQRAFTVYMPGRNVPMIPRTLSDELCSLKEGEERN
FT                   TLCARLLIAEDGLLLEETEFFAARISSHARLTYDDVSDWAEHGKQLDIDAGVLAQLPLM
FT                   KAMTEARIAWRTEHALVFPDRPDYDFELGENGEVLAIHVEPRRIANRMVEESMIAANIC
FT                   AGRVLGKQVGYGIFNVHTGFDEESLDGAIDLLKSAEAPFEKEEIASLSGFCALRRWIDN
FT                   LDTRWLDGKIRRFQSYALMSAEPGAHYGLGLDAYATWTSPIRKYGDMVNHRLLKAVIAG
FT                   KTPGERPSLELTEHLTACRRLHRMVERDIGDWLYVRYLKADAGTDKVFNAEIIDVMRAG
FT                   LKLRLRENGAVVFMPARHILDNKDRLECNWDNGRVYLDKTEVVYELGQIIEVKLTEAVE
FT                   ETRSLIAKPAVELVPGPAPVAPTSEADATPADEAPKAE"
FT   gene            complement(589465..590364)
FT                   /locus_tag="AHA_0555"
FT   CDS_pept        complement(589465..590364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0555"
FT                   /product="chromosome initiation inhibitor"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36191"
FT                   /db_xref="GOA:A0KFR2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR2"
FT                   /protein_id="ABK36191.1"
FT                   /translation="MKALDYKLLLALDAVMQEQNFERAAQRLHITQSAISQRIKQLEQQ
FT                   FAEPLLIRGQPLQATALGQKLLAHYRQVRQLELELAGELSPAEPQAPIRVSIAVNADSL
FT                   ATWFLPALAPLLEQHPIELNLLVDDESRTLDRVREGQAFGAVSLHGQPLAGCCVDELGE
FT                   MRYLLTASPAFVARHFPQGLTLAALAKAPAVAFDQRDDMHVSYMARHFGLEPGGYPCHT
FT                   VRSSEAFVAMAEQGLACCLIPELQIRRQLAEGSLLDLSPDQHLVERLYWHRWVLERGLH
FT                   KQISQRLIEQGRRALQPG"
FT   gene            complement(590632..591255)
FT                   /locus_tag="AHA_0556"
FT   CDS_pept        complement(590632..591255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0556"
FT                   /product="autoinducer synthesis protein AhyI"
FT                   /note="identified by match to protein family HMM PF00765"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38974"
FT                   /db_xref="GOA:A0KFR3"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR3"
FT                   /protein_id="ABK38974.1"
FT                   /translation="MLVFKGKLKEHPRWEVENELYRFRNRVFSDRLGWDVESHRGLEQD
FT                   SFDTPDTHWVLIEDEEGLCGCIRLLSCAQDYMLPSIFPTALAGEAPPRSNDVWELTRLA
FT                   IDAERAPRLGNGISELTCIIFREVYAFAKAQGIRELVAVVSLPVERIFRRLGLPIERLG
FT                   HRQAVDLGAVRGVGIRFHLDERFARAVGQPLQGAYDEARELVTE"
FT   gene            591318..592103
FT                   /gene="ahyR"
FT                   /locus_tag="AHA_0557"
FT   CDS_pept        591318..592103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahyR"
FT                   /locus_tag="AHA_0557"
FT                   /product="transcriptional activator protein AhyR"
FT                   /note="identified by similarity to SP:P0A3J6; match to
FT                   protein family HMM PF00196; match to protein family HMM
FT                   PF03472; match to protein family HMM PF04967"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37236"
FT                   /db_xref="GOA:A0KFR4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR4"
FT                   /protein_id="ABK37236.1"
FT                   /translation="MKQDQLLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIP
FT                   MSMQRPKVVLFNQCPDSWVQAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEG
FT                   SLDVMGLAAEFGLRNGISFPLHGAAGENGIILSFITAERASSDLLLESSPILSWMSNYI
FT                   FEAAIRIVRVSLREDDPQEALTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQV
FT                   TRKTGSMNRYQAIAKGVSSGILLPNLEQVVVTNFPKLMQ"
FT   gene            592316..592936
FT                   /locus_tag="AHA_0558"
FT   CDS_pept        592316..592936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0558"
FT                   /product="arginine exporter protein ArgO"
FT                   /note="identified by match to protein family HMM PF01810;
FT                   match to protein family HMM TIGR00948"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37692"
FT                   /db_xref="GOA:A0KFR5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR5"
FT                   /protein_id="ABK37692.1"
FT                   /translation="MFATTLQGFTLGLAMIIPIGAQNAFVLSRGIHRNHHLLTATLCCL
FT                   CDLVLIGIGVFGGANLLAASPIGLALLTWGGVLFLGWFGIRSLRSAWRGQGAKLADSPQ
FT                   LMGVKSVLAMTLGVTLLNPHVYLDTLMLLGSFGSQFAEELRPAFAAGAMLASLVWFYSL
FT                   AFGAAALSPWLARGRVQQAIDTIVGFIMLGLALQLASGALLAS"
FT   gene            593051..595042
FT                   /locus_tag="AHA_0559"
FT   CDS_pept        593051..595042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0559"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /EC_number="3.1.4.16"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38083"
FT                   /db_xref="GOA:A0KFR6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR6"
FT                   /protein_id="ABK38083.1"
FT                   /translation="MNKTMKLGAIAAIVLLSACSNENDSKAQPGEVALRLIQTSDIHSN
FT                   VLGYDYYQNKEDRKFGLSRTALLIRAARAENPNNLLLDNGDLIQGTPLADYIFEQSGAG
FT                   YLDKQAHPVFKAMNELGYDAGNLGNHEFNYGLDYLTKTLQGAKFPYVNANVFEAGAFKR
FT                   DAKGQIDWSGNKFTPYLLLERKVKDDKGQLQTVKVGILGLTPPQVLQWDKRHLEGKVVV
FT                   ADMVETANHYVPELRAKGADIVVVVAHTGINASSYEAMMENSAWHLAKVKGVDALMLGH
FT                   AHKNFPGDFPDLPEVDNKAGTLSGIPTVMPGYWGNHLGIIDLKLEQVDGKWQVKQSQAS
FT                   LRKIDSSEGSAVDQRVVDLVQADHDATNQWLDEPLGKITSSIHSFFALVQDDPSVQLVS
FT                   DAQRKHAEQLQKDGLLKESYPILSVAAPFRGGRNGINDFTYVAQGDISLRNVSDLYIYP
FT                   NTLQVVEVNGATVKEWLEMSAGQFNQIDTGKTEVQWLVNEKFPTYNFDVIDGVNYEVDI
FT                   TQPARYNKEGAKVSDGQRISSLTFNGQPIDPTQKFYVVTNNYRASGGGHFPGIDGSNIV
FT                   HEDPFETREIIAQYLKAQSADNPAGFSPAANNNWHMKALPANVDVRLYSSPREEAKQLA
FT                   GADLEYKSTLPMDDAQHPGYAIFRLIRQ"
FT   gene            complement(595108..595584)
FT                   /locus_tag="AHA_0560"
FT   CDS_pept        complement(595108..595584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0560"
FT                   /product="surface antigen family protein"
FT                   /note="identified by match to protein family HMM PF05433"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38520"
FT                   /db_xref="GOA:A0KFR7"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR7"
FT                   /protein_id="ABK38520.1"
FT                   /translation="MLKRITLIALLATTTATTLSGCANSDVYSGDVYTKDRAKQVQTVS
FT                   YGTILSTRPVKIQADENSLIGTIGGAVVGGLLGSTIGGGRGSDIAAAGGAIAGAAAGKA
FT                   AGDKLNQVDGVELEIKKENGESIVVVQKASPTFVPGARVRMTQGNGTINVAVVN"
FT   gene            complement(595722..596174)
FT                   /locus_tag="AHA_0561"
FT   CDS_pept        complement(595722..596174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0561"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36774"
FT                   /db_xref="GOA:A0KFR8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR8"
FT                   /protein_id="ABK36774.1"
FT                   /translation="MHQPPVLRVARHTDMHAIWQIDVNVFGEDVYPGFFFRQAMDLWPE
FT                   LLLVAELDGKLLGYALGGLGQDRSQGWLLSLAVLPEARGFGLAERMMLQVEQSLLTLGI
FT                   ERVRLTVDPANPAQRLYFRLGYQQLAEERDYFGPGEDRLLLEKRLG"
FT   gene            complement(596295..596750)
FT                   /locus_tag="AHA_0562"
FT   CDS_pept        complement(596295..596750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39403"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR9"
FT                   /protein_id="ABK39403.1"
FT                   /translation="MPAGLTCIKTPSPQVRTMPCMTTHHSHPARPARADKAPVHPRLKR
FT                   EQQTVSAMIRLYCDHHHQDPVCRHCQQLQEFAHQRLRRCRYGHGHKPTCANCHIHCYAP
FT                   AMRKQIQLVMKWSGPRMLWHHPWLALRHLLDSRRKAPKRPGSRPLPP"
FT   gene            complement(596803..598605)
FT                   /locus_tag="AHA_0563"
FT   CDS_pept        complement(596803..598605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0563"
FT                   /product="aminopeptidase P"
FT                   /note="identified by match to protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37723"
FT                   /db_xref="GOA:A0KFS0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS0"
FT                   /protein_id="ABK37723.1"
FT                   /translation="MNHFEIIETRVAQVRAELAMMELDAFIVPHDDEHLGEYIPAYAER
FT                   LDWITGFNGSAGLAIILAQRAALFIDGRYTVQARMQAPAELFEFLHLVEDPHVQWLADQ
FT                   LPSGSRVGFDARLHSLAWYHNAKAVLTERGIELVRVEQNPIDLHWSDRPAPTKNPAILY
FT                   SEALAGQSSQAKREMLASDLRKRGLDAVLLTQAEPINWLLNLRGRDVERLPVVLGFAVL
FT                   YANATMDFFVDTDKIDCFAFSQHVGQDVSVYPIDKLGDVLQRIGEDQQKVLADPNTANA
FT                   WTQLVMEEAGAILVAGQDPTMLPKACKNEVELAGMRAAHLRDGVAVTRFLAWLDRLIAS
FT                   GEFDGVDEGTLADQLEAFRREQEHYVEPSFDTISALGPNAAMCHYRHTNGTPRTFGQDS
FT                   IYLVDSGAQYLDGTTDITRTLKVGELTDEHKAMFTRVLQGHIALDQARFPRGTAGIQLD
FT                   VLARQPLWQAGYNYDHGTGHGVGHFLSVHEGPQRIAPKGSLVALQPGMVLSNEPGYYRE
FT                   DAFGIRCENLVVVTEQEQIGELPMLGFERLTYVPFDTRLIDRSLLSPAEFRWINEYHAE
FT                   VYRRLSPLLEGEDLAWLEQATSLI"
FT   gene            complement(598639..599304)
FT                   /locus_tag="AHA_0564"
FT   CDS_pept        complement(598639..599304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0564"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37245"
FT                   /db_xref="GOA:A0KFS1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS1"
FT                   /protein_id="ABK37245.1"
FT                   /translation="MTPPYKTRTQMVMENLRGRILRGEFPAGAPLRQDAIAKELAVSRI
FT                   PVREALMQLEAQGLVKFEAHRGAVVTMLDAAAIEELFYLRALLEADTLFHAVDLMTEET
FT                   FARAQAILAQFDQALESGTQIERWAELNHSFHATLYQAAGRPQALELIAQINLSCDRYV
FT                   RFELLFASDGVDKAEREHAQLLELCRARRKHEAVVLLKQHIEAAGQSIKRILDSGHNH"
FT   gene            complement(599480..601105)
FT                   /gene="pckA"
FT                   /locus_tag="AHA_0565"
FT   CDS_pept        complement(599480..601105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="AHA_0565"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="identified by match to protein family HMM PF01293;
FT                   match to protein family HMM TIGR00224"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38879"
FT                   /db_xref="GOA:A0KFS2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS2"
FT                   /protein_id="ABK38879.1"
FT                   /translation="MTIVAEPTLAKQLGLDQYGIKNSTEILRNPSYDQLFAEETRADLE
FT                   GFERGVVTELGAVNVNTGIFTGRSPKDKYIVKDATTQNTVWWSDQGKNDNKAISPEVWS
FT                   HLKSLVTKQLSGKRLFVVDGFCGANPDTRLAVRIITEVAWQAHFVKNMFIRPSDEELKT
FT                   FKPDFVVMNGAKCTNPNWKEQGLNSENFVAFNLTEKIQLIGGTWYGGEMKKGMFSMMNY
FT                   FLPLRGIASMHCSANVGQDGDVAIFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFN
FT                   FEGGCYAKTIKLSKEAEPDIYNAIRRDALLENVTVAADGTIDFDDGSKTENTRVSYPIY
FT                   HIENIVKPVSKAGHANKVIFLTADAFGVLPPVSKLTKEQTKYHFLSGFTAKLAGTERGI
FT                   TEPTPTFSSCFGAAFLSLHPTKYGQELVKRMEAAGAEAYLVNTGWNGTGKRISIKDTRA
FT                   IIDAILDGSIEKAETKVLPIFNLEVPTALHDVNPAILDPRDTYANKAEWDAKAVDLAGR
FT                   FIKNFERFTDNEEGKRLVAAGPQL"
FT   gene            complement(601255..602142)
FT                   /gene="hslO"
FT                   /locus_tag="AHA_0566"
FT   CDS_pept        complement(601255..602142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="AHA_0566"
FT                   /product="33 kDa chaperonin HslO"
FT                   /note="identified by similarity to SP:P0A6Y5; match to
FT                   protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39863"
FT                   /db_xref="GOA:A0KFS3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS3"
FT                   /protein_id="ABK39863.1"
FT                   /translation="MMSNQDLLYRYLFEEYEVRGELVQLDHTYRHVVEAQNYPVQVQKL
FT                   LGELLVATSLLTATLKFEGSITVQLQGNGPVRLAVINGDNNQQLRGVARYEGELPSDDK
FT                   LQSLIGEGQLVITITPEQGERYQGIIALDADTLAGCLEHYFAQSEQLATKLWIRTGYHQ
FT                   GEPRAAGILLQELPAQSEDHSDDFEHLTQLTSTIKDEELFGLEAEEILYRLYHQDKVRV
FT                   FDPQAVEFRCTCSRARCEGALLQIEKEEVMEMVQELGKIDMHCDYCGAQYQFDGIDVET
FT                   LFSRAPGNDANKLH"
FT   gene            complement(602248..602838)
FT                   /locus_tag="AHA_0567"
FT   CDS_pept        complement(602248..602838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0567"
FT                   /product="heat shock protein 15"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35955"
FT                   /db_xref="GOA:A0KFS4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS4"
FT                   /protein_id="ABK35955.1"
FT                   /translation="MFINIFWHPNRLAIVYGNGPRDNRPDGMKLRKLTFRHTISPPVSI
FT                   PGPASGIIRHPFQPFRSRFMPNPAETPALVRLDKWLWAARFYKTRSLARDQIEGGKVHY
FT                   NGQRSKPGKHVEVGALIRFWQGQDEREVRVLEVSEQRKSAPLAQQLYEETEASLKKRAE
FT                   NSEARRFNSQFAPSPERRPDKQERRQLIKVKQY"
FT   gene            602786..603709
FT                   /gene="gspC"
FT                   /locus_tag="AHA_0568"
FT   CDS_pept        602786..603709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="AHA_0568"
FT                   /product="general secretion pathway protein C"
FT                   /note="identified by similarity to GB:AAA58784.1; match to
FT                   protein family HMM TIGR01713"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36389"
FT                   /db_xref="GOA:A0KFS5"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS5"
FT                   /protein_id="ABK36389.1"
FT                   /translation="MPYTIANRFGCQKILINMTLPFRDDLLSSLLARCKTVPLSRFSQP
FT                   LFWLLLLLLAHQCAGLTWRLLDLGSRPVSQSWQPSVVANQSQGANRLDLSGVSRLALFG
FT                   KAKQQAQAADVVAADAPKTQLNAQLNGVLASSDPAKSIAIIAHNGLQNSYGIGDLIDGT
FT                   QAKIRQVFPDRVIIERDGRDETLMLDGEEYGKPLPKPGNQDGKLSSVRNELMGNPGKIT
FT                   DYLNISPVRVDGRMVGYRLNPGSNPELFNQLGLVANDMAVSINGLDLRDNAQAMQAMQQ
FT                   VAGATEMTVTVERQGQLYDVYVGLSE"
FT   gene            603731..605764
FT                   /gene="gspD"
FT                   /locus_tag="AHA_0569"
FT   CDS_pept        603731..605764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="AHA_0569"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by similarity to SP:P45758; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38515"
FT                   /db_xref="GOA:A0KFS6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS6"
FT                   /protein_id="ABK38515.1"
FT                   /translation="MINKGKGWRLATVAAALMMAGSAWATEYSASFKNADIEEFINTVG
FT                   KNLNKTIIIEPSVRGKINVRSYDLLNEDQYYQFFLSVLDVYGFAVVPMDNGVLKVVRSK
FT                   DAKTSAIPVVDESNPGSGDEMVTRVVPVRNVSVRELAPLLRQLNDNAGGGNVVHYDPSN
FT                   VLLITGRAAVVNRLVEVVRRVDKAGDQEVDIVKLKYASAGEMVRLVTNLNKDGNNQGGN
FT                   TSLLLAPKVVADERTNSVVVSGEPKARARIIQMVHQLDRDLQSQGNTRVFYLKYGKAKD
FT                   LVEVLKGVSSSIEADKKGGAATTTGGGGASIGGGKLAISADETTNALVITAQPDVMAEL
FT                   EQVVAKLDIRRAQVLVEAIIVEIADGDGLNLGVQWANTNGGGTQFTDTNLPIGSVAIAA
FT                   KDYQKNGTTTGLAALAKDFNGMAAGFYKGNWAALVTALSTNTKNDILSTPSIVTMDNKE
FT                   ASFNVGQEVPVQSGSQSSTTSDQVFNTIERKTVGTKLVVTPQINEGDSVLLNIEQEVSS
FT                   VAQTQAPGTSTLGPTFDTRTIKNAVLVKSGETVVLGGLMDEKTQEKVSKVPLLGDIPVL
FT                   GYLFRSTSNSTSKRNLMVFIRPTILRDADVYSGISSNKYSQFRSEQQEAAAQEGYLTSP
FT                   KRQVLPQYGQGVTMSPEVQKQLQQTQQAPQASGGSQPFVGNK"
FT   gene            605764..607269
FT                   /gene="gspE"
FT                   /locus_tag="AHA_0570"
FT   CDS_pept        605764..607269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="AHA_0570"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by similarity to SP:P31741; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37044"
FT                   /db_xref="GOA:A0KFS7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS7"
FT                   /protein_id="ABK37044.1"
FT                   /translation="MAAYQLDGVDMPAALPELPFAFARNFGVILTERQGAPVLLCRQGV
FT                   TPQTLLEVRRVAGCAFTVEQMDREAFEELLMAHYQRDSSEARQLMEDLGNEMDFFALAE
FT                   ELPQSEDLLDADDDAPIIRLINAMLSEAIKEEASDIHIETFERALVIRFRIDGVLREIL
FT                   RPHRKLASLLVSRIKVMSRMDIAEKRVPQDGRISLRIGGRAVDVRVSTMPSSYGERVVL
FT                   RLLDKNNVRLELKQLGMTLANRNIISELIRKPHGIILVTGPTGSGKSTTLYAALSEINS
FT                   RDRNILTVEDPIEYDLEGVGQTQVNSKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQ
FT                   IAVQASLTGHLVMSTLHTNTAIGAITRMRDMGIEPFLLSSSLLAVLAQRLVRTLCPDCR
FT                   APRAITEQERIAMGIELAPDQQVWRPVGCEQCNHTGYRGRTGIHELVVIDEAVREAIHS
FT                   ASGELAIERLIRGHTPSIRRDGIDKVLKGQTSLEEVLRVTRED"
FT   gene            607271..608491
FT                   /gene="gspF"
FT                   /locus_tag="AHA_0571"
FT   CDS_pept        607271..608491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="AHA_0571"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   match to protein family HMM TIGR02120"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38224"
FT                   /db_xref="GOA:A0KFS8"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS8"
FT                   /protein_id="ABK38224.1"
FT                   /translation="MAAFEYKALDGKGRNKSGVLEGDSARQVRQLLREQGLTPLEVNET
FT                   TEKAKREANRFVLFRRGASTAELAMITRQLATLVGAGLTIEEALKAVAEQCEKAHLRSM
FT                   VATVRSKVVEGYSLADSLAAFPHVFDQLFRSMVAAGEKSGHLEKVLNRLADYTEQRQHM
FT                   RTKLLQAMIYPIVLTCVAIGVISILLTAVVPKVVAQFEHMGQQLPATTRFLIGTSELMQ
FT                   HYGLWFLLLLLVGGFVWRWWLTDDKRRRHWHQLILRLPVIGRVSRGLNTARFARTLSIL
FT                   NASAVPLLEGMKISGEVLSNDFARMRIGEATERVREGTSLRKSLDETKIFPPMMLHMIA
FT                   SGEQSGELDNMLERAADNQDREFETQVNIALGVFEPMLVVSMAGVVLFIVMSILQPILE
FT                   LNNMVNL"
FT   gene            608607..609038
FT                   /gene="gspG"
FT                   /locus_tag="AHA_0572"
FT   CDS_pept        608607..609038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="AHA_0572"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by similarity to SP:P31733; match to
FT                   protein family HMM PF07963; match to protein family HMM
FT                   TIGR01710; match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38698"
FT                   /db_xref="GOA:A0KFS9"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS9"
FT                   /protein_id="ABK38698.1"
FT                   /translation="MQKRRQSGFTLLEVMVVIVILGILASLVVPNLMGNKEKADQQKAV
FT                   SDIVALENALDMYKLDNNRYPTTEQGLDALVNKPTAAPEPRSYREGGYIKRLPQDPWGN
FT                   PYQMLSPGQFGKIDIFSMGLDGEAGTDDDIGNWNLKDFQ"
FT   gene            609202..609753
FT                   /gene="gspH"
FT                   /locus_tag="AHA_0573"
FT   CDS_pept        609202..609753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="AHA_0573"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by similarity to SP:P31735; match to
FT                   protein family HMM TIGR01708; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38394"
FT                   /db_xref="GOA:A0KFT0"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT0"
FT                   /protein_id="ABK38394.1"
FT                   /translation="MKHSRQAGFTLLEVLLVAMLMGLVATAVTLSMGGARGDRELDKQA
FT                   RRFMAVLQQAQEYSVMDGRLVGLRVEDNSWQFMQRAAKDRKWQVMSGDKLLDRVELPDN
FT                   MRLAIELEGFSWRTESDEKYEKGRDEKERTPQVFIFPGGELTPFVLTLTQQDDDLRYVR
FT                   TVKADEFGRLRLLQDEEEEE"
FT   gene            609750..610109
FT                   /gene="gspI"
FT                   /locus_tag="AHA_0574"
FT   CDS_pept        609750..610109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="AHA_0574"
FT                   /product="general secretion pathway protein I"
FT                   /note="identified by similarity to SP:P31737; match to
FT                   protein family HMM PF02501; match to protein family HMM
FT                   PF07963; match to protein family HMM TIGR01707; match to
FT                   protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38055"
FT                   /db_xref="GOA:A0KFT1"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT1"
FT                   /protein_id="ABK38055.1"
FT                   /translation="MNARGMTLLEVMVALAVFAIAGLAVMKTASEHLSGLNYLEQKTLA
FT                   TWVVENQLVQQKLEAKWPGDSWVEGDEQMAGQTWYWRYRGVATADSNFKALDMEVRTTP
FT                   KADSPVAMIRTYISR"
FT   gene            610178..610807
FT                   /gene="gspJ"
FT                   /locus_tag="AHA_0575"
FT   CDS_pept        610178..610807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="AHA_0575"
FT                   /product="general secretion pathway protein J"
FT                   /note="identified by similarity to SP:P31739; match to
FT                   protein family HMM PF07963; match to protein family HMM
FT                   TIGR01711; match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39529"
FT                   /db_xref="GOA:A0KFT2"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT2"
FT                   /protein_id="ABK39529.1"
FT                   /translation="MIRSQRQAGFTLLEMLVAIAIFAGLSLGAYQVLQGVLTSDEVAKR
FT                   KEARLSELQLAFSVLERDITQMVPRSGRIDGENNKVLLAASRFGQQSDDWGMAFMRGGW
FT                   LNPDGMLPRSGLQRVGWRLKDHKLERLSYLYPDPVIGTEPRIQPMLERVTALRLYFYDK
FT                   GAWKEEWTQRNVLPYGLAVELDLEDYGTIRRQFLIGAGGQRAENGN"
FT   gene            610897..611922
FT                   /gene="gspK"
FT                   /locus_tag="AHA_0576"
FT   CDS_pept        610897..611922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="AHA_0576"
FT                   /product="general secretion pathway protein K"
FT                   /note="identified by similarity to SP:P31760; match to
FT                   protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39209"
FT                   /db_xref="GOA:A0KFT3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT3"
FT                   /protein_id="ABK39209.1"
FT                   /translation="MAIKRGRGRSRTTPGRQGGMALLVVLLILSVMVIIASNMSGRLQL
FT                   ELRRTANLTAGKQAWWYAMSAEALVSKVLAQDFKDDPNVVSLGQNWARQDAVFPVDDGK
FT                   LTGRVRDLQSCFNLNSLSVPLKDGISGDDLEKQPYPVKVFKALLKQLEVEDYEAVQLTD
FT                   AIRDWTDKDTVLVSSYGAEDAYYEGLTPPYLTANQWMLGTDELRAVRGVSAKLYARLAP
FT                   YVCALPNDKLVVNVNTIRPEQSALLVALYLDKVGLDDAKRVLTSRPQKGWKNKKEMTDQ
FT                   MPVQVGNIQGLDAALDVKSSYFEARLIAEVGDTRARLESVFVRGKDNKLVMLRRLNGGA
FT                   E"
FT   gene            612042..613226
FT                   /gene="gspL"
FT                   /locus_tag="AHA_0577"
FT   CDS_pept        612042..613226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="AHA_0577"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by match to protein family HMM PF05134;
FT                   match to protein family HMM TIGR01709"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37063"
FT                   /db_xref="GOA:A0KFT4"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT4"
FT                   /protein_id="ABK37063.1"
FT                   /translation="MSESLVIRLGTNAQQPVEWLVWSGGEEEVIASGTLASAHALGELQ
FT                   ERAGGRPAVVLVPGSDLIFRRVSLPGKYSRQSAAALPYLLEEQIASDVDELHLVVLGHQ
FT                   GHEVDLMAVDKEKMQTWLGWLEQAGLKSRQLLPDVLALPQASEGWSALQLGKEWLLRQG
FT                   PCQGIVADEPLLAMLLAAEPAPVTIHSHTPPPAIAAASWQAADPELPMLLLARGALASQ
FT                   ANLLQGPYRPQTEYSRYWQQWRKVAVVAGALLVVAFAQRGVQLYQLAEQDKALKAEIRQ
FT                   VYTRIFPGESRIVNVRSQMTQHLQQLGQTPQDGVLMVLTELAPTFAEVPGLKPEVLRFD
FT                   AARGELRLQVTAPGFAEIERFRELAGKRFDVQQGEVRSTEGKVEGALVLKGKSS"
FT   gene            613223..613714
FT                   /gene="gspM"
FT                   /locus_tag="AHA_0578"
FT   CDS_pept        613223..613714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="AHA_0578"
FT                   /product="general secretion pathway protein M"
FT                   /note="identified by similarity to SP:P41850; match to
FT                   protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37544"
FT                   /db_xref="GOA:A0KFT5"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT5"
FT                   /protein_id="ABK37544.1"
FT                   /translation="MMDKLQGWWRGISAREQRLVAVGGSVLLIGFCYWVIWQPIGNRID
FT                   ERERQVLSQQQTLAWLKEKGEEVLALQGGQGHQLDTSGTLEGVVNRTAFNQKIKIARLQ
FT                   PQGQELQVWIDTVAFDDLLIWLATLADRHGVQVQVIEVARENLAPGLVKVRRLQLSRPQ
FT                   "
FT   gene            613776..614531
FT                   /gene="gspN"
FT                   /locus_tag="AHA_0579"
FT   CDS_pept        613776..614531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="AHA_0579"
FT                   /product="bacterial type II secretion system protein N"
FT                   /note="identified by match to protein family HMM PF01203"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35923"
FT                   /db_xref="GOA:A0KFT6"
FT                   /db_xref="InterPro:IPR000645"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT6"
FT                   /protein_id="ABK35923.1"
FT                   /translation="MKQRVLIAVLFLAAYLVFLLAKLPASLVVRYLPLPPLVQLEGVSG
FT                   TLWSGQVARLQYASESLTQLRWELNGWSLLRFAPEVSLRFGERSGLNGQGVVGWSGAAF
FT                   GRDITLNVPAPWLLARVPMQLPVPVTVAGQLQLKLDQVAQGNPWCDNLYGNLYWYGADA
FT                   DTPAGKLVLGDPEIKLTCIDSRLVAELKQGSEAVQVQGKLELQANRQYLFQGTLKPGPD
FT                   LPEQMKQGLPFLGQPDGQGRFPLRYQGRI"
FT   gene            complement(614592..615503)
FT                   /locus_tag="AHA_0580"
FT   CDS_pept        complement(614592..615503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0580"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36367"
FT                   /db_xref="GOA:A0KFT7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT7"
FT                   /protein_id="ABK36367.1"
FT                   /translation="MSPRGQFCHSRASIRLSCDHRGEPARHPEAIAMNQTLATDALTRS
FT                   MTEVVDALHGSAFPAALVRLIQQQVAFDCALLLGVGQRPVYLYDNLHHQRALLFDRYLT
FT                   RHFSQDPFMQALEQGLPAGVWTLAQVSRGRLDPEYRHHFYQATGWQEEVGLILPVRGGL
FT                   TLMLFLGRLDKRSSLSRDELARLEALFPLVHSLCRQHWREEAALLAQSPMLPGGADLKA
FT                   TVEQAIASVGGASLTRRERQVAGLLLQGLDTEAIAGTLGIGSGTVKNHRKHLYAKLHLR
FT                   SRAELFRFFLNHLITAPAGTPP"
FT   gene            615563..616831
FT                   /gene="tyrS-1"
FT                   /locus_tag="AHA_0581"
FT   CDS_pept        615563..616831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS-1"
FT                   /locus_tag="AHA_0581"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39461"
FT                   /db_xref="GOA:A0KFT8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFT8"
FT                   /protein_id="ABK39461.1"
FT                   /translation="MINPHLLDELTRRGLVAQNSDPVALADHLATPRTVYCGFDPTAGS
FT                   LHIGHLVPLLMLRRFQLAGHTPVALVGGATGLIGDPSFKATERNLNSSETVQGWVASLS
FT                   AQIKALLPASEGLAAPLLVNNADWMGQMSALDFLRDIGKHFSVNAMLVRESVRQRLARP
FT                   DQGISFTEFSYALLQSQDYAVLNQRLGCTLQIGGNDQWGNITSGMDLTRRLHQAQVYGM
FT                   TLPLITKADGTKFGKTEGGAIWLDPALTSPYAFYQFWLGTADEDVYRFLRYYSFMPLTE
FT                   IEALEAEDAKRQGRKLAQQVLADELTELVHGKGALAAAQRISELLFSGEVARLGESDLA
FT                   QLAQDGMPGWRIEGETDLVTLLVESGLANSKRIARELLAAGAISLNGEIRREEPLRAAD
FT                   RLFGRHLLLRRGKKQYRLVTWQG"
FT   gene            complement(616925..617593)
FT                   /locus_tag="AHA_0582"
FT   CDS_pept        complement(616925..617593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0582"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39071"
FT                   /db_xref="GOA:A0KFT9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT9"
FT                   /protein_id="ABK39071.1"
FT                   /translation="MPTPLPWHQIDTVLLDMDGTLIDLHFDNHLWQQLVPERYAERLGL
FT                   PLAEARVQIEAHYQAVSGTLNWYCVDYWSETLGLDIRALKQESLAKIQWRPHVIPFLAA
FT                   LRAAGKQLVLFTNAHPASLSVKDAQLGLAGHLDLMVSTHELGWSKESQHCWQALAERLA
FT                   FDPARTLFVDDSERILRAAADYGIGYQLAIQNPDSCQPEQHITAFPAIRDYAELLPLAE
FT                   "
FT   gene            617780..618340
FT                   /locus_tag="AHA_0583"
FT   CDS_pept        617780..618340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0583"
FT                   /product="ADP compounds hydrolase NudE"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39771"
FT                   /db_xref="GOA:A0KFU0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU0"
FT                   /protein_id="ABK39771.1"
FT                   /translation="MAHDKSKPEILKAEIVAESRLFKVESLHLKFSNGEERVYERMRGG
FT                   SRGAVMVVPLFDAHTLLLVREYAAGTHSYELGFPKGLIDPGEDAFEAGNRELMEEAGFG
FT                   ANSLTLLKQVSLAPGYFSSRMDILLARDLFPEQRVGDEPEPLEVIPWPLNRIDELLARP
FT                   DFTESRSISALLLAQRWLAEQAE"
FT   gene            618378..619190
FT                   /gene="cysQ-1"
FT                   /locus_tag="AHA_0584"
FT   CDS_pept        618378..619190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ-1"
FT                   /locus_tag="AHA_0584"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by match to protein family HMM PF00459;
FT                   match to protein family HMM TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35844"
FT                   /db_xref="GOA:A0KFU1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU1"
FT                   /protein_id="ABK35844.1"
FT                   /translation="MQELLAWVPGVKEIAREAGRILHEIYHGGQFERQLKEDATPVTSA
FT                   DLAADAYLKQALSALTPHVPVLTEEAADIPFSQRANWRQYWLVDPLDGTGEFIAGSGDF
FT                   ATLIALVQDNVPVLGVIYAPESNVLYWAVRGHGAFKEANGEVHPISAMHHEHDQPDSLV
FT                   VAISRRQKLENLTRRLNPAINYELIPLGSSSLKSCLVAEGAADCYVRLGPTGEWDTAAA
FT                   QCIVEAAGGRILSLALQPLRYNETESLENPDFIVMGDPDLAWGSILAH"
FT   gene            619602..620873
FT                   /locus_tag="AHA_0585"
FT   CDS_pept        619602..620873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0585"
FT                   /product="serine transporter"
FT                   /note="identified by match to protein family HMM PF01490"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36559"
FT                   /db_xref="GOA:A0KFU2"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU2"
FT                   /protein_id="ABK36559.1"
FT                   /translation="MSLSVDVTKELSGSCSTTVSATPWRRHDTHWVISLFGTAVGAGIL
FT                   FLPINLGLGGIWPLIIVSVLAGPMTFLAHRGLARFVLSSSRPHADFTEVAQEHFGKMAG
FT                   RLISALYFLSIFPILLIYGVGLTNTVESFMINQLGMDAPNRVMLSGLLVFAMIAVMLAG
FT                   EKAMLRAFAVMVYPLAAILAALSCYLIPQWQWPQLGSLEGGSFLNTVWLALPVTVFAFS
FT                   HAAAISGFANVQRREYGELAEAKSSLILRNTTVMLVGFVLFFVFSCVLSLSPAQLAEAK
FT                   AQNVSVLSYLANITDNPVIVTLGPLIAFIAISSSFLGHFLGARESLKSLIAKPTGLSLA
FT                   KADRLGIALMFFSIWGAAIINPGILGLMETLSGPVIAMILFIMPVVAIYKVEALARFRH
FT                   RWANGFILLTGALAVSALIFSLLK"
FT   gene            complement(620947..621285)
FT                   /locus_tag="AHA_0586"
FT   CDS_pept        complement(620947..621285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0586"
FT                   /product="protein CsaA"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM TIGR02222"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36731"
FT                   /db_xref="GOA:A0KFU3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU3"
FT                   /protein_id="ABK36731.1"
FT                   /translation="MQTISWQDFEMVELRVGTLVRVEPFPEARRPAYKVWADFGPELGV
FT                   RKSSAQITDLYQPQELVGRQIVAVVNFPPKQIGPIQSEFLLTGFYRPDGAVVIAIPEQA
FT                   VQNGAKLG"
FT   gene            complement(621370..622122)
FT                   /locus_tag="AHA_0587"
FT   CDS_pept        complement(621370..622122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0587"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37446"
FT                   /db_xref="GOA:A0KFU4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU4"
FT                   /protein_id="ABK37446.1"
FT                   /translation="MTRPQAASSLSAPFSLRRYQSDICSHSHDHAQLVIPLDGPIEIEV
FT                   QGQGRRLAPGFACIIAPGERHDYAADPALSFLVQESHWLPGELGERPFIELDQAQRHYL
FT                   AFLHRMVAEGRHVAGMEQVWLGLLAEAQQAGSRARARLAPRIGKVQRHIEAHLAEPLSN
FT                   ARLAALACLGQSQFKHAFQQQVGMSVSHYIRARRMALARTLLAHTALPVGEIASRCGYQ
FT                   NQGAFGERFLAETGLTPSLWRQQNGRLP"
FT   gene            complement(622158..622481)
FT                   /gene="metJ"
FT                   /locus_tag="AHA_0588"
FT   CDS_pept        complement(622158..622481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="AHA_0588"
FT                   /product="met repressor"
FT                   /note="identified by similarity to SP:P0A8U6; match to
FT                   protein family HMM PF01340"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38234"
FT                   /db_xref="GOA:A0KFU5"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU5"
FT                   /protein_id="ABK38234.1"
FT                   /translation="MGTEWNGDYVSPYAEHGKKSEQVKKITVSIPLKVLKVLTDERTRR
FT                   QVNNLRHATNSELLCEAFLHAFTGQPLPCDEDLRKDHPDSVPAEARAIMEALGKEIEDF
FT                   DAE"
FT   gene            622690..623853
FT                   /gene="metB"
FT                   /locus_tag="AHA_0589"
FT   CDS_pept        622690..623853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="AHA_0589"
FT                   /product="O-succinylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.48"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR02080"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39105"
FT                   /db_xref="GOA:A0KFU6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU6"
FT                   /protein_id="ABK39105.1"
FT                   /translation="MTHKATQAVRTGIETDQQHGAVVPPIYLSSNYTFADFGEPRQYDY
FT                   ARSGNPTRTNLADALAALEGGAGAVVTGTGMGAVHLVTTALLKAGDLLLAPHDCYGGTW
FT                   RLFEYLAAKGHYRVQFVDQGDAAALAEALAQQPALVWVETPSNPLLRVVDIAAIAEASH
FT                   AAGAKVAVDNTFLSPLLQQPLALGADLVVHSTTKYINGHSDVVGGVAIAKDPELADSLV
FT                   WWANCLGLTSGAFDSYLTLRGLRTLAPRLRAHQENTDRILAFLQQQPLVKRIYHPSLPS
FT                   HPGHDIARRQQSGFGAMLSFELDCSEAGIRAFLAALTLFSVAESLGGVESLVAHPASMT
FT                   HRAMTPAAQQAAGISSQLLRLSVGIEHGEDLVADLAAAFAQAQQVAK"
FT   gene            623853..626321
FT                   /locus_tag="AHA_0590"
FT   CDS_pept        623853..626321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0590"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase II (akii-hdii)"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF00742; match to protein
FT                   family HMM PF03447; match to protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39637"
FT                   /db_xref="GOA:A0KFU7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU7"
FT                   /protein_id="ABK39637.1"
FT                   /translation="MEQQQQGEIAVATEAGLKRRHVHKFGGSSLADPVCYRRVASILEQ
FT                   QAEQQGGGRELVVVSAAGKTTNRLIQLVELAEAGDEAAGEAISALQAYQQSLIDGLLEG
FT                   ELHLELSQQLADDMQLIAKTLEGQFDRFERNGLLAFGEVWSARLLAALLTSRGDKAIWL
FT                   DARSFLRAEDGALVKVDTALSSELLKARLAEHAGRIVVTGFIAADMEGRSLLLGRNGSD
FT                   YSASLLALLADGESTTIWSDVAGVYSADPRRVKEARLLERLSLAEANELARLGSSVLHS
FT                   RTLQPVADSRQRLTLRCSYNPDEGCTHILRRAPRSGGARIVSSVDQIALIELKVLPQTH
FT                   YEQTVAAIEAHLARHRLNPLTLQRQPDRRILRLAYTLEVAQGAFELLRDFQLQGSFTGL
FT                   IQREGYSLVALVGAGVTDNAEQCHRFYQLLADQPLEFVQVAKDGLSLVAVLRQVVLEPL
FT                   LIALHSALFSRPNRVGLVVFGKGNIGGHWLNLYAREKARLEHELNLALTLYGVFSSEGG
FT                   LLDEEGLDPLKVQDNFNPKPLIWPELLAQLEQHGFDTLIALDMTASETVSRYYPDFAQL
FT                   GIHIIAANKFAGAADSEFYQRIKQTCRDHQVQWRYNATVGAGLPIQSSIQMLRQSGDRI
FT                   QGVSGIFSGTLSWLFQQYDGSRPFSELVDEAWQHGLTEPDPREDLSGQDVRRKLLILAR
FT                   EAGFELDSADIELENLVPVSLRKVSTDQFMDRLKDLDDPIQTAFEGARRVGKVLRYVAR
FT                   FEHDGKARVGLEALEPHHPFANLLPCDNIFAIESDSYRTNPLVIQGPGAGREVTAAAIQ
FT                   YDLWQICASL"
FT   gene            complement(626974..629607)
FT                   /gene="ppc"
FT                   /locus_tag="AHA_0591"
FT   CDS_pept        complement(626974..629607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="AHA_0591"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="identified by match to protein family HMM PF00311"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39687"
FT                   /db_xref="GOA:A0KFU8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFU8"
FT                   /protein_id="ABK39687.1"
FT                   /translation="MNEKYAALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKSS
FT                   RKGNETDRERLLDTLRNLSDDELLPVARAFSQFLNLANVAEQFHTISRRCEEQVCTPDP
FT                   LEQMFDKLKASNLSQEAIIQAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEALEL
FT                   SDLLPRERDKILNRIEQLVNQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIPEFMR
FT                   NLDERLQHHLGVRLPLDAAPVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAVSLFYK
FT                   DIKELTSELSMSDCTDAVRERVGDHPEPYRALVRELREQLRETQEFLTAKVQGQASESR
FT                   DLVKTTAQLREPLELCYHSLHACGMGNIADGMLLDVLRKLACFGIHLVKLDIRQDGERH
FT                   GQVFSELTRYLGMGDYAEWSEDDKQAFLLNELNSRRPLIPTDWEPSDETRETLDTCKVI
FT                   AQHDPDAFGIYIISMAGAPSDVLAVQLLLKEAGCKFRMPVAPLFETQEDLMAGTAVMER
FT                   LLSVDWYRGYIQGRQYVMIGYSDSAKDAGMMAAGWAQYAAMESLVALAEANNLRLTLFH
FT                   GRGGTVGRGGAPAHQAILSQPPGSLRGGLRVTEQGEMIRFKFGLPKVAIQSLNLYTSAV
FT                   LEGNLLPPPKPKECWRAVMEQLASVSCDHYRSIVRGHPDFVPYFRAATPEMELGKLPLG
FT                   SRPSKRKPNGGVESLRAIPWIFAWTQNRLMLPAWLGAHKGLQQAIADGQKGVLEEMSRQ
FT                   WPFFRTRLEMLEMVFLKADVWLAEYYDTRLVPKELWGLGKQLRQELADSIQVVLELRPQ
FT                   GDLLDDQPWIKESIKLRNPYTDPLNVLQVELLGRSRNHAETLHPELDQALMVTIAGIAA
FT                   GMRNTG"
FT   gene            complement(629823..630968)
FT                   /gene="argE"
FT                   /locus_tag="AHA_0592"
FT   CDS_pept        complement(629823..630968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="AHA_0592"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /EC_number="3.5.1.16"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01892"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38365"
FT                   /db_xref="GOA:A0KFU9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU9"
FT                   /protein_id="ABK38365.1"
FT                   /translation="MANLDFFSLYKNIIAIPSISSTDPRWDQSNEAVIRLLADWFGQLG
FT                   FQCEVTALPDLPGKFNLVATIGQGEGGLLLAGHTDTVPFDEGAWRKDPFKVTEEGNRLY
FT                   GLGTIDMKGFFAFIVEALKEIDLKTLSKPLRILATADEETTMAGARAIAAAAELKPDYA
FT                   VIGEPTGLVPVVAHKGHMSEAIRITGRSGHSSDPANGVNALEIMHQAMGQVLKLQHSLK
FT                   EKYADHRFAVPQPTLNLGYIQGGDSPNRICGCCELHIDMRPTPQVGPDELMGMLKEALS
FT                   PIEIHQPGCLHLQHLHEPIPAYACADDSELVREAERASGRAAESVNYCTEAPFIQQLGC
FT                   ETIVLGPGHIAQAHQPDEYLDLSFVKPTTRVLQHLIRRFCL"
FT   gene            631237..632244
FT                   /gene="argC"
FT                   /locus_tag="AHA_0593"
FT   CDS_pept        631237..632244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="AHA_0593"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01850"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37991"
FT                   /db_xref="GOA:A0KFV0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFV0"
FT                   /protein_id="ABK37991.1"
FT                   /translation="MLNTVIVGASGYAGAELAALVQNHPQLKLFGLYVSAGSQDAHKRF
FT                   SSLHPQWVGALDQPLLPLDEDGMTRILTQADLVLLATAHEVSATLAPKFLAKGLPVFDL
FT                   SGAFRVRDQQFYASYYGFTHDSEQWLDQAAYGLAEWNAEAVKAAQLIAVPGCYPTASLC
FT                   ALKPLQQAGLIAKGWQPIINAVSGVSGAGRKAAINTSFCEVSLNPYGTFNHRHQPEISH
FT                   HLGKEVLFQPHLGNYVRGILATIYVQLADGVTPTQVDQAYLKAYEGKPLVRLTGQMPSI
FT                   RGVAGTPYCDLAWQQQGNMLVVVCAIDNLLKGAASQAMQCINIKFGFEPATGLI"
FT   gene            632268..633047
FT                   /gene="argB"
FT                   /locus_tag="AHA_0594"
FT   CDS_pept        632268..633047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="AHA_0594"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38661"
FT                   /db_xref="GOA:A0KFV1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFV1"
FT                   /protein_id="ABK38661.1"
FT                   /translation="MDKQTLVIKLGGALIENDEALTALFATLKTFLDEQHRPLVLVHGG
FT                   GCLVDDLLKGLGLTSTKKNGLRVTPFEQIPFIAGALAGTANKMMMAKAIATDIPAVGLC
FT                   LADGGLCQVTQLDPALGAVGDCQPGNPALVTGILGQGFLPVVSSIGITAQGQLMNVNAD
FT                   QAATAIAEALGADLVMLSDVSGILDGKGKLVPQLDKVTALDLMEKGVISDGMAVKVKAA
FT                   LHAAETLGKPVCVASWRYPDQLLKLLAGGAVGTQVAI"
FT   gene            632968..633984
FT                   /gene="argF-1"
FT                   /locus_tag="AHA_0595"
FT   CDS_pept        632968..633984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF-1"
FT                   /locus_tag="AHA_0595"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39334"
FT                   /db_xref="GOA:A0KFV2"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV2"
FT                   /protein_id="ABK39334.1"
FT                   /translation="MSPAGATRISCSSCWLAARSAPKWLFDLHRSKEHPMQHLLKDSDL
FT                   NKAQIEALIALGKAVKADPKKYGQALAGKSVVTLFEKPSLRTRVTFDIGIAKLGGHSVY
FT                   LDQQNGALGKRESVQDFAANLSRWCDAIVARVFDHQTLVELAEHGTVPVVNSLCNLYHP
FT                   CQGLADFMTISEHYGDLSKVKLAYLGDGNNVSHSLLLLGATLGTNVTLVCPKGHGPDTQ
FT                   IFLQAQALAAQSGATIHISDDVAAIEGFDVAYTDTWVSMGDNTPMEQVKDIFMPYQINQ
FT                   ALLDRTGIQHVLHCQPAHRELEITSQVMDGPGSLIMDEAENRMHIQNAVLLTLLGHK"
FT   gene            634039..635274
FT                   /gene="argG"
FT                   /locus_tag="AHA_0596"
FT   CDS_pept        634039..635274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="AHA_0596"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39577"
FT                   /db_xref="GOA:A0KFV3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFV3"
FT                   /protein_id="ABK39577.1"
FT                   /translation="MSGINKIVLAYSGGLDTSAIIPWLKENYDAEIIAFVADVGQERDD
FT                   LEGIEQKAIASGATKCIVKDLREEFVKEYVYPTLKTGAVYEGTYLLGTSMARPVIAKAM
FT                   VEAALAEGADAISHGCTGKGNDQVRFEGAVAALAPQLKVIAPWRLWDMRSREDLLAYLE
FT                   TRNIPCKATLKKIYSRDANAWHISTEGGELESTWNEPSEAVWQWTVPAEQAPDQPEYVK
FT                   LTVAQGEVVAVDDQPLSPHQILTTLNERAGKHGVGRIDITENRMVGMKSRGCYETPGGT
FT                   VMVAALRAVEELVLDRPTRAWREKLGAEFSHLVYDGRWFTPLCKAIVASANAIAEDLDG
FT                   EVVLKMYKGQVTAVQKKSPNSLYSEDFATFGADEVYDQSHAEGFIRLYTLASRIRAMKE
FT                   QHQAIGGDHTHG"
FT   gene            635484..636869
FT                   /gene="argH"
FT                   /locus_tag="AHA_0597"
FT   CDS_pept        635484..636869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="AHA_0597"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36163"
FT                   /db_xref="GOA:A0KFV4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFV4"
FT                   /protein_id="ABK36163.1"
FT                   /translation="MALWGGRFSQGADSRFKQFNDSLRFDYRLAEQDIQGSMAWAKALV
FT                   KVGVLTADEQGKLQQAMEVLLASVQQDPQQILISDAEDIHSWVESALIAAVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKAQGELLLGSITALQQGLVASARANQAAVLPGYTHLQRAQPV
FT                   TYAHWALAYVEMLERDYSRLQDALKRLDTSPLGCGALAGTAYAIDREALALDMGFAGAT
FT                   RNSLDSVSDRDHVVELMHVASLSMTHLSRFAEDLIFYNTGEAGFVELSDAVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVVGAQMGMLMSLKALPLAYNKDMQEDKEGLFDALDTWHDCLD
FT                   MAALVLIDLKVNGERTMAAAQGGYANATELADYLVAKGIPFREAHHIVGETVVYAIQVK
FT                   KPLEELTIGEFQRFSPVIEFDVYPNLELEATLAKRVAKGGVAREQVEAALIAAETWLAK
FT                   RAG"
FT   gene            complement(636990..637547)
FT                   /locus_tag="AHA_0598"
FT   CDS_pept        complement(636990..637547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36914"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV5"
FT                   /protein_id="ABK36914.1"
FT                   /translation="MYAIYGDVNYLELPIDIKDIARKIEKVNLLSDFDLNDLFVSGFLK
FT                   IKKDESGLVDKIDIWVNPTEVLTRQRFTLAHEVGHLFNDIIPNIDNLEEDMIVDVAFNR
FT                   GALKSHKETKADRFAAQLLMPPQLISRELSNLVTILKEKKEKVSVDYLIKILSKKFLVS
FT                   EKSMKIRLESLGYIKANDNDRD"
FT   gene            complement(638445..638906)
FT                   /locus_tag="AHA_0599"
FT   CDS_pept        complement(638445..638906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0599"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37374"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV6"
FT                   /protein_id="ABK37374.1"
FT                   /translation="MIAISTLLPLASLALKLGSKLLGDGTPQAKAETPVQEERLAPTVQ
FT                   SLFQRLGVKDANSEQSRPAINHFMGALMQTLGQEYSGQSLPQAIDAARTQLADGTQSTR
FT                   LDALQSELDTLKDSLGASNLNLDQLLGAFKQTLPNGKGEGVGRMLNTSV"
FT   gene            complement(639107..639379)
FT                   /locus_tag="AHA_0600"
FT   CDS_pept        complement(639107..639379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38703"
FT                   /db_xref="GOA:A0KFV7"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV7"
FT                   /protein_id="ABK38703.1"
FT                   /translation="MRQQKASRLFSRLFIGKESLMTMWTGIVLIVFISALFGFLSKRAR
FT                   YQLGDIRITDRLGKQDVLINQLQERIANLEAIVIEEEKRRPFKEL"
FT   gene            complement(639428..639769)
FT                   /locus_tag="AHA_0601"
FT   CDS_pept        complement(639428..639769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0601"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF06961"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39232"
FT                   /db_xref="GOA:A0KFV8"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV8"
FT                   /protein_id="ABK39232.1"
FT                   /translation="MIWLALLPLLWTAWLGLADANWWPLAIVTTMSLLTVLAYAHDKRQ
FT                   AIRGGWRIPESRLHLLELFGGWPGALVARHWLRHKTQKGSYRRVFWFIVLLHLTLWGLW
FT                   LGRPLWQTI"
FT   gene            complement(639766..640356)
FT                   /locus_tag="AHA_0602"
FT   CDS_pept        complement(639766..640356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0602"
FT                   /product="maltose O-acetyltransferase"
FT                   /EC_number="2.3.1.79"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36537"
FT                   /db_xref="GOA:A0KFV9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV9"
FT                   /protein_id="ABK36537.1"
FT                   /translation="MASDWDKVLAGGALDSQSEEIANDRIRGQALLAQLNASPAGDEAL
FT                   RQRLCGELFGHCPDSCWISTPFTCEFGRNIHIGEKTFFNFNITILDVGEVHIGSHVLLA
FT                   PNVQIYTATHTMDYLERRNWTAYNKPVRIGDDCWIGGGAIICPGVTIGPRSIIGAGAVI
FT                   TRDIPADSVAVGNPARVIRSLSPDAPRGWELAL"
FT   gene            complement(640437..641699)
FT                   /locus_tag="AHA_0603"
FT   CDS_pept        complement(640437..641699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0603"
FT                   /product="MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37105"
FT                   /db_xref="GOA:A0KFW0"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW0"
FT                   /protein_id="ABK37105.1"
FT                   /translation="MWINAEPVNGALVSLAIGLIIGLERGWQVRQLGDNQRIAGMRTYG
FT                   LIGLLGGVCALLLPTLGPWLPLLGLLAVVTGCGLSVWLAQRWQGEFGLTSSVAMLLTYL
FT                   LGLMSVLLSPSEAVACAVLAALLMGLKGKIQQGMLFLSETEFHATLRFLLISLVLLPVL
FT                   PNEEMGPLDAFNPFKIWLMVVVIAGISFCGHFAVRLLGTRAGLVLTSILAGLASSTALT
FT                   LQFARLNKEQGGLERLLATGILLAGATMWLRLLVLVLLIHSELAMRLAAPLLLLAATVY
FT                   GFAFWFWRQREELTDGPVQPQTSNPLDLATAIKFGLLLALIGFMATLLQSKVGNSGVYL
FT                   LSLVSGITDVDAITLSLSQLSHKELALEVAARGILLAGLVNSLVKGLLALGIGGRRLGL
FT                   RVLLPYFVSALLILPLIWPGT"
FT   gene            641909..642910
FT                   /locus_tag="AHA_0604"
FT   CDS_pept        641909..642910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0604"
FT                   /product="sulfate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38063"
FT                   /db_xref="GOA:A0KFW1"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW1"
FT                   /protein_id="ABK38063.1"
FT                   /translation="MKLRMTALTLLSLLALGQANAAEIRLLNVSYDPTRELFQEFNGAF
FT                   AKEWKAKTGDDVVVSQSHGGSGKQARAVVDGLEADVVSLALAYDVDAVAKQGLTAADWQ
FT                   SRLANNAAPYTSTIVFLVRKDNPKQIKDWDDLVRKDVAIVTPNPKTSGGARWNYLAAWG
FT                   YALKKSGSEEGAKQFVGDLYKNVKVLDSGARGATTSFIERGLGDVLLAWENEALLVLGQ
FT                   PGNSDKFELVVPSVSILAEPPVAVVDKVAKKHGTEAVAKAYLDYLYSDEGQRIIAKYHY
FT                   RPSNPAILKETAAQFPQLALFTVKDLEGDWDKAQKKHFAQGALFDQIYQPGR"
FT   gene            642967..643542
FT                   /locus_tag="AHA_0605"
FT   CDS_pept        642967..643542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38512"
FT                   /db_xref="GOA:A0KFW2"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW2"
FT                   /protein_id="ABK38512.1"
FT                   /translation="MNKILLVPGLHNSGPDHWQSRWHQYFPHWQRMVGLPWDRPDLTVW
FT                   SAKLASKLRSRRGRAHLVAHSFGALAAITAARQQPDKVASLFIVAPADPARFGLPDELL
FT                   AGSLKVSAQLVASRNDPWMSFERAEYWSRQWQVPLFDAGEVGHINAQSGHGEWNQGLNL
FT                   LGTLYRRAEMVVEPTPAVWERRAALSFR"
FT   gene            643795..644661
FT                   /gene="cysT"
FT                   /locus_tag="AHA_0606"
FT   CDS_pept        643795..644661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="AHA_0606"
FT                   /product="sulfate/thiosulfate ABC transporter, permease
FT                   protein CysT"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02139"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38971"
FT                   /db_xref="GOA:A0KFW3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW3"
FT                   /protein_id="ABK38971.1"
FT                   /translation="MFFITNGCVMRFGSYSVLPGFGPTLGFSLLYLGVLVLLPLSALVL
FT                   FAVNNLTLAEFWQVIGSPRVLASFRLSFGAALVAALLNALFGLILAWVLVRYTFPGRRL
FT                   VDALIDLPFAMPTAVSGIALCAIFAPNGWIGQWVAPFGIELAYNPIGVVIALTFIGLPF
FT                   VVRTLQPVLREAETEQEEAAASLGADRWQTFIRVLWPTLVPALLTGFALAFARAVGEYG
FT                   SVIFIAGNLPMVSEIAPLMIMSHLEEYDYAGASAIAVVMLLISFILLLLINKLQAWSWA
FT                   RIGGSRI"
FT   gene            644658..645554
FT                   /gene="cysW"
FT                   /locus_tag="AHA_0607"
FT   CDS_pept        644658..645554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="AHA_0607"
FT                   /product="sulfate/thiosulfate ABC transporter, permease
FT                   protein CysW"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02140"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39011"
FT                   /db_xref="GOA:A0KFW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW4"
FT                   /protein_id="ABK39011.1"
FT                   /translation="MNASNASLALATGEAAPTTSVRQPPVIREPVWVKWLLITVGLGWF
FT                   AALLLLPLATVFIQALSPGLTFFWHAISEPDALSALGLTALVTLCSVPLNLLFGVAAAW
FT                   AIARFRFPGRQLLITIIDLPFSVSPVIAGLMFVLMFGSRGWFGEWLSEHDIKVIFATPG
FT                   IILATTFITVPFVVRELLPQMEARGPEEEEAAIMLGASGLQMFWRVTLPGIRWSLMYGL
FT                   LLCTARAVGEFGAVSVVSGHIRGQTNTLPLHIEILYNEYQTGAAFAVASLLALFGIFTL
FT                   LGETLLARLRAQPTHSH"
FT   gene            645577..646644
FT                   /gene="cysA"
FT                   /locus_tag="AHA_0608"
FT   CDS_pept        645577..646644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="AHA_0608"
FT                   /product="sulfate/thiosulfate ABC transporter, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03459; match to protein
FT                   family HMM TIGR00968"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39441"
FT                   /db_xref="GOA:A0KFW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041193"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW5"
FT                   /protein_id="ABK39441.1"
FT                   /translation="MSIQVQGLNKHFNQYAALADINLDFHDGELVALLGPSGCGKTTLL
FT                   RIIAGLEQADSGSVIIRGEDASDLHVRERNVGFVFQHYALFRHMTVFENVAFGLRVKPR
FT                   SERPAEAAIRARVKELLDLVQLSHVAARYPTQLSGGQRQRVALARALAVQPKVLLLDEP
FT                   FGALDAQVRKELRRWLRELHDELHVTSLFVTHDQEEALEVADRVVLMNAGKVEQIGTPA
FT                   EVYDQPASSFVHSFLGSVNLFRGRVAGQGLGIGEQLLGGPISSQLAEGSAAVAYVRPHE
FT                   LEILPADAPGGISATITRLLPMGPRIRVELRGNGDTNGAHFEAELSKEAARAFSPGQGV
FT                   RLVAKQAQLYPDYQI"
FT   gene            646821..647768
FT                   /locus_tag="AHA_0609"
FT   CDS_pept        646821..647768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0609"
FT                   /product="HTH-type transcriptional regulator cbl"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36817"
FT                   /db_xref="GOA:A0KFW6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW6"
FT                   /protein_id="ABK36817.1"
FT                   /translation="MNFQQLRIIREAARRDYNLTEVANALFTSQSGVSRHIRELEEELG
FT                   IELFIRYGKRLLGMTEPGKELLVIAERILNDANNIRKLASTFANRESGRLLVATTHTQA
FT                   RYALPRVVKAFREQFPLVQLELRQGSPEEIVRLVQTGEVDIGISSEQLDKSEGVVAFPY
FT                   YRWHHNIVVPEQHPLTAERELTLAALAHWPIITYQAGLTGRARVDEAFAEAGIAPQILL
FT                   TAQDSDVIKTYVELEMGVGILADMAFDTQRDKGLVQLDGSRLFAPHTAWIGLKQGQFQH
FT                   NFAWQFIQLCNPELALADIQARAMGSEAAIDFQI"
FT   gene            complement(647841..649325)
FT                   /locus_tag="AHA_0610"
FT   CDS_pept        complement(647841..649325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0610"
FT                   /product="chitin binding protein"
FT                   /note="identified by match to protein family HMM PF03067"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37291"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR041029"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW7"
FT                   /protein_id="ABK37291.1"
FT                   /translation="MLRGTPPANLTAHICRTEECMAAKIQLNHVAATLALLVSGSVLAH
FT                   GYISQPESRNYLCKTGGNSQCGAVQWEPQSVEGPSGFPQAGPPDGQIASAGSASWRELN
FT                   AQTSDRWTRREVQAGPFAISWTFTANHVTRNWRYYLTKQDWNPNQPLTRAAFELTPFCV
FT                   VDGNMTQPPKQVTHQCNLPQRTGYQVILGVWEVGDTSNSFYNVIDANFKGGTQPPLAWS
FT                   QGGTIYPSTELAVGDKARTLVFDANGVRPDLQTELTIASPEQGQKNNWAHALATKINAE
FT                   QSQIRAGQQSGEGQFNPIYGQNPVYFKAGSALERVEIQLEQQQPPVSNGVSVSGLESDY
FT                   LLDEGKLTLNFTVAAEGDLTVTNTLYDHGGAAKGQTSADIKDSTHSFTMPLTGLSAGHH
FT                   QLVIEGKPKAGGDAVQQTLDLMLKDPAAGGDYQFTFPDGLKSYTDGTKVLQPKNGKVYQ
FT                   CKPFPYRGWCSQWSASATQYEPGVGTNWQDAWIQVN"
FT   gene            complement(649679..651376)
FT                   /locus_tag="AHA_0611"
FT   CDS_pept        complement(649679..651376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0611"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39381"
FT                   /db_xref="GOA:A0KFW8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW8"
FT                   /protein_id="ABK39381.1"
FT                   /translation="MFKLGDIAVSRKLMLLLSLALIGFIALLLISASALHRNLMSEREA
FT                   RLQAVLDLAMSRIQTLAATLPAPQAQAEAKAMLNSMRFDGDNYLFVLDENRRMVVHPVR
FT                   PELVGQQMGESGTATAGVHWQQMVDLGKGGHSGRLEYKWISPSGEAAQKMSLVAGYQPW
FT                   GWILGSGVLLQDIQATIWSQYQLMGGATLLVTLLMGLLGFAISRSIVNPLAEINRAMQQ
FT                   VAAGDLVVSIPVHGQDELGAVASCTNQGLNAIRRALLEASQGARNVADAALRIAASAEQ
FT                   TNQAVNSQRDQLAQLATAMNEMSATISDVAGHAENTARDTQDATSEAGLGNRDVHASVH
FT                   GIQALATEVEQATLQVNQLKEGVMQISEVTAVISAISEQTNLLALNAAIEAARAGEQGR
FT                   GFAVVADEVRQLASRTRQSTEEIQSTIAQLQQRAVTAASAMDASRKLAESSVSQSEKAG
FT                   QDLSLIVNHIQHVSDMATQIATAAEQQSMVAEDMNRNVSGINDSALEMSQSASQLARES
FT                   ELLAGLSRSLDERLAVFKLGSAIDQQLEQRLAPLHRQVSPAERPRVRH"
FT   gene            651672..653519
FT                   /locus_tag="AHA_0612"
FT   CDS_pept        651672..653519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0612"
FT                   /product="oligoendopeptidase F"
FT                   /note="identified by match to protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37892"
FT                   /db_xref="GOA:A0KFW9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW9"
FT                   /protein_id="ABK37892.1"
FT                   /translation="MSSIARNYLNQLNADYLQVHRRKEDLFWSTYMGTSDDQAGFTAAE
FT                   QAYKAFCADPARLPVLRQMQAQAEETELKRGLGGWIAFFECNVIEDPQAAALMDELVAA
FT                   EAALFARRRELKLTLLDEQGRQVAGSLPAASTALAASSDEAVRQSALAMFHTLEQWVVD
FT                   NGYLAIVALRNRFARAMGYRDYFDYKVHKNEQMSPAQLFAILDDFIAGTEQRLHQSLAE
FT                   LKAAKGEAALLPHNLRYSVSGDVTRQLDPYVPFSRALQDWVESFRRLGIQYRGATLTLD
FT                   LLTREGKYENGFCHGPVPSFWQEGEWVPAVVNFTSLANPAQVGSGWSGLNTLFHEGGHA
FT                   AHFANVTGNAPCFSQEFPPTSMAYAETQSMFCDSLLDDADWLKRYARNAAGEPIPDALI
FT                   KAMIEARQPFRAFNERQIALVAYFERDLYAMDEAERTPAAVLVLARRWERKILGGESPR
FT                   PLLAIPHLLNQESACAYHGYLLALMAVEQTRAYFLKRDGYLTDNPRIGPDLAAHYWGPG
FT                   NGMTHDETLQSLTGKGFSAGPLARACNQSVAEAWQQAEACMAAARQRPPVGEGEPLNAR
FT                   IRVVHGDQLIADNSGSEAAMLADFECWIRDHYQETVTSH"
FT   gene            653596..654387
FT                   /locus_tag="AHA_0613"
FT   CDS_pept        653596..654387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35827"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX0"
FT                   /protein_id="ABK35827.1"
FT                   /translation="MGTTARWRWLLATLLLTGGLAQPARALQALTEQMPPYNYQLAGQP
FT                   VSGFSVDLLHALLARSGLALRGDIQLQPWARAYQNARYQAGSILFSVARTPEREQQFQW
FT                   VGPFGPRTIRVWRLSSRTDIQPRSLQEASHYRIAVVRNSASAQQLIRQGLAPVSVNSEE
FT                   DKFRMLLRGRVELVTALDLGAAFHMHQLGHGLAALTPLFVYDDGEQYYFALNLATEPAK
FT                   VQALQRALDQMRQDGSLEALRRRWLNLHALPPAPASGATPS"
FT   gene            complement(654401..656596)
FT                   /locus_tag="AHA_0614"
FT   CDS_pept        complement(654401..656596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36349"
FT                   /db_xref="InterPro:IPR021459"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX1"
FT                   /protein_id="ABK36349.1"
FT                   /translation="MNGLPIRAPALGWLLISLLAAPLAAAPLTLQGETQRYRIDPDTLA
FT                   ISVNQIPVSAGQPARQVDQLQQGEQQASWHWPAQDARVEVKLDGDDLLLTLVSDSPRQL
FT                   AWFSLPKNQTHLSLAFGEGSRFSVRDSDWLGYVGDELAELNTHYDLKLPLWSQDAGKQT
FT                   YSWILQTPYDNRLRFSRQGGRLQLSASHEFSSFNQQAPMVVRLSVGDDWLAGARRYRAW
FT                   LQSEGAWQSLADKVARIPAGRRLIGASHVYLWGDALLDRQDVTAWPALQAKLRQKPEWL
FT                   QGFNSEEREALAANAPEPWQQALIMAGLNRLIADQLPLPAQQGPQAQSKVLALRQQWVK
FT                   SQFGEQLVAQERWGQGLSLPVIEALQQAGLRKLWLGTPQWTAALQQGYALTAAQRQGYL
FT                   VGSYDSYDTAIAPGTNDSWLTAQLPPEIGKRCAIFEANGEPKPGFGGEGVYLNPGCTLP
FT                   FAKSRMSELAKASGINSLFLDVDGTAMASNDYNPAHQQGSQAMIADRNARMSWVGERLG
FT                   LVLGSEDGNALTSKPLLFAHGIQSWGFGWTDAAMRKQAKSPYYLGKWWPDEAPQVFFQP
FT                   ARLKPRYLKTVFNPADRLPLYQAVFHDSVLNSHHWLLDNLKFPGIKEERALLGLLYNTP
FT                   PLVNLSRSTLASRLPELVRLDSQFGPLHEALWDKALVGFRWRDGVGRVQETRFSDGSRL
FT                   VANFGHSSIMIDGHKLPGRQLLVALKDKPVSVLKIQG"
FT   gene            656878..657588
FT                   /locus_tag="AHA_0615"
FT   CDS_pept        656878..657588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38761"
FT                   /db_xref="GOA:A0KFX2"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX2"
FT                   /protein_id="ABK38761.1"
FT                   /translation="MNAIHCFIRIVFDWSISMKRAKWKPWLGLGALLAGVIGWYLWPQG
FT                   VAPGQAAGDEERAADSGPLAELTPLAAMPAPALKPAPIAAPAKPDRLREDGSQQLETPW
FT                   QAAEVDADFPLAEPGDAVEQPQPIALQGSDLERAQVGDSVALPMPDGSTLQARVTKVEL
FT                   QRGGERNWQGEIRVDGDSYPVNFTVGKQATFGFIGTPQGSYSVETLGGKGWVYKNPPLD
FT                   LGHGGDDALIPTHQ"
FT   gene            657609..658952
FT                   /locus_tag="AHA_0616"
FT   CDS_pept        657609..658952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37164"
FT                   /db_xref="GOA:A0KFX3"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX3"
FT                   /protein_id="ABK37164.1"
FT                   /translation="MQKTTLGIMIAGLLGATPVLAETIDLMVLHSPGLAARYQGDAQTR
FT                   IQHMINVTNQIYAASGLDLTVRAVHDQQVNYPDGGTDKSALNAVTYQQDPAFKQVPTLR
FT                   TRYGADMVVLMRPQTGDHGSCGLAWVGGSATYTDGSKAYADGDVSQDAGSMFSHVTATG
FT                   CGDVVLAHELGHNMGLNHSRLQDGTGGTYHYALGHGVRGSFATVMAYPSSFGVYSHEYK
FT                   FSSPDLICKGQPCGVDYRDQANGADAVRALRVTTPQIAAFYPTMVTEALPDLGELERSL
FT                   ETRRQDLAAAQEHYSQQVAARTALQDRQQTLKGNFDRYQRELSQLNQRNRQTVQEINRL
FT                   VREHNSYNGSYGPEEYRRIRAIQASLSARIDQLHDENNAIIRQSNEISQRYQAEVNEYN
FT                   GSWDRYNQLVAAVKSADGKVDEARRELELAEHRYQLALARQPAETQPA"
FT   gene            complement(659059..662220)
FT                   /locus_tag="AHA_0617"
FT   CDS_pept        complement(659059..662220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0617"
FT                   /product="putative Tricorn protease homolog 1"
FT                   /note="identified by match to protein family HMM PF03572;
FT                   match to protein family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37984"
FT                   /db_xref="GOA:A0KFX4"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX4"
FT                   /protein_id="ABK37984.1"
FT                   /translation="MRYRLSLLLLLLCSSLQAAEPLWLREPALSPDGKQLAFTWQGRVY
FT                   LSAGDGGPAVPLTDGNYLSQRPLWSPDGKLIAFAANLYGNEDVFVVPSHGGEMVRLTRD
FT                   SRPDLPQAFSADGKQLLLSSQRLTDPDADHFVAEGYQAGNLYWTPVAGGPLTPAQPLPA
FT                   TLARPHGSQLAYQMPGMDQPFRKHQHSFAVSRLWLFDGKQHRQLTEDRVAASDPVWDEQ
FT                   GKQLYYLSERSGDFNVWQRDLASGQDRQLTHFKGHPVRGLSASRQGDLVWSWQGELYRL
FT                   DAGSDTPRKLVIQPLFAKVPAEQSWQPGPIDEAIARQDGEEVILVSQGDLYAVDTRRER
FT                   VRQLTRHPSEQSAPRYLDKEQELIYLSEQEGPAALYRLKKGQPDKLFSDPGPLTEEKLL
FT                   AIPGAAISVPTLSPDGKQLAFVVDGQAVHLLDLASGKQRQLVAAEFNPSRHAVELAFAP
FT                   DSRHLALTIQPDSAQQEIAVIDTRDAKAKPVNVSLNGYRDGEPAWSQDGGILYWQSTKY
FT                   GVLGADGEPLGGSLLGLYSSRAAKSDFIAEQAPPKAGYGFEADRLAHREAIQLQPEGPI
FT                   LASRIVDDHLIYLVEVMDANGESEIKGYAQDLRKGETKLLFAEQPGPALASLNQDASLA
FT                   TLVREGEIALIDTRSGEASSHPFNLLITASWQDRMSAAFDQITRLTRDEFYRADMNGVD
FT                   WDGYVAAYRRLLPGISNDRDFGNLLAELAGELNVSHTWGSGPAPSLRMPDETASLGGYW
FT                   RERQGAVELDALLAGGPLEQETDLAPGARLLAVNGTELHSLNELDALLNHQAGQRLALT
FT                   VLPKGAKEPSQLEVTAIDLQQEYQLQLDGWIAKRRSQVEQLSQGRVGYVYLPEMSSAVY
FT                   EEVVADALGRQRNREALIVDVRFNKGGYLANTLVEFLTGSGSAQGMARSWPRLGKGETD
FT                   AATRQWTKPSVVLVNAGSYSEGSAFPQYYRTLKVGPIVGEPVPGTGTMVYAHTSRLIPG
FT                   LAYGIPTLGLRNPDGTLYENQELIPDVQVVLTPADMLAGRDPQLAAAVQAALAQLTTNA
FT                   KPAAK"
FT   gene            662465..662956
FT                   /locus_tag="AHA_0618"
FT   CDS_pept        662465..662956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0618"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38290"
FT                   /db_xref="GOA:A0KFX5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX5"
FT                   /protein_id="ABK38290.1"
FT                   /translation="MPRDGMRAVLLCLLGLWPALSFATLSADMVVVKKSSYSLTLMKDG
FT                   KEVKRYWIALGPAPKGHKQREGDQRTPEGRYILDYKKTNSNYYKAIHINYPNLDDIKAA
FT                   NEMGVRPGGMIMIHGQRNSIGNTRLQPSNWTNGCIAMLNKDLDEVWNAIEPGTPIVIQP
FT                   "
FT   gene            663105..663824
FT                   /locus_tag="AHA_0619"
FT   CDS_pept        663105..663824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0619"
FT                   /product="AzlC family protein"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39046"
FT                   /db_xref="GOA:A0KFX6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX6"
FT                   /protein_id="ABK39046.1"
FT                   /translation="MPSATCSRPVGAESTRALWWRASIDILPLSVSVIPWGILCGALAL
FT                   QVGLSPLQAQLMSLLVYAGAAQLSATTLFGAGTPLLPIMGSTFVITSQHLLYGFTFRRD
FT                   VLPLSLRWRASLAFFLTDEMFAVALKDRERSGRFDPAYALIAGFVFYLFWNAATLLGIA
FT                   AGQYIDGLDQMGLDFAIAATFIAMTIPAMKNLPMVAATLVSGAMALLTKPLLAEVYIII
FT                   SALSGMLVGYVLHRMRR"
FT   gene            664285..665811
FT                   /locus_tag="AHA_0620"
FT   CDS_pept        664285..665811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38585"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX7"
FT                   /protein_id="ABK38585.1"
FT                   /translation="MSFTETCQRIVRDPLLSPAQKSHALALAAENALPYPELPAEVSEA
FT                   MAKGFVCDMFEGHAPYKPRYVLPDYEKFLRQGSAWLELAPPQDFDEALDALRILYHHVP
FT                   SVTGMPVWLGRLDHLLLPFVGELDDEALYRKLKGFWIYLDRVLPDAFMHVNIGPDDNRL
FT                   CRLILRIDGDLKQVAPNLTLFHDPAQTPDSLLLQGVKNIAACSKPHIANYPLHRNTFDE
FT                   RGFGIVSCYNALPQAGGANTLVRVSLKRVAEQAHGIDDFLGCLLPHYCRLASRLIEARA
FT                   AFLHQESGFFDSFLVQEGLLEEDRFVPMFGIYGMAEAVNLLMDKENLPERYGRDEEANQ
FT                   LGYRISAQLARHVSEAPQVHAWGGRALLHSQGGLSVDRGVTPGVRIPYGEEPDPASHML
FT                   ALAPHHGFYHSGISEILTLDPTIRQNPQALLQLCKGALAIGMREFTANVADSDLVRVTG
FT                   YMIRKSDVARFATEGSRLQTTCLGAEASELTGIRQRAPRVVGREATLCDY"
FT   gene            665849..666700
FT                   /locus_tag="AHA_0621"
FT   CDS_pept        665849..666700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0621"
FT                   /product="pyruvate formate lyase activating enzyme"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38013"
FT                   /db_xref="GOA:A0KFX8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX8"
FT                   /protein_id="ABK38013.1"
FT                   /translation="MSRWLPFSCVDGPGNRLVLFLQGCNFACPGCHNPHTIGLCDHCGD
FT                   CVPGCPSGALTLHEGRVSWQAARCTDCDACLDLCPRSASPKTAAMTVAEVLALLRRYGP
FT                   LLSGITVSGGEATTQLPFVIALFTAIKGAADLAHLDCLLDSNGSLAEAGWQRLLPVLDG
FT                   AMIDLKGWGDSVHHMLAGYGRERVLASLQLLAQAGKLAEVRLLQVPGQSDYLVADGTLE
FT                   GGLAAFLRALGPVPIRLNGFRHHGVRGAAQGWPEATREELEQLAAALAVAGLGPVSLPP
FT                   LL"
FT   gene            666893..667216
FT                   /locus_tag="AHA_0622"
FT   CDS_pept        666893..667216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37548"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX9"
FT                   /protein_id="ABK37548.1"
FT                   /translation="MSESNALYRVQFICHNERYEVYVREVSQGQLFGFIEIANFVWDNH
FT                   TALIVDPSHEKLKSEFADVNRTMIPMHHVLRVDQVRKQGAARITELGNNVSPFPSPIYT
FT                   KKP"
FT   gene            complement(667259..668182)
FT                   /locus_tag="AHA_0623"
FT   CDS_pept        complement(667259..668182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0623"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37073"
FT                   /db_xref="GOA:A0KFY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY0"
FT                   /protein_id="ABK37073.1"
FT                   /translation="MDLIALSRLGGRHLVTLHLLLDSQSVTRTAERLCTTPSTVSKTLN
FT                   QLRDLLGDQLLYRQGNQLLLTPFAERLGPTLHRLLSELNGLTGQGGFDPASWQGQLTFA
FT                   LRESGMVWPMGPILAQLMREVPGLVPDIRNKDEQGLAALAAGKLDFVILPHDQSQPLPR
FT                   QQGLVWETLREDKLVCLLRADHPALARSWDLDAYLSWRHIAIRDQELANPFFEQSLAQL
FT                   QVRRQIAAILPDFGSAAALLRQSDLILTAIGGWAEQAAPHALVSRPVPFDYGAVTHSLV
FT                   WYGPAGEEPARRWFRQRILQLARELG"
FT   gene            complement(668243..669439)
FT                   /locus_tag="AHA_0624"
FT   CDS_pept        complement(668243..669439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0624"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37600"
FT                   /db_xref="GOA:A0KFY1"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY1"
FT                   /protein_id="ABK37600.1"
FT                   /translation="MFEHVDAYAGDPILTLVETFHKDTREQKVNLGIGLYYDEQGRIPL
FT                   LASVQQAEAQRAAAPAPRPYQPMEGAANYRTAVQHLLFGADHEAVKAGRIATIQTIGGS
FT                   GALKIGADLLKRYFPTSEVWVSNPTWDNHKAMFEGAGIKVHDYPYYDAATGGVQFDAMI
FT                   DCLSSLPAKSIVLLHPCCHNPTGVDLSRAQWDQVIALVVEKNLIPFMDIAYQGFGDGLE
FT                   EDAYAIRAMVAAGVSFFVSNSFSKNLSFYGERCGGLSVICQDAEEASRVLGQMKATVRR
FT                   NYSSPPTHGGQITAAVMNDASLHAMWVGEVTEMRTRIKAMREKLFEVLSAKVPGRDFSY
FT                   FINQRGMFSYTGFTPEQVDRLREEFAVYLVRSGRMCVAGLNSRNVDYVADAMAAVLKG"
FT   gene            complement(669609..669884)
FT                   /locus_tag="AHA_0625"
FT   CDS_pept        complement(669609..669884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36974"
FT                   /db_xref="GOA:A0KFY2"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY2"
FT                   /protein_id="ABK36974.1"
FT                   /translation="MSHTIHGKKKLLARVRRIKGQAGALESALEQESDCAAILQQIAAI
FT                   RGAVNGLMLEVLEGHMREHLGAEEATPAERLEDLDQVVRVLRSYLK"
FT   gene            669956..670915
FT                   /locus_tag="AHA_0626"
FT   CDS_pept        669956..670915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0626"
FT                   /product="heavy metal transporter"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35911"
FT                   /db_xref="GOA:A0KFY3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY3"
FT                   /protein_id="ABK35911.1"
FT                   /translation="MSSLASSHCHQPVVHEGNPLAEQKTRWAVLLTVIMMVAEIGGGWF
FT                   YNSMALLADGWHMSSHALALGLSVLAYRAARHFARDHRFSFGTWKIEVLGGFTSALLLV
FT                   GVAGMMLFESVFRLLDPSPIHYQQAIVIAIVGLLVNLACAWLLKDDHGHHHGHGHDHHH
FT                   DHHDHAHPHDHGQHHGHQDLNLRAAYIHVLADAATSVLAILALVGGMLWGADWLDPLMG
FT                   IVGAGLVAVWAWGLLRDSGRVLLDAEMDVPLVAEIREVIAELPDAEVRDLHVWRVGQQQ
FT                   YACVLSLLMAAPVAASEIRARLAIHEELVHVTIEVSAA"
FT   gene            complement(670979..671389)
FT                   /locus_tag="AHA_0627"
FT   CDS_pept        complement(670979..671389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35908"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY4"
FT                   /protein_id="ABK35908.1"
FT                   /translation="MKRIEEQARRLDQEYQEIAQLFDQFCQQAGTLAEQYHFFNWPDYE
FT                   DTPPLARAFTLLGEPRELRLRCQPGERGSLSGLIQVCGEEGTIHASLGFRADGHLLLES
FT                   GRLLDNPPELLLKLLLGAIWQHKPEDVQGQPH"
FT   gene            671620..675708
FT                   /locus_tag="AHA_0628"
FT   CDS_pept        671620..675708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0628"
FT                   /product="pullulanase"
FT                   /EC_number="3.2.1.41"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02103"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37551"
FT                   /db_xref="GOA:A0KFY5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="InterPro:IPR041111"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY5"
FT                   /protein_id="ABK37551.1"
FT                   /translation="MTGYSDIETNYSGNYKKMDMKKTKVALVTASLLALLSGCNDNSSS
FT                   PSTPDPTDGPVARLPNVQPPAEQLVAGPDQAVIALVDTQTSAARGVTGPFANYSLHLWN
FT                   NDACSATAESGLNAGWDDKVNTPAAADGFGPSWVVPLSKLEGCINFIARNGDLANLTGS
FT                   DMKVVFSDHPDRTVAIVAGKNEIFGSRAEAFTAAFGVAGASAHLIDGNTLIWQGGKDKP
FT                   HVRLYYTESGTIKANAEGVFDFPYITLAPTSLTAEQQAKYPHLKDAAAFALPAGKDLKP
FT                   LLKGELVAIGTDADGILQGATLVQSAGALDALYSEAATKLTYGAVVEGGNVTFRLWAPT
FT                   AKSVKLALFDGQHKPLGERTMTLDEASGSWSVQGGSELVGKFYRYDIQVYHPVSRKLES
FT                   YQVTDPYSLSLAMNSEFSQVVDLNDPALKPEGWDSLKAPHSQQNPADITIYEAHVRDLT
FT                   GNDDSTPAEHRGKFLGLTDTDTAPVKHLQALAKSGVSHLHLLPVFDIATVNEDPAKVAN
FT                   ISDDFGKLCQVNPEVQNSKFAGYCSSGQTIEAVLGDLQGSDSKENPQVQELYGYLRGVD
FT                   SFNWGYDPYHYTTPEGSYATNAEGSQRILEFREMVKAIKQNIGMNVVMDVVYNHTNEAG
FT                   LGPKSVLDKIVPWYYQRLNPETGSVENSTCCSNTAPEHAMFAKLMDDSLVTWARDYKID
FT                   AFRFDLMGHHPKDQMVQALAAVKQVNPEMYFYGEGWNFGEVQDDKRFVQATQKHLAGTG
FT                   IGSFSDRLRDAVRGGSPFDGGDTIRKTQGFGNGALVDANEMDGVDRATALHQADLVRLG
FT                   MAGNLKDFILTDKDGMPKKGSDIDYNGQPAGYAQDPTEIQNYVDKHDNQTLFDNLIYKA
FT                   PQGADLVRMQGVSLATAMLGQGIPFTHAGVELLRSKSMERDSYDSGDWYNRVDYTLADN
FT                   NFDKGLPRKDKDGDNYPLIEKVLGKHVKPSGADMATMVGFYQELAELRQSSRLLRLGSG
FT                   AEVIKRVDFRNTGPDQEPGLIVMTVDDGINAGADLDPAIDGLVVMINATNAPQSISDFR
FT                   DGNDQPIDLTSLQLSPAHHGGESIARDAAANGGTLTLGAWSAAVFVKPQSGAQGTGLPV
FT                   GKKTDLSTVPPFGDTAVYLKGFLNEWGNTNQMTFSSNFMYEFTTEVSSDKLGTTNVKIA
FT                   DASWGPLNYGSCNAGDKLVVGTPLTLCKGGDTGNIGLDLAKAGSYKFVFTAMNKDKPTL
FT                   SVSFTEPVQSCKVLDTVAGNPLGYNLFVKGELSGWAAQPQYQLSYKGMDGDLAIYQAAF
FT                   NYTGSTEFKVANEDWSKEYLLNGGGAVTAETGYAIGFSQPGSANNSITLPQGLWSVLVK
FT                   VDPAGTKAGTAVIQECSAK"
FT   gene            complement(675901..678399)
FT                   /locus_tag="AHA_0629"
FT   CDS_pept        complement(675901..678399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0629"
FT                   /product="lead, cadmium, zinc and mercury transporting
FT                   ATPase"
FT                   /EC_number="3.6.3.3"
FT                   /EC_number="3.6.3.5"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01512; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39804"
FT                   /db_xref="GOA:A0KFY6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY6"
FT                   /protein_id="ABK39804.1"
FT                   /translation="MDLTPRFTLGSVIEDLAPAGSIQEGLIMSKSCCSHQHAAAPIKAV
FT                   SKSAAPQAEHQHDSHCCDQAAPVSCCASQAPHDHQDHAASGAPEGEEPPRGGCCATPPP
FT                   AHARHAHDGEHDHHEHAVAAEPPLDAPEQNSRRHSWQVLGMDCPSCARKIETAVSRVSG
FT                   VQQARVLFATEKLVVDLAPGLSPDPVTAAVLAAGFQLKGERSGKQEPSRERGPLQTLLT
FT                   KYWQPLSLAGLMLVAALLPSQVGQPLFTLATLWGLWPISRKAWALTKSGSPFAIETLMT
FT                   VAAVGALFLGETAEAAMVLLLFMLGEHLEAYAAGRARAGVTALMALVPDKALRIRTTAE
FT                   GEVREEVAADQLRPGDIIEIAPGARLAADARLLDALGAFDESALTGESIPVERRQGDKV
FT                   PAGSLAADRVLRLEVVSEPGNNAIDRILHLIEEAETQRAPIERFIDRFSRWYTPAMMLV
FT                   ALLVVLVPPLAFGQSWDEWVYRGLALLLIGCPCALVISTPAAVTSALAAATRQGALIKG
FT                   GAALERLAHIDTVAFDKTGTLTLGKPQLTELVSLNGQPEAELLALAAAIEQGSHHPLAR
FT                   AVVTAASERGLSLAAAQALRALPGMGVEGRIDGTLWQLLAPSRVATLDAAMQARVATLE
FT                   QQGKTVVVLGQPDATPAALLALRDQIRPEAAAALQELNQLGLQSIMLTGDNPRAAEAIA
FT                   SELGMGWRAGLLPEGKVDEIAKLGLSQKVAMIGDGINDAPAMKRASIGIAMGGGTDVAL
FT                   ETADAALTHNQLGGVAAMIRLSRAALANIHQNIALALGLKAIFLVTSLLGITGLWIAVL
FT                   ADTGATALVTANALRLLRKR"
FT   gene            678536..679036
FT                   /locus_tag="AHA_0630"
FT   CDS_pept        678536..679036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0630"
FT                   /product="thiol peroxidase"
FT                   /EC_number="1.11.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36370"
FT                   /db_xref="GOA:A0KFY7"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY7"
FT                   /protein_id="ABK36370.1"
FT                   /translation="MSNSVTLQGNPVSVAGHFPVAGEQAKPFSLVAKDLSDLTLVSFAG
FT                   QRKILNIFPSVDTPTCATSVRKFNEQASALNNAVVLCISADLPFAQSRFCGAEGLDKVV
FT                   TLSTLRGAAFLQDYGVAFSSGPLVGLAARAIVVLDEENKVLHSELVAEVADEPNYATAL
FT                   AVL"
FT   gene            complement(679099..679917)
FT                   /locus_tag="AHA_0631"
FT   CDS_pept        complement(679099..679917)
F