(data stored in ACNUC7421 zone)

EMBL: CP000471

ID   CP000471; SV 1; circular; genomic DNA; STD; PRO; 4719581 BP.
XX
AC   CP000471; AAAN03000000-AAAN03000108;
XX
PR   Project:PRJNA262;
XX
DT   09-NOV-2006 (Rel. 89, Created)
DT   09-SEP-2019 (Rel. 142, Last updated, Version 9)
XX
DE   Magnetococcus marinus MC-1, complete genome.
XX
KW   .
XX
OS   Magnetococcus marinus MC-1
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Magnetococcales;
OC   Magnetococcaceae; Magnetococcus.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-4719581
RX   PUBMED; 22581902.
RA   Bazylinski D.A., Williams T.J., Lefevre C.T., Berg R.J., Zhang C.L.,
RA   Bowser S.S., Dean A.J., Beveridge T.J.;
RT   "Magnetococcus marinus gen. nov., sp. nov., a marine, magnetotactic
RT   bacterium that represents a novel lineage (Magnetococcaceae fam. nov.;
RT   Magnetococcales ord. nov.) at the base of the Alphaproteobacteria";
RL   Int. J. Syst. Evol. Microbiol. 0:0(2012).
XX
RN   [2]
RP   1-4719581
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Goodwin L.A., Brettin T., Bruce D., Han C., Tapia R., Gilna P.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Richardson P.;
RT   "Complete sequence of Magnetococcus sp. MC-1";
RL   Unpublished.
XX
RN   [3]
RP   1-4719581
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Goodwin L.A., Brettin T., Bruce D., Han C., Tapia R., Gilna P.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Richardson P.;
RT   ;
RL   Submitted (20-SEP-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1a237f6382973ea631eae4dc5c87ce4d.
DR   BioSample; SAMN02598452.
DR   EnsemblGenomes-Gn; EBG00001139787.
DR   EnsemblGenomes-Gn; EBG00001139788.
DR   EnsemblGenomes-Gn; EBG00001139789.
DR   EnsemblGenomes-Gn; EBG00001139790.
DR   EnsemblGenomes-Gn; EBG00001139791.
DR   EnsemblGenomes-Gn; EBG00001139792.
DR   EnsemblGenomes-Gn; EBG00001139793.
DR   EnsemblGenomes-Gn; EBG00001139794.
DR   EnsemblGenomes-Gn; EBG00001139795.
DR   EnsemblGenomes-Gn; EBG00001139796.
DR   EnsemblGenomes-Gn; EBG00001139797.
DR   EnsemblGenomes-Gn; EBG00001139798.
DR   EnsemblGenomes-Gn; EBG00001139799.
DR   EnsemblGenomes-Gn; EBG00001139800.
DR   EnsemblGenomes-Gn; EBG00001139801.
DR   EnsemblGenomes-Gn; EBG00001139802.
DR   EnsemblGenomes-Gn; EBG00001139803.
DR   EnsemblGenomes-Gn; EBG00001139804.
DR   EnsemblGenomes-Gn; EBG00001139805.
DR   EnsemblGenomes-Gn; EBG00001139806.
DR   EnsemblGenomes-Gn; EBG00001139807.
DR   EnsemblGenomes-Gn; EBG00001139808.
DR   EnsemblGenomes-Gn; EBG00001139809.
DR   EnsemblGenomes-Gn; EBG00001139810.
DR   EnsemblGenomes-Gn; EBG00001139811.
DR   EnsemblGenomes-Gn; EBG00001139812.
DR   EnsemblGenomes-Gn; EBG00001139813.
DR   EnsemblGenomes-Gn; EBG00001139814.
DR   EnsemblGenomes-Gn; EBG00001139815.
DR   EnsemblGenomes-Gn; EBG00001139816.
DR   EnsemblGenomes-Gn; EBG00001139817.
DR   EnsemblGenomes-Gn; EBG00001139818.
DR   EnsemblGenomes-Gn; EBG00001139819.
DR   EnsemblGenomes-Gn; EBG00001139820.
DR   EnsemblGenomes-Gn; EBG00001139821.
DR   EnsemblGenomes-Gn; EBG00001139822.
DR   EnsemblGenomes-Gn; EBG00001139823.
DR   EnsemblGenomes-Gn; EBG00001139824.
DR   EnsemblGenomes-Gn; EBG00001139825.
DR   EnsemblGenomes-Gn; EBG00001139826.
DR   EnsemblGenomes-Gn; EBG00001139827.
DR   EnsemblGenomes-Gn; EBG00001139828.
DR   EnsemblGenomes-Gn; EBG00001139829.
DR   EnsemblGenomes-Gn; EBG00001139830.
DR   EnsemblGenomes-Gn; EBG00001139831.
DR   EnsemblGenomes-Gn; EBG00001139832.
DR   EnsemblGenomes-Gn; EBG00001139833.
DR   EnsemblGenomes-Gn; EBG00001139834.
DR   EnsemblGenomes-Gn; EBG00001139835.
DR   EnsemblGenomes-Gn; EBG00001139836.
DR   EnsemblGenomes-Gn; EBG00001139837.
DR   EnsemblGenomes-Gn; EBG00001139838.
DR   EnsemblGenomes-Gn; EBG00001139839.
DR   EnsemblGenomes-Gn; EBG00001139840.
DR   EnsemblGenomes-Gn; EBG00001139841.
DR   EnsemblGenomes-Gn; EBG00001139842.
DR   EnsemblGenomes-Gn; EBG00001139843.
DR   EnsemblGenomes-Gn; EBG00001139844.
DR   EnsemblGenomes-Gn; EBG00001139845.
DR   EnsemblGenomes-Gn; EBG00001139846.
DR   EnsemblGenomes-Gn; EBG00001139847.
DR   EnsemblGenomes-Gn; EBG00001139848.
DR   EnsemblGenomes-Gn; EBG00001139849.
DR   EnsemblGenomes-Gn; EBG00001139850.
DR   EnsemblGenomes-Gn; EBG00001139851.
DR   EnsemblGenomes-Gn; EBG00001139852.
DR   EnsemblGenomes-Gn; EBG00001139853.
DR   EnsemblGenomes-Gn; EBG00001139854.
DR   EnsemblGenomes-Gn; EBG00001139855.
DR   EnsemblGenomes-Gn; EBG00001139856.
DR   EnsemblGenomes-Gn; EBG00001139857.
DR   EnsemblGenomes-Gn; EBG00001139858.
DR   EnsemblGenomes-Gn; EBG00001139859.
DR   EnsemblGenomes-Gn; EBG00001139860.
DR   EnsemblGenomes-Gn; Mmc1_R0001.
DR   EnsemblGenomes-Gn; Mmc1_R0002.
DR   EnsemblGenomes-Gn; Mmc1_R0003.
DR   EnsemblGenomes-Gn; Mmc1_R0004.
DR   EnsemblGenomes-Gn; Mmc1_R0005.
DR   EnsemblGenomes-Gn; Mmc1_R0006.
DR   EnsemblGenomes-Gn; Mmc1_R0008.
DR   EnsemblGenomes-Gn; Mmc1_R0009.
DR   EnsemblGenomes-Gn; Mmc1_R0010.
DR   EnsemblGenomes-Gn; Mmc1_R0011.
DR   EnsemblGenomes-Gn; Mmc1_R0012.
DR   EnsemblGenomes-Gn; Mmc1_R0013.
DR   EnsemblGenomes-Gn; Mmc1_R0014.
DR   EnsemblGenomes-Gn; Mmc1_R0015.
DR   EnsemblGenomes-Gn; Mmc1_R0016.
DR   EnsemblGenomes-Gn; Mmc1_R0017.
DR   EnsemblGenomes-Gn; Mmc1_R0018.
DR   EnsemblGenomes-Gn; Mmc1_R0019.
DR   EnsemblGenomes-Gn; Mmc1_R0021.
DR   EnsemblGenomes-Gn; Mmc1_R0022.
DR   EnsemblGenomes-Gn; Mmc1_R0023.
DR   EnsemblGenomes-Gn; Mmc1_R0024.
DR   EnsemblGenomes-Gn; Mmc1_R0025.
DR   EnsemblGenomes-Gn; Mmc1_R0026.
DR   EnsemblGenomes-Gn; Mmc1_R0027.
DR   EnsemblGenomes-Gn; Mmc1_R0028.
DR   EnsemblGenomes-Gn; Mmc1_R0029.
DR   EnsemblGenomes-Gn; Mmc1_R0030.
DR   EnsemblGenomes-Gn; Mmc1_R0031.
DR   EnsemblGenomes-Gn; Mmc1_R0032.
DR   EnsemblGenomes-Gn; Mmc1_R0033.
DR   EnsemblGenomes-Gn; Mmc1_R0034.
DR   EnsemblGenomes-Gn; Mmc1_R0035.
DR   EnsemblGenomes-Gn; Mmc1_R0036.
DR   EnsemblGenomes-Gn; Mmc1_R0037.
DR   EnsemblGenomes-Gn; Mmc1_R0038.
DR   EnsemblGenomes-Gn; Mmc1_R0039.
DR   EnsemblGenomes-Gn; Mmc1_R0040.
DR   EnsemblGenomes-Gn; Mmc1_R0041.
DR   EnsemblGenomes-Gn; Mmc1_R0042.
DR   EnsemblGenomes-Gn; Mmc1_R0043.
DR   EnsemblGenomes-Gn; Mmc1_R0044.
DR   EnsemblGenomes-Gn; Mmc1_R0045.
DR   EnsemblGenomes-Gn; Mmc1_R0046.
DR   EnsemblGenomes-Gn; Mmc1_R0047.
DR   EnsemblGenomes-Gn; Mmc1_R0048.
DR   EnsemblGenomes-Gn; Mmc1_R0049.
DR   EnsemblGenomes-Gn; Mmc1_R0050.
DR   EnsemblGenomes-Gn; Mmc1_R0051.
DR   EnsemblGenomes-Gn; Mmc1_R0052.
DR   EnsemblGenomes-Gn; Mmc1_R0053.
DR   EnsemblGenomes-Gn; Mmc1_R0054.
DR   EnsemblGenomes-Gn; Mmc1_R0055.
DR   EnsemblGenomes-Gn; Mmc1_R0056.
DR   EnsemblGenomes-Gn; Mmc1_R0057.
DR   EnsemblGenomes-Tr; EBT00001556514.
DR   EnsemblGenomes-Tr; EBT00001556515.
DR   EnsemblGenomes-Tr; EBT00001556516.
DR   EnsemblGenomes-Tr; EBT00001556517.
DR   EnsemblGenomes-Tr; EBT00001556518.
DR   EnsemblGenomes-Tr; EBT00001556519.
DR   EnsemblGenomes-Tr; EBT00001556520.
DR   EnsemblGenomes-Tr; EBT00001556521.
DR   EnsemblGenomes-Tr; EBT00001556522.
DR   EnsemblGenomes-Tr; EBT00001556523.
DR   EnsemblGenomes-Tr; EBT00001556524.
DR   EnsemblGenomes-Tr; EBT00001556525.
DR   EnsemblGenomes-Tr; EBT00001556526.
DR   EnsemblGenomes-Tr; EBT00001556527.
DR   EnsemblGenomes-Tr; EBT00001556528.
DR   EnsemblGenomes-Tr; EBT00001556529.
DR   EnsemblGenomes-Tr; EBT00001556530.
DR   EnsemblGenomes-Tr; EBT00001556531.
DR   EnsemblGenomes-Tr; EBT00001556532.
DR   EnsemblGenomes-Tr; EBT00001556533.
DR   EnsemblGenomes-Tr; EBT00001556534.
DR   EnsemblGenomes-Tr; EBT00001556535.
DR   EnsemblGenomes-Tr; EBT00001556536.
DR   EnsemblGenomes-Tr; EBT00001556537.
DR   EnsemblGenomes-Tr; EBT00001556538.
DR   EnsemblGenomes-Tr; EBT00001556539.
DR   EnsemblGenomes-Tr; EBT00001556540.
DR   EnsemblGenomes-Tr; EBT00001556541.
DR   EnsemblGenomes-Tr; EBT00001556542.
DR   EnsemblGenomes-Tr; EBT00001556543.
DR   EnsemblGenomes-Tr; EBT00001556544.
DR   EnsemblGenomes-Tr; EBT00001556545.
DR   EnsemblGenomes-Tr; EBT00001556546.
DR   EnsemblGenomes-Tr; EBT00001556547.
DR   EnsemblGenomes-Tr; EBT00001556548.
DR   EnsemblGenomes-Tr; EBT00001556549.
DR   EnsemblGenomes-Tr; EBT00001556550.
DR   EnsemblGenomes-Tr; EBT00001556551.
DR   EnsemblGenomes-Tr; EBT00001556552.
DR   EnsemblGenomes-Tr; EBT00001556553.
DR   EnsemblGenomes-Tr; EBT00001556554.
DR   EnsemblGenomes-Tr; EBT00001556555.
DR   EnsemblGenomes-Tr; EBT00001556556.
DR   EnsemblGenomes-Tr; EBT00001556557.
DR   EnsemblGenomes-Tr; EBT00001556558.
DR   EnsemblGenomes-Tr; EBT00001556559.
DR   EnsemblGenomes-Tr; EBT00001556560.
DR   EnsemblGenomes-Tr; EBT00001556561.
DR   EnsemblGenomes-Tr; EBT00001556562.
DR   EnsemblGenomes-Tr; EBT00001556563.
DR   EnsemblGenomes-Tr; EBT00001556564.
DR   EnsemblGenomes-Tr; EBT00001556565.
DR   EnsemblGenomes-Tr; EBT00001556566.
DR   EnsemblGenomes-Tr; EBT00001556567.
DR   EnsemblGenomes-Tr; EBT00001556568.
DR   EnsemblGenomes-Tr; EBT00001556569.
DR   EnsemblGenomes-Tr; EBT00001556570.
DR   EnsemblGenomes-Tr; EBT00001556571.
DR   EnsemblGenomes-Tr; EBT00001556572.
DR   EnsemblGenomes-Tr; EBT00001556573.
DR   EnsemblGenomes-Tr; EBT00001556574.
DR   EnsemblGenomes-Tr; EBT00001556575.
DR   EnsemblGenomes-Tr; EBT00001556576.
DR   EnsemblGenomes-Tr; EBT00001556577.
DR   EnsemblGenomes-Tr; EBT00001556578.
DR   EnsemblGenomes-Tr; EBT00001556579.
DR   EnsemblGenomes-Tr; EBT00001556580.
DR   EnsemblGenomes-Tr; EBT00001556581.
DR   EnsemblGenomes-Tr; EBT00001556582.
DR   EnsemblGenomes-Tr; EBT00001556583.
DR   EnsemblGenomes-Tr; EBT00001556584.
DR   EnsemblGenomes-Tr; EBT00001556585.
DR   EnsemblGenomes-Tr; EBT00001556586.
DR   EnsemblGenomes-Tr; EBT00001556587.
DR   EnsemblGenomes-Tr; Mmc1_R0001-1.
DR   EnsemblGenomes-Tr; Mmc1_R0002-1.
DR   EnsemblGenomes-Tr; Mmc1_R0003-1.
DR   EnsemblGenomes-Tr; Mmc1_R0004-1.
DR   EnsemblGenomes-Tr; Mmc1_R0005-1.
DR   EnsemblGenomes-Tr; Mmc1_R0006-1.
DR   EnsemblGenomes-Tr; Mmc1_R0008-1.
DR   EnsemblGenomes-Tr; Mmc1_R0009-1.
DR   EnsemblGenomes-Tr; Mmc1_R0010-1.
DR   EnsemblGenomes-Tr; Mmc1_R0011-1.
DR   EnsemblGenomes-Tr; Mmc1_R0012-1.
DR   EnsemblGenomes-Tr; Mmc1_R0013-1.
DR   EnsemblGenomes-Tr; Mmc1_R0014-1.
DR   EnsemblGenomes-Tr; Mmc1_R0015-1.
DR   EnsemblGenomes-Tr; Mmc1_R0016-1.
DR   EnsemblGenomes-Tr; Mmc1_R0017-1.
DR   EnsemblGenomes-Tr; Mmc1_R0018-1.
DR   EnsemblGenomes-Tr; Mmc1_R0019-1.
DR   EnsemblGenomes-Tr; Mmc1_R0021-1.
DR   EnsemblGenomes-Tr; Mmc1_R0022-1.
DR   EnsemblGenomes-Tr; Mmc1_R0023-1.
DR   EnsemblGenomes-Tr; Mmc1_R0024-1.
DR   EnsemblGenomes-Tr; Mmc1_R0025-1.
DR   EnsemblGenomes-Tr; Mmc1_R0026-1.
DR   EnsemblGenomes-Tr; Mmc1_R0027-1.
DR   EnsemblGenomes-Tr; Mmc1_R0028-1.
DR   EnsemblGenomes-Tr; Mmc1_R0029-1.
DR   EnsemblGenomes-Tr; Mmc1_R0030-1.
DR   EnsemblGenomes-Tr; Mmc1_R0031-1.
DR   EnsemblGenomes-Tr; Mmc1_R0032-1.
DR   EnsemblGenomes-Tr; Mmc1_R0033-1.
DR   EnsemblGenomes-Tr; Mmc1_R0034-1.
DR   EnsemblGenomes-Tr; Mmc1_R0035-1.
DR   EnsemblGenomes-Tr; Mmc1_R0036-1.
DR   EnsemblGenomes-Tr; Mmc1_R0037-1.
DR   EnsemblGenomes-Tr; Mmc1_R0038-1.
DR   EnsemblGenomes-Tr; Mmc1_R0039-1.
DR   EnsemblGenomes-Tr; Mmc1_R0040-1.
DR   EnsemblGenomes-Tr; Mmc1_R0041-1.
DR   EnsemblGenomes-Tr; Mmc1_R0042-1.
DR   EnsemblGenomes-Tr; Mmc1_R0043-1.
DR   EnsemblGenomes-Tr; Mmc1_R0044-1.
DR   EnsemblGenomes-Tr; Mmc1_R0045-1.
DR   EnsemblGenomes-Tr; Mmc1_R0046-1.
DR   EnsemblGenomes-Tr; Mmc1_R0047-1.
DR   EnsemblGenomes-Tr; Mmc1_R0048-1.
DR   EnsemblGenomes-Tr; Mmc1_R0049-1.
DR   EnsemblGenomes-Tr; Mmc1_R0050-1.
DR   EnsemblGenomes-Tr; Mmc1_R0051-1.
DR   EnsemblGenomes-Tr; Mmc1_R0052-1.
DR   EnsemblGenomes-Tr; Mmc1_R0053-1.
DR   EnsemblGenomes-Tr; Mmc1_R0054-1.
DR   EnsemblGenomes-Tr; Mmc1_R0055-1.
DR   EnsemblGenomes-Tr; Mmc1_R0056-1.
DR   EnsemblGenomes-Tr; Mmc1_R0057-1.
DR   EuropePMC; PMC2708431; 19465526.
DR   EuropePMC; PMC3430331; 22730130.
DR   EuropePMC; PMC3754751; 23893106.
DR   EuropePMC; PMC3934378; 24616719.
DR   EuropePMC; PMC3971196; 24723915.
DR   EuropePMC; PMC4065386; 24915802.
DR   EuropePMC; PMC4097590; 24794567.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP000471.
DR   SILVA-SSU; CP000471.
DR   StrainInfo; 885174; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351493
CC   Source DNA and bacteria available from Dennis Bazylinski
CC   (dbazylin@iastate.edu)
CC   Contacts: Dennis Bazylinski (dbazylin@iastate.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4719581
FT                   /organism="Magnetococcus marinus MC-1"
FT                   /strain="MC-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:156889"
FT                   /type_material="type strain of Magnetococcus marinus"
FT   gene            181..1524
FT                   /locus_tag="Mmc1_0001"
FT   CDS_pept        181..1524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: pca:Pcar_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42530"
FT                   /db_xref="GOA:A0L3I7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3I7"
FT                   /protein_id="ABK42530.1"
FT                   /translation="MQDFWSKAMDAVAEQVSVQVFEAWIRPLKAGGEVGDGQFQVYAAN
FT                   DFSADWVKKRYGGLLEEILSEQLGEPVTLLFAADPALEKPVASKTQTVTPVQSGGETGD
FT                   QENFHSGLDPRYTFDSFVVGGCNQFVHAAAARVAEAPAAAYNPLFIHGGVGLGKTHVMQ
FT                   AIGNRVLEIDPDKRVLYISSENFMTQLINSLRFKRVFDFKENFRSVDVLLVDDIQFIAG
FT                   KKATQEEFFHTFNALYEAKKQIVMTADSFPHEIEHLEERLRSRFGMGLVADMQPPDLET
FT                   RVAILQKKAGSEGLRLADEVAFFLADAVQTNVRELEGALIRVSAYASLTGKPITMALVK
FT                   ESLKDIVRGQDRAVTVEQIQKTVANYYKVKVTDLCSNSRSRIYSHPRQIAMYLCKQLTQ
FT                   HSYPEIGHRFGGRDHTTVLYAVSQVDKKQGSTPALADELASLKSMLQK"
FT   gene            1570..2700
FT                   /locus_tag="Mmc1_0002"
FT   CDS_pept        1570..2700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gsu:GSU0001 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42531"
FT                   /db_xref="GOA:A0L3I8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3I8"
FT                   /protein_id="ABK42531.1"
FT                   /translation="MEFHVSREPFLKALQRLQSVVEKRNTMPELGNALLEASAEGLTLT
FT                   ATDLEVSMKSHCPAEVESSGAIAVSARKLFEIVRELPQDSLRLRSEAGERLVLTCGRAR
FT                   FTLVGIRADIFPPFPETTQGQSFTLSGPRLAEMIAKTHFAMSQDETRYTLNGILLHLVS
FT                   AADAELAGENGLVRIVATDTHRLAMAEMALDIPVEESAELIIPRKGVQEIRKLVEEDDE
FT                   AVELGLDENFIRVSKPGIVLTSKLVSGRFPNYQRVIPTDNPHLLELEKEPLFGVVKRMM
FT                   VLSHEKSRGIRMALSSDHIKVSAQNPEQEAAEEEMPCSFAGKDMTVGFNARYLQEIVSV
FT                   ANGDTVRMKLRDEESPVLVEEHSATGYLYVLMPMRV"
FT   gene            2711..3859
FT                   /locus_tag="Mmc1_0003"
FT   CDS_pept        2711..3859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gsu:GSU0002 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42532"
FT                   /db_xref="GOA:A0L3I9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3I9"
FT                   /protein_id="ABK42532.1"
FT                   /translation="MQLDRLTLRDFRNITEAELRFGPGLNLITGPNGHGKSNLLEAIGL
FT                   LATGRSFRRAPAAALRRYGQPWFHLRGETTARDLGHRLEFFGQAGRQAVKINGKSASAA
FT                   SALGQALAAVIVTPDTLRLVQDGPGVRRGFVDWVAFTCGRQQGALSHAVVAGDYQKALK
FT                   ARNRLLKLPRVEAGEWLAWESQLATLGAKMARNRYQVLQRLQPHLDRMLEDLGMAQRLT
FT                   ITLSCQLDRHGTHWAEDESAAASLYRRLLAENRASERRSGGTAIGPHRDDLVLRLDGHA
FT                   LAQFGSQGQQKRAALALKLAEAQLLQEQLGEWPLFVLDDPAAELDTDGMSRLMGLLARC
FT                   GGQIFVASCRAQTIPWSGLAPQRFYVDQGVFALTEEIPLESL"
FT   gene            3859..5223
FT                   /locus_tag="Mmc1_0004"
FT   CDS_pept        3859..5223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0004"
FT                   /product="ATP binding protein"
FT                   /note="KEGG: psp:PSPPH_1028 ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42533"
FT                   /db_xref="GOA:A0L3J0"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J0"
FT                   /protein_id="ABK42533.1"
FT                   /translation="MKLNTLTLSNFRCFESLEITFDDYLTVLVAQNGGGKTAILDAIGV
FT                   ALGPYLGAFDEAVGSHFSPEDVRTKPSHTQPSMESLYPLTLVAHGVAEGQEIHWERALK
FT                   GKKSKTTVAGAKNLVLVAKNQQVRIRQGISVDLPLLAYYGTGRLWRNIRVTTSTKQGWG
FT                   SRTLGYTNALSPASSFNSFERWFQDTDRAHYDYQLEHSDGPTNYGGANAFLASPERDNP
FT                   FGQALDAVRGAVDLALESVQWGTLRYSGTHRRIVVSHPAHGILPVHLLSDGIRNMIGLV
FT                   ADMAYRAVRLNPHLGVEAAQRVEGVVLIDEVDMHLHPAWQQVVLTDLRKAFPKVQFVVT
FT                   THSPQVLTTVKRENIRVLEIENGRGTARPPLTQTLGRDNRETIEDVMQVDARPPIEPTT
FT                   QLKHYLDMVGQGNGDTIEALNLRAILEQIYGKDYTKLRVADCAIHKYRAMRAQSK"
FT   gene            5220..5909
FT                   /locus_tag="Mmc1_0005"
FT   CDS_pept        5220..5909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_1029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42534"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J1"
FT                   /protein_id="ABK42534.1"
FT                   /translation="MRHVKHTASLTKLDRAKTKDPCPTDPAKAWRGFKHKDDVAKQLKL
FT                   LQDGLCAYCQVSLDTELGYHIDHIQPKGPNPKQTFVWHNLVLSCIASGSQGAVSGKLSC
FT                   GHAKGNQALPKDMDPTHPDCESLFTYTLSGKVEPNPDRPPEQVEDIKKAIELLNLNNKR
FT                   LVRERAEMLHEGYLCLKDLNGSAVAHFLDLELGKTNGKHRAFITARKLHFQDWPHVEPI
FT                   DNTLEER"
FT   gene            5916..8354
FT                   /locus_tag="Mmc1_0006"
FT   CDS_pept        5916..8354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: vvy:VV0014 DNA gyrase, subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42535"
FT                   /db_xref="GOA:A0L3J2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J2"
FT                   /protein_id="ABK42535.1"
FT                   /translation="MTTENAPEAQHDHSTYDSTNIKVLKGLDAVRKRPGMYIGDTDDGT
FT                   GLHHMVFEVVDNAIDEALAGHCDRVEVILHTDGSCSVSDNGRGIPTDMHKEEGRSAAEV
FT                   IMTVLHAGGKFDDNSYKISGGLHGVGVSVVNALSETLELTIKRGGKVCHQTYHLGEPTA
FT                   PLAVIGDTPDSGTTVRFKPSPLIFHNVLEFSFDTLSQRLRELSFLNDGVRIFIHDERDD
FT                   KSHNFFYEGGIRSFVEYLNKARTPLMPPIHFRDERNGITAEVALQWNDSYQENVYCFTN
FT                   NIPQRDGGTHLAGFRGALTRTINNYASANNLLKKEKVTISGDDCREGLTAVISVKVPDP
FT                   KFSSQTKDKLVSSEVRPVVESVIGESLGTFFEEHPAEAKAIIAKSVEAANAREAARKAR
FT                   ELTRRKSALEISSLPGKLADCQERDPAKCELYLVEGDSAGGSAKQARDRKHQAVLPLKG
FT                   KILNVEKARFDKMISSQEVGTLITALGTGIGREEYNIEKLRYHHIIIMTDADVDGAHIR
FT                   TLLLTFFYRQMPEIVKRGHLYIAQPPLYRVSKGKQEQYLKDDDALNQLLMNYGLHGVEG
FT                   RNGSKVLDEAALSVLVRDAARYRKMLDRLGRHHDALALDIAASALHIDEAILKDSAAAG
FT                   ALIAPFTEMLQARGGEEERLQVSLLHDPETSSWVILVERAVHGMLQFTRLNLAMVHSAE
FT                   YKAMLAIAKRYQEEMGDEGQLVKNEKSSPAGRVADFLQLVLDEGRRGLTIQRYKGLGEM
FT                   NPDQLWETTMDPSVRTLLQVRVDDEVGANEVFTTLMGDVVEPRRDFIQENALNVTNLDV
FT                   "
FT   gene            complement(8555..9178)
FT                   /locus_tag="Mmc1_0007"
FT   CDS_pept        complement(8555..9178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42536"
FT                   /db_xref="GOA:A0L3J3"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J3"
FT                   /protein_id="ABK42536.1"
FT                   /translation="MMSKKERKEKIAQAFEKRMAQLDRIKNAVLNQHLEQKALAFMSKT
FT                   VVAKLHQTRVDLYAAERFKLLTRVIKDESKAQRQKRAQEQFRMRCKAFDAQNLWSEPDP
FT                   LEAQQRAEVEQTLQRKAEKRLILKRRMLAPLVPAIIFFIATASIWATGELRELGNTLKK
FT                   SPFQFEMWEEDHPIMGEVVRFIYEEKSKNREKWNNVNQFVKNLK"
FT   gene            complement(9638..10243)
FT                   /locus_tag="Mmc1_0008"
FT   CDS_pept        complement(9638..10243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42537"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J4"
FT                   /protein_id="ABK42537.1"
FT                   /translation="MRHLAFAALLLLLAAPLQAAQPSEHAPAMVKMARQAVKDAKSALL
FT                   QTNHDAMTFATDVEALHARINHLEMRYTELLKEVTTKRAAFTLLEEELRAADLTLKDME
FT                   KPMREAKEQYRKAQLMSLEYPEVSTEKERKAYYDVQKLVSQQTKGQLQGLAVLKNRLTL
FT                   AYESLESAEQALERTRHEAEQLRSQLAEANGVIRPVAD"
FT   sig_peptide     complement(10184..10243)
FT                   /locus_tag="Mmc1_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.716 at
FT                   residue 20"
FT   gene            10453..10722
FT                   /locus_tag="Mmc1_0009"
FT   CDS_pept        10453..10722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0009"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ, family 3; KEGG: yps:YPTB1692 flagellar
FT                   biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42538"
FT                   /db_xref="GOA:A0L3J5"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J5"
FT                   /protein_id="ABK42538.1"
FT                   /translation="MTADTVQNLVVEALRLALLISAPMLLTALVVGITISLLQAVTQIQ
FT                   EMTLTFIPKILATFLALMLTLPWMIQKLTDYFRHLFDTIPTLIS"
FT   gene            10733..11533
FT                   /locus_tag="Mmc1_0010"
FT   CDS_pept        10733..11533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0010"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; KEGG:
FT                   cvi:CV3124 flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42539"
FT                   /db_xref="GOA:A0L3J6"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J6"
FT                   /protein_id="ABK42539.1"
FT                   /translation="MDPAAMMDFFGFTIGEVERMVLIMSRLSGLFLAAPFFSRNVGPKR
FT                   IRVILLLWITIVIYPIVPPWPGEGNGEVIRMVFTGVVEFSMGIMIGMIAHWVLVSVQIA
FT                   GTMIGFEMGLSMAMVMDPTSGVQEGVLANLLYLFGLMLFLLLNGHHWLLEGLARSFVSM
FT                   PLGSPLPHGEPMITIVLQGIVHMFELALLLAAPVVAAAKLLYLGMGLINRASPQIQVFF
FT                   LAMPVAQLMGFLIMGLTLSIFGQRLTREMELFINLAFRVVGLTP"
FT   gene            11564..12631
FT                   /locus_tag="Mmc1_0011"
FT   CDS_pept        11564..12631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0011"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: sat:SYN_02832 flagellar
FT                   biosynthesis pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42540"
FT                   /db_xref="GOA:A0L3J7"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J7"
FT                   /protein_id="ABK42540.1"
FT                   /translation="MADEDKDSKTEEPTSKRLSDSRNKGQVVSSKEVPTALLMLAALAV
FT                   FLVQGNELWQALQRKMHFFLSGQISDDITPTGVSLIFNEIIRAVVMDLAPFFALFLVVA
FT                   IISGLIQHGWLITFEPLMPKFSKVNPLQGLKRLFSVRSLVEAFKSIVKIFVISFAVYLA
FT                   MRNNIDQILGLADTTITEFTTLMFKDSLEILWRVTLAFLLIAVLDFIYQKFDYIKGLRM
FT                   SKQEIKDEMKQMEGDPLLKGRIRQIQRELAQSRMMQEVPKADVIITNPTHYACALQYTP
FT                   GQMSAPKLVAKGKGLIAARIRELADENNIPRVENPPLARTLYRDVELEQFIPPELFKAV
FT                   AEVLAYVFSLKNRRS"
FT   gene            12800..13252
FT                   /locus_tag="Mmc1_0012"
FT   CDS_pept        12800..13252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0012"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: sde:Sde_1289
FT                   RecX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42541"
FT                   /db_xref="GOA:A0L3J8"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3J8"
FT                   /protein_id="ABK42541.1"
FT                   /translation="MTEIELYEQALRWLGRREYGEMELRNRLRTLPEVSLELVNKVVER
FT                   LLAMDYLSDVRFAEALVRDRTRRGQGSLRIRHELQQKGVPALIIESSLAELAPNDTAQE
FT                   NAHRALVKRFGPTPPEDLKARKKRHDFLTRRGFDGQTIRMVLEALG"
FT   gene            13357..15993
FT                   /locus_tag="Mmc1_0013"
FT   CDS_pept        13357..15993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0013"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: nha:Nham_1621 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: alanyl-tRNA synthetase, class
FT                   IIc; phosphoesterase, DHHA1; Threonyl/alanyl tRNA
FT                   synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42542"
FT                   /db_xref="GOA:A0L3J9"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3J9"
FT                   /protein_id="ABK42542.1"
FT                   /translation="MNGNEIRKRFVAFFQQHGHTHVESSSLVPRNDPTLLFTNAGMVQF
FT                   KSLFLGEERRDYSRAVSAQKCVRAGGKHNDLENVGRTARHHTFFEMLGNFSFGDYFKEE
FT                   AIRLGWRFVTEDLGIDAQRLLVTVYSEDDEAYAIWTQQIGLPADKVIRIPTTDNFWSMG
FT                   DTGPCGPCSEIFYDYGDTVAGGPPGSEDEDGDRFVEIWNLVFMQYDRSSDGTLTPLPKP
FT                   SIDTGAGLERLASVLQGKTNNYDTDLFQPLIKAAAALAGVDDTTCSAEQLVSLRVIADH
FT                   IRSVSFLIADGVLPSNEGRGYVLRRIMRRGMRHGRLLGLEQPFMHKLVETLGALMGDTY
FT                   PELTAQRKTLAMVIETEEKRFAATLGTGLKHLEEAVAGLRMGDVLDGKTLFTLYDTFGF
FT                   PLDLTADILRDREIGVDQEGFSACMKEQRERARAAWSGSGEASLGALYHPLLERVGASE
FT                   FLGYVHESASASVVALIKNGAEVESLTAGDEGSVVCNQTPFYGESGGQVGDRGVIQLAN
FT                   GARFTVTDTQKPLPDLIVHHGKMVTGTVHLGDHAELQVDGATRQAIRLHHSATHLMHHA
FT                   LRAVLGEHVKQAGSHVSAERLRLDFSHFQGMSEEELRAVEDRVNGAILSNVSQETAVMT
FT                   PQEAVAAGAMALFGEKYGDEVRVVRIGDSMELCGGTHVSRSGDMGIFHILSESAVAAGV
FT                   RRLEAVCGGRARAIFRGDQEALKAAAALLKTQPNKLAEGIERLLGKQKELEKSLEKLQS
FT                   AQAGGMVEALLEQAVEVGGIKLLAVEVKGVDGKALREMVDQVKDKLGSGVILLALGGDK
FT                   VSLVAGVTKDLAGKRVKAGDLMAFAAAMVGGKGGGRPDMAQGGGTEVAAIPTMLTAIPG
FT                   WLQEQLG"
FT   gene            complement(16227..17009)
FT                   /locus_tag="Mmc1_0014"
FT   CDS_pept        complement(16227..17009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0014"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: ccr:CC3223 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42543"
FT                   /db_xref="GOA:A0L3K0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3K0"
FT                   /protein_id="ABK42543.1"
FT                   /translation="MLPCVLTIAGSDPCAGAGLQADLKTITALGGYGATVVTAITVQNS
FT                   VKVSQVHPVEGSLVAAQMRAVLSDLPIKAIKLGMLGNRGVVEAVLSVLDHYPEIPVVAD
FT                   TVLRGSAGGALLADEDVAHFVQHLLPRCHLITPNLDEAQRLTGLEGGVGVADLESLAYR
FT                   LMGLGCGGVVLTGGHLVGNKVVDTLVCKGGIKRWIGEKIASKEGFHGTGCTLASAVALG
FT                   VAKGLDDFEAVEEGIAYVRQTIRRSIKLGSGQRFLGHG"
FT   gene            complement(17290..18675)
FT                   /locus_tag="Mmc1_0015"
FT   CDS_pept        complement(17290..18675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0015"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: pca:Pcar_2412 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42544"
FT                   /db_xref="GOA:A0L3K1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3K1"
FT                   /protein_id="ABK42544.1"
FT                   /translation="MSEFTPREIVSELDRYIIGQNMAKRAVAIALRNRWRRQRLSAEMR
FT                   EEVYPKNILMIGPTGVGKTEIARRLAKLARAPFIKVEATKFTEVGYVGRDVESIVRDLV
FT                   EMGITMVTEEAKVKVQFQAEDQAEERLLDILLPLPSTGQGEGSAHFGLFGQMEGSSVKP
FT                   EPTAQQKESRQKMRKMLREGKLDDREIDIDLKEQRRVPMMEVITPQGMEGINLQDMLGG
FT                   LMGGRTKTRRVKVGEAMKLLTEEEAGKLVDQDTVQQVAIERVEQSGIVFLDELDKVCAR
FT                   GSETRGGDVSREGVQRDLLPLVEGTTVSTKYGMVKSDHILFIASGAFQLAKPSDLLPEL
FT                   QGRLPIRVELESLGKGEFVRILTEPENALTRQYAALMGVENIELVFTDEGIEALAEIAT
FT                   RVNETAENIGARRLHTVMEKLLDELSFSAPDRGGERVVIDAAYVNRQLSDLAADEDLSR
FT                   FIL"
FT   gene            18810..20273
FT                   /locus_tag="Mmc1_0016"
FT   CDS_pept        18810..20273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42545"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3K2"
FT                   /protein_id="ABK42545.1"
FT                   /translation="MNQHNREQATVPTPMIDEIKTQSFGVFGVDNAIVDFLQEIGFQAI
FT                   FNRRGWSKRTGKDLPTLIMLLILHPLLKVPSIHLFCRDHFLSVFAVGKDTFYRLLQRQF
FT                   PWRNAHWALIKKLLPQWRTLDLGPGYLVADTTVKEKRGDRIEGVCWHHDHNTGRSVAGF
FT                   EAAHLVWVNKQGTLPLDAALRFSKRPLISNLLHILSYRFDCRSHLGRRYREAAKMSKLD
FT                   QTVDMVARAIQAGIPAQYFLADAWYSSVKFVKKILDLGVVPLIRWKRNNTKFLFQGERL
FT                   TSAELYTRFAKGKIRKAKGSKRFKGTFLDAEHPEIGLIRLFFVRLIDPKTGSKEWAVFL
FT                   TTDRSMGLSNMIEHYANRWGIEVFYKESKQHLGFLNESVRSFEAVIACLHLAAMRHAVL
FT                   SSMVAIKGSQRDQLAHNLAALTYARKLWHTFRAIFNDALGRTSILENHQKNEVIELFEQ
FT                   EVEAWLSKALMLDPLGSQRQILAETNCET"
FT   gene            complement(20282..20818)
FT                   /locus_tag="Mmc1_0017"
FT   CDS_pept        complement(20282..20818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0017"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   mca:MCA2014 ATP-dependent protease HslV"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42546"
FT                   /db_xref="GOA:A0L3K3"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3K3"
FT                   /protein_id="ABK42546.1"
FT                   /translation="MFKGTTILSVRRGNHVVMGGDGQVSIGNTVAKSNARKVRLMSDGK
FT                   VLAGFAGSTADAFTLFERFEGKLSKHGGNLTRAAVEMAKDWRTDRVLRRLEAMLAVADE
FT                   HCSLLISGNGDVLEPEEGVIAIGSGGPYALSAARALLRHTSLNPRQIVESSLEVAAEIC
FT                   VFTNNNLTIEELGGE"
FT   gene            20962..21195
FT                   /locus_tag="Mmc1_0018"
FT   CDS_pept        20962..21195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42547"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3K4"
FT                   /protein_id="ABK42547.1"
FT                   /translation="MTDQEMKDRILALLTPKNIEDGTRVMAYTMFYRKLFGRQPNSENE
FT                   QRVQRMLDALVAEGKISRYPDIGVAEPPYVLS"
FT   gene            21209..21952
FT                   /locus_tag="Mmc1_0019"
FT   CDS_pept        21209..21952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0019"
FT                   /product="Arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /note="PFAM: Arginine-tRNA-protein transferase, N-terminal
FT                   domain protein; Arginine-tRNA-protein transferase,
FT                   C-terminal domain protein; KEGG: ppu:PP4006
FT                   arginyl-tRNA-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42548"
FT                   /db_xref="GOA:A0L3K5"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3K5"
FT                   /protein_id="ABK42548.1"
FT                   /translation="MTGMSRIDATAQRLDLLLTPPHACSYLDNHEAAILFVEPSLPMSA
FT                   PLYEHLMERGFRRSSEHVYRPYCAQCDACVSVRIPVERFKMSRNMRRIWKRNEDLTVAS
FT                   ATPTHREEWFELYRRYLASRHAGGPMDDPQPSQFMEFLNASWSHTRFVEFRLNGRLIMV
FT                   AVVDDQPKSLSAVYTFFDPNEKARSLGTYAILWQTEAAKQAAQPWVYLGYWIKQSPKMR
FT                   YKSRFTPLEGYRDRRWRDLTPSELA"
FT   gene            complement(22046..22708)
FT                   /locus_tag="Mmc1_0020"
FT   CDS_pept        complement(22046..22708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0020"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: bsu:BG13824 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42549"
FT                   /db_xref="GOA:A0L3K6"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3K6"
FT                   /protein_id="ABK42549.1"
FT                   /translation="MYLLGLTGSIGSGKSTVAAMLVERGARLLDSDRFAREALEPGTEQ
FT                   WHAVVARFGQDIMEEGEGDIRALDRRKLGQIVFADELARKDLESIVHPYVWRMQSKLLA
FT                   KWAEEEPNTVVVIDIPLLFETNGEGRCDMAVVVGCGDQQWARLENRRGMSDDMKRRIIA
FT                   QQMPEEEKIKRGDWVIWNTGTLDETEKQIGQLWNMVSLGAKNGVGEAWPDGWHKYGY"
FT   gene            complement(22710..23507)
FT                   /locus_tag="Mmc1_0021"
FT   CDS_pept        complement(22710..23507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0021"
FT                   /product="type 4 prepilin peptidase 1, Aspartic peptidase,
FT                   MEROPS family A24A"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; peptidase
FT                   A24A domain protein; KEGG: gme:Gmet_0959 peptidase
FT                   A24A-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42550"
FT                   /db_xref="GOA:A0L3K7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3K7"
FT                   /protein_id="ABK42550.1"
FT                   /translation="MPPTAWLDLGTALVIGLVFGSFLNVCVHRIPLKESVVNPPSHCPF
FT                   CKKNIVWYHNIPIFSWLWLKARCAYCHHPIHWRYPLMELLGGVVVVMAIARFGSNAEGW
FT                   LLALFGLALLLLSAIDMEKRILPNIITYPLLVVGVVCSALPMLGSPFPSMGDALLGMVV
FT                   GAGGLLVLIEVWYRVTGRVAMGLGDVKLVGVLSAWLGWQALYFIIFGSALLGVVVGGGW
FT                   LIWGGKEKQTPIPFGPFLALSAWIYLFLDESFKQGYLLWMVRS"
FT   gene            complement(23815..24675)
FT                   /locus_tag="Mmc1_0022"
FT   CDS_pept        complement(23815..24675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0022"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: gsu:GSU1490 shikimate 5-dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42551"
FT                   /db_xref="GOA:A0L3K8"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3K8"
FT                   /protein_id="ABK42551.1"
FT                   /translation="MLSKALNINGETGLLAVIGDPVSHSLSPKMHNLALRHCQLNYCYV
FT                   ALPVKPHNLVRAVQGFAAMGMRGFNATIPHKENLLPLMHTLSEEASHIGAVNTVVIDDD
FT                   GKMTGHNTDAYGFITGLKEAWRSDLSGLTAIMLGSGGAARAILYGLIQAKAARVIIANR
FT                   TIERAQALIEAMQPYAPNTQLMVAPTQADQLPLESCDLLINTTSMGLKGETIPYIDLAR
FT                   LPHHAFVSDIVYGAHPTPLLRATAQHQLGGQDGLPMLIHQGAKAFELWTGHSMPVELVE
FT                   HTLRQ"
FT   gene            complement(24687..25445)
FT                   /locus_tag="Mmc1_0023"
FT   CDS_pept        complement(24687..25445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0023"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   ppu:PP1302 conserved hypothetical protein TIGR00486"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42552"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3K9"
FT                   /protein_id="ABK42552.1"
FT                   /translation="MANLTEIETHLRNILQCDRIDDYCPNGVQVRGGHNITRVVSGVTA
FT                   CMALFEAAVAVNAQLIITHHGLFWNKDPRVVEGMLKHRLKLLLEHDITLMGFHLPLDMH
FT                   PELGNNAQILNRLQLIAGEPFGVYKGSALSKMGHWEQSLSLDQVQQKLQKLFGGEPLVL
FT                   PYGPPNIRKVAVCSGGAPELIHEAVTAGADLFLTGEASEPVYHVAREMGIHFVAAGHHR
FT                   TEMFGVQAVGERLAQTFSLEHTFIDIPNPI"
FT   gene            25568..26701
FT                   /locus_tag="Mmc1_0024"
FT   CDS_pept        25568..26701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42553"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3L0"
FT                   /protein_id="ABK42553.1"
FT                   /translation="MTMPRDMFRIDPDPNIQRVLEADSYWQAREKILDTLIKHTLIDSY
FT                   NKFRKAREPYPFISRSSLRPGSVVSSKEYKLHNSALVVLLADVMPASLRKHFRCRLANR
FT                   VIKKNIAGVAPDLPGLNEYDTAWRDVHHEGFIKLMRMMLPLDFALLVQPSDEDDRYQLT
FT                   NFHVKIERLLDMALRTMGHHLNYLERGLYEQGETFIDQLERKFFEYFNYYHNAAGRRGA
FT                   SALAAQVLAMEQQEATIFSTSQQDRRLTLLTTYNDSHDLKIEQYVLLSLEPDEYKTLKQ
FT                   WGKDVALDIRNHYLIHPQKSTQPVVVMRLVYQHTEAAQPNADGTLRELNVRERWIRLTE
FT                   ETIIPLHGGAQAFIGYPVAYKKDTAEVDGKSCPLPVK"
FT   gene            27100..28170
FT                   /locus_tag="Mmc1_0025"
FT   CDS_pept        27100..28170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0025"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: tcx:Tcr_0123 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42554"
FT                   /db_xref="GOA:A0L3L1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3L1"
FT                   /protein_id="ABK42554.1"
FT                   /translation="MKSKHRFIQACFRQPVDRTPIWLMRQAGRYLPEYRKTRAQAGDFM
FT                   ALCKNTELATEVTMQPIRRYGLDAAILFSDILVIPEAMGMDVRFATGEGPLLDPPVRVH
FT                   GDIEKLIHTDPEDSLDYVMRAVASIRKALNEEIPLIGFSGSPWTLATYMVEGGSSKTFG
FT                   LVKGMLYDAPESMHLLLDKLADMVAAYLNAQIRHGAQAVQIFDTWGGVLSQPTFREFSL
FT                   RSMKAVVDRLDRTNSAGERIPVILFAKGCNAMVEDIAQSGCDVVGLDWTSEIGPLRERI
FT                   GHKVALQGNMDPALLYASPERIAQGAREVLQAFGPHPGHIFNLGHGMAPDMSPDHVEAL
FT                   VRAVKEEGLKIHQGVA"
FT   gene            28170..29576
FT                   /locus_tag="Mmc1_0026"
FT   CDS_pept        28170..29576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0026"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: tcx:Tcr_0501 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42555"
FT                   /db_xref="GOA:A0L3L2"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3L2"
FT                   /protein_id="ABK42555.1"
FT                   /translation="MHAPISQVWQFDLELINRYNKSGPRYTSYPTAPHFREDFGPDAFR
FT                   QAVARSQQKDPGKPLSLYFHIPFCDTVCYYCACNKVITPDRARGARYLEYLLQEVARMG
FT                   ALFDRKREVVQLHLGGGTPTYLDNGQLQRLWDAVNAHFTLVEDARGEYSFEADPRELPV
FT                   GAVAGLRKMGMNRISIGVQDLDPVVQKAVNRIQPLDLTKRVVDEARDSGYASVNVDLIY
FT                   GLPFQSEAGFRETLRATIEDLDPDRLAVFNYAHLPQYFKPQRRINEADLPSPDTKLKIL
FT                   EMAAQMLVEAGYVYIGMDHFAKPDDELAVAQRQGVLHRNFQGYTTHAECDLVSMGSTSI
FT                   SQIGNTFAQNIKELEPYYERIERGELAIFKGLELTEDDMLRQDVIMRMICDFQLDREQI
FT                   SKKHHIDFDQYFSVEQEDIKRMVEEGLIEDDGRLIRCTPGGRLLIRNICMTFDWYLRNA
FT                   EQKKTFSRTI"
FT   gene            29839..31230
FT                   /locus_tag="Mmc1_0027"
FT   CDS_pept        29839..31230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0027"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: csa:Csal_0796 protoporphyrinogen oxidase;
FT                   TIGRFAM: protoporphyrinogen oxidase; PFAM: amine oxidase;
FT                   FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42556"
FT                   /db_xref="GOA:A0L3L3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3L3"
FT                   /protein_id="ABK42556.1"
FT                   /translation="MTKNPILIIGGGISGLSTAWFLHKKGEKVILLESRDRVGGNIRTS
FT                   RNPEGYLIEHGPNSTLQKPGDEEDALGRIITDMALESELQEANPLAARRFVMKGGQLHV
FT                   LPTSPPGFIKTPLFSLSAKLRLCLEPFIGKSEQEESIAQFVIRRLGQEFLDYAIEPFVS
FT                   GVYAGDPKQLSVRAAVAKIYALEAKYGSLIKGAIALGKIRKAAGMPRGRMISFETGMET
FT                   LPATIANRLPHQSIHTNAQVTALCQHGAAWQVSWQQGGQHGGEPHSIIASQVVLATPAS
FT                   VSAQLLRPLSPQAADLLESIRYAPVDSVALGYAKQDINHSLDGFGFLIPRKEQVTTLGG
FT                   LFSTTLFPGRAPQDKALLTCFIGGMTNPSITQWSEEKVVTQVDQDMMAALGIQHGAEYV
FT                   HLTRYTHAIAQYEQGHLQRVGDIDRALAGYKGLHLRANWRDGVSVSDCVLNGEKSAQKI
FT                   LAGVS"
FT   gene            31230..31943
FT                   /locus_tag="Mmc1_0028"
FT   CDS_pept        31230..31943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0028"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rru:Rru_A3611 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease, RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42557"
FT                   /db_xref="GOA:A0L3L4"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3L4"
FT                   /protein_id="ABK42557.1"
FT                   /translation="MERLIVLDTETTGFDPKEGHRIIEIGCVELVNMRKGDERQWYVNP
FT                   EREIPADATKVHGITDADVANSPKFKEIYHEFLAFIGEDSLVIHNAEFDMRFLNAELTR
FT                   LNKRLVMPMERAIDTIPLARRKFPGSTVNLDALCKRLGVDNSGRTFHGALLDAHLLAEV
FT                   YVELMGGNQFSLEMAADESGRIAQPSDSPKDGAPGPGLMMAPRDWQVSEESTQAHEAFL
FT                   QLLDRESGGAVWNKN"
FT   gene            32014..32565
FT                   /locus_tag="Mmc1_0029"
FT   CDS_pept        32014..32565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0029"
FT                   /product="cytochrome c553"
FT                   /note="KEGG: vvy:VVA0641 cytochrome c553"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42558"
FT                   /db_xref="GOA:A0L3L5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3L5"
FT                   /protein_id="ABK42558.1"
FT                   /translation="MLLRLCVVAVLMIPSPSYGGSLLEPCLPCHKKSGEPVKTDVTPLI
FT                   GSQNTFYLTEVLKDYATGKRPTEVAAHRQIPPHQQAAYAAHFAQQRWVSPWQPVEQKRA
FT                   ERGKSLVKGCERCHREGGRVQFDENPRLAGQRMAYLRLRLHQFRTAGKIPPQPEKMRNF
FT                   IGELNDEQIEDVVHFYANNR"
FT   gene            32681..33313
FT                   /locus_tag="Mmc1_0030"
FT   CDS_pept        32681..33313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB0776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42559"
FT                   /db_xref="GOA:A0L3L6"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3L6"
FT                   /protein_id="ABK42559.1"
FT                   /translation="MFLRWCCHRHDKMLGITLIEMLLGLLIIGGLLGIVMVGIELQHNA
FT                   QNKKIARVFIGGWVQAYDLYHERTGRVPGDPSNTGRTHVPLEAAFETQFSGIVMQLPQG
FT                   DGEGGINSYRYNDEQGYIHHLRLAFESISTASEAIGVGLVGNVMRLEGVSPTLFATLEA
FT                   LLDESLSRTQGTLRCRSILEMDQQDPMRQRNKSQANHSFVCWYKMRY"
FT   gene            33413..34600
FT                   /locus_tag="Mmc1_0031"
FT   CDS_pept        33413..34600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0031"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: bbr:BB3333 putative 8-amino-7-oxononanoate
FT                   synthase; TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42560"
FT                   /db_xref="GOA:A0L3L7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3L7"
FT                   /protein_id="ABK42560.1"
FT                   /translation="MEQPHLAYRAFCQSREAAGQWRQLHAVQPLPRGRVLRDGVELINF
FT                   SSNNYMGLADHPLLKQRAMAWTEQWGTGAQASRLVCGDLEPFARIEARLVAGKGCEAAL
FT                   VLNAGYQANSSVIPALLDKRVLGGEPLVFSDRLNHASMHHGVQLAGVRQLRYRHGDLDH
FT                   LERLLKRHAGEKVAKFILSETVFSMDGDRIDVGGLIALKQRYGAFLYLDEAHATGVLGP
FT                   DGFGLAAAYPGQVDLVMGTFSKGLGGFGAYVTCSHALRAYLINRAGGFIYSTALPPGVL
FT                   GAMDAALELLPQMGEVRARVLAGAQRVRAALRAAGLDTGNSSTPIIPVMVGDEQRTLAL
FT                   SEGLRAEGLLGIAIRPPTVPEGTSRLRLSLSAAHSDEDWSLLAAAVPRCLREING"
FT   gene            34673..35371
FT                   /locus_tag="Mmc1_0032"
FT   CDS_pept        34673..35371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0032"
FT                   /product="biotin synthesis protein BioH"
FT                   /note="KEGG: gox:GOX0721 biotin synthesis protein BioH"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42561"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3L8"
FT                   /protein_id="ABK42561.1"
FT                   /translation="MRTVLMVHGWGLAPGLWRPMLGHMGPVELLRADLGFFHPHGQVTV
FT                   PLPEGDWLGVGHSMGGLWLLQALLGEAETPQMAALARCKERCRGLVFINGFSRFHQGAD
FT                   FPHGVGARVIGRMRKQLTVDAMQVLRDFGSRSGLPVMGLPPGVKPHVARLDEGLAAISR
FT                   WDGRAILQGWSHPFLAIASREDAIVSAAMSEQMFGGSALQWIEGGSHLLPLTHGQQMAA
FT                   ALQQSLESWL"
FT   gene            35368..36180
FT                   /locus_tag="Mmc1_0033"
FT   CDS_pept        35368..36180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0033"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bpa:BPP1773 putative biotin synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42562"
FT                   /db_xref="GOA:A0L3L9"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3L9"
FT                   /protein_id="ABK42562.1"
FT                   /translation="MNLPNRGEGNRNGRVGKNFGRALNYHRKALVQQHVADELAERLVD
FT                   FPLPERPRVLEIGCGTGFLSRHLMRQWPGGSFLFTDISAPMLVRCQSHLSDLPGQRQFM
FT                   VMDGEHCAVRGPFDLVVSSMAMQWFGDLPGALQGLSSLLKTNGMLAFATLGDETFREWR
FT                   GVCAQYGSPFGRPDYPDVAQLQEMWPSGGEGDVEEDHIPVAHSSGHGFLRALREVGAHQ
FT                   PSGQHRPVSAALMRRMLQATRGGQHGFTVTYHVLYGFYTRSFDDRPIH"
FT   gene            36233..37198
FT                   /locus_tag="Mmc1_0034"
FT   CDS_pept        36233..37198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0034"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: lic:LIC11777 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM domain protein; biotin and
FT                   thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42563"
FT                   /db_xref="GOA:A0L3M0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3M0"
FT                   /protein_id="ABK42563.1"
FT                   /translation="MAEAALAGQLPDAQSGLRLLTDPGIELLPLLQAAFRVRFHHFGRG
FT                   VRIHILNNVQNGYCSEDCNYCAQAKNSKAPIEKYSIKSDEEILEGARKAYESGAYRYCM
FT                   VSSGRSPHAERIDHMSKLIREIKSRWPVEVCLSAGFLDANKARELKEAGLDRYNHNLNT
FT                   ADGYYGSICTTHSYGDRLNTLQEARRAGLEVCSGIIIGMGEKPEEIVEVATTLRSLQAR
FT                   SIPVNFYVHVEGAQLGAVDQLTPAYALRALALFRFFNPDAEVRAAGGRESNLRGMESMA
FT                   LYPANSLFAEGYLNTTGHMAEKTVKMVEDAGFFVEKIEEE"
FT   gene            37226..37870
FT                   /locus_tag="Mmc1_0035"
FT   CDS_pept        37226..37870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42564"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3M1"
FT                   /protein_id="ABK42564.1"
FT                   /translation="MLSPRDRFWSAALSLLLLAGCSDSSPPKNDWEPFVESYLEEKQRQ
FT                   AELPADYYLTPERWNPLLDYLGWSQVKADTSKEHELVIREGGIDMGPEEELNAGHLEGG
FT                   GLLEDLKRKIHAGREALGIVDETMGDNPELLDALRDGGVREALKGVDHGYLEQKKQELM
FT                   GLAESAGVDADYQPSELDRQVLKGFGKKLGLSDKRMENLEDQAENYRDKRP"
FT   sig_peptide     37226..37300
FT                   /locus_tag="Mmc1_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.844 at
FT                   residue 25"
FT   gene            37867..38487
FT                   /locus_tag="Mmc1_0036"
FT   CDS_pept        37867..38487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0036"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG:
FT                   syf:Synpcc7942_0030 dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42565"
FT                   /db_xref="GOA:A0L3M2"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3M2"
FT                   /protein_id="ABK42565.1"
FT                   /translation="MILTPPARGVFVTGTDTHVGKSVASAWLLHQWQASYWKPIQSGLE
FT                   GATDSQVVTELAQLDSSRLFAERFRLQAPLSPHASAAAQGIAIHLEDFQLPPCEAPLVV
FT                   EGAGGVLVPINQQHTMLDLMVWLGLPVIVVTRTGLGTLNHTLLTLQALEGRGLQVLGLI
FT                   ACGEANPSNFAALRHFGQRPLLAHIPPLEPLTPERLAAVGWAE"
FT   gene            38622..39935
FT                   /locus_tag="Mmc1_0037"
FT   CDS_pept        38622..39935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0037"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.62"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   mag:amb2763 adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42566"
FT                   /db_xref="GOA:A0L3M3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3M3"
FT                   /protein_id="ABK42566.1"
FT                   /translation="MTPSADLIQWDKRHCWHPFTQAQTAPDPIPMASARGATLTSVDGR
FT                   TFIDLNASWWVTTHGHAHPAIAAAIAQQAQTLEQVIFAGFTHAPAVNLATRLSETLGGD
FT                   LDRVFFSDDGSTAVEVALKMAAQYHINQGTPRHRFVAFRGGYHGDTVGAMSMGQGSGFF
FT                   DAFQAMLFHVDLLDYPATWLGDPTPELREALVLSQLDDYLATHGPQCGALLMEPLVQGA
FT                   AGMRMARAGFVQQVMERCRAAGVLVILDEVMTGFGRTGTLFAFQQCGDYPDIICLSKGL
FT                   TAGFMPMSVTVVREPIYQAFMGEGFERALAHGHSFTANPLGCVAALASLELFEQEGSLA
FT                   RIGQIAALHQQRLEPLQKHAKAVRPRVCGSIGAIDLRVADGGYGAEIGPKLKAFFIEKG
FT                   LLMRPLGNTVYLLPPYCVSDAQLHQGWDAIEEALDTLL"
FT   gene            complement(39950..41704)
FT                   /locus_tag="Mmc1_0038"
FT   CDS_pept        complement(39950..41704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0038"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42567"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3M4"
FT                   /protein_id="ABK42567.1"
FT                   /translation="MKPQHGLKGGRPQRRGQGPAMLLAAALMWGSAQAQEAPPQVQDVI
FT                   PQGSAIAPPDAIESSALTGFESIGRPFPLTPNAVRRMLEQGQAQLALMLSEQALNRGSG
FT                   APVTALRWRELKARAHMALGQQSQALEVLESLPTDTIDHTPELVLMMAQAQLANGQFQE
FT                   ARGRFSRFLVENPGHPHAYIAQRGIGICELKLGALDRARLQLGLYRERPDRPEPDPEWI
FT                   LAMAELSLAQGGWEMARHGLKQLPEETRRSQPARAIFYRAVRMQVAEAAQTEFTPKLLI
FT                   DLESALAHNPGETEAQELRILHAKLFHQWATTPIKREKKPTATVQRLMQRRCLLRTLLN
FT                   APQGLEQALFLTQLLELEQEAPLGLTAAGGLLTPEGLGLTPLTPPVRAVLAETLLQQQR
FT                   LAEAVALLGSQRERDGDLIRLQLLAMDTSMSDVTLESLLEELSPSGTNGEPMVLPSPLL
FT                   EPIAKALLAYTRHGREAQAELLLAQLQTREDDPAVIRLLAYQKGLMLESLGDLEEALLH
FT                   YAGMSFPAEKIAPAADRLLPESPKEATARLLIQLGKTSEADKLLGKTETPSNSPKGGTP
FT                   TPAGVVKP"
FT   sig_peptide     complement(41600..41704)
FT                   /locus_tag="Mmc1_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.672 at
FT                   residue 35"
FT   gene            complement(41900..42769)
FT                   /locus_tag="Mmc1_0039"
FT   CDS_pept        complement(41900..42769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0039"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: tma:TM1077 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42568"
FT                   /db_xref="GOA:A0L3M5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3M5"
FT                   /protein_id="ABK42568.1"
FT                   /translation="MESLQDRAALLAWRKRQGHQNIGFVPTMGCLHEGHLTLLREARQR
FT                   CEQVVVSIFVNPTQFGPNEDFDLYPRTFEADWALLEAEGCDALFHPTVAAIYPPENPNL
FT                   THVTLPALAGMLCGAVRPGHFDGVATVVTLLLNLVRPTSAFFGLKDYQQFTVLRSMVQD
FT                   LAMPVEVIGIPTVREPDGLAMSSRNRYLDAPARAQAVALSQGLNRAYHAYQEGLHDATA
FT                   LAHLVEQTLRQAGIARIDYVAVRDALTLQPWQGKGAPVVLIAAHVGAARLIDNLVLGAQ
FT                   PIPSVTQE"
FT   gene            complement(42778..43584)
FT                   /locus_tag="Mmc1_0040"
FT   CDS_pept        complement(42778..43584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0040"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: sat:SYN_02773 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42569"
FT                   /db_xref="GOA:A0L3M6"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3M6"
FT                   /protein_id="ABK42569.1"
FT                   /translation="MKKRVRVPDLVRMKQQGEPIVALTAYDYTLARLVDAADVDLVLVG
FT                   DSLGMVVQGHETTLPVTLDEMIYHTRAVARGCQRALVVLDMPFGSTQNGPERTFEQAAR
FT                   AMKESGAAAIKLEGGQAMAATVAYLTERAIPVIGHLGLTPQSVHAFGGFKIQGRDQAAA
FT                   QRIADDALALQQAGAGAIILEGIPAALAQQVSQSLTIPTIGIGAGVGCDGQVLVIYDML
FT                   GLYGDLAPKFVKRYLDGVPVIGGAIGAYVQEVRNRQFPTPDHSFEK"
FT   gene            complement(43642..44085)
FT                   /locus_tag="Mmc1_0041"
FT   CDS_pept        complement(43642..44085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0041"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK;
FT                   KEGG: tel:tll0178
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridin e
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42570"
FT                   /db_xref="GOA:A0L3M7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3M7"
FT                   /protein_id="ABK42570.1"
FT                   /translation="MRNCQQALLMLDKQPHVTVTACSSWYRTEPLGPQQPDYINGAATL
FT                   TTTLSPLALLALLLDVEQQMGRDRHREQRWGPRALDLDLLFYADLLLDHPQLILPHPQL
FT                   HLRRFVLQPLGEIIPTKRHPKLGKTVDTLLSEVEDRGQVERLS"
FT   gene            complement(44151..45026)
FT                   /locus_tag="Mmc1_0042"
FT   CDS_pept        complement(44151..45026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0042"
FT                   /product="peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysins; KEGG: dde:Dde_0064 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42571"
FT                   /db_xref="GOA:A0L3M8"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3M8"
FT                   /protein_id="ABK42571.1"
FT                   /translation="MMQRRQFLQAMAVGVFGGAGMVATEAHAIEKAVPMPKKTEAYLRA
FT                   SMDQAEIEEAVRRIRNFNTAHKDDIFLSPAQFATLKKVNIRFTRLENLVGHANFHLLGF
FT                   DEAINLAKNFSSVESFSKAELDFLEELFFRDAGAYGFNGYKPFTRLTEEIPKREVSKLP
FT                   FTGNYLYRGTPVQTYNKILRDVGDKVILTSGVRSVIKQFRLFLHKAEESQGNLSMASRS
FT                   LAPPGYSFHGIGDFDVGQVGFGYLNFTEHFATTEVFKRLRDLGYVNLRYPRDNLLGVRF
FT                   EPWHIKVLSV"
FT   sig_peptide     complement(44940..45026)
FT                   /locus_tag="Mmc1_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 29"
FT   gene            45368..46315
FT                   /locus_tag="Mmc1_0043"
FT   CDS_pept        45368..46315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0043"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="KEGG: tcx:Tcr_1751 peptidase M14, carboxypeptidase
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42572"
FT                   /db_xref="GOA:A0L3M9"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3M9"
FT                   /protein_id="ABK42572.1"
FT                   /translation="MTHAQHWWALPLALVFFLGCPPVQAGDTGALSPLLSMEQTCQRIG
FT                   NKLGSVSVQDCLSQELRPTGGYSVGGIPILVKEYPPLGQRLPRGRILVLGGIHGDEYSS
FT                   VSITFRWLEKLNLYHSGLFHWRVAPLTNPDGLLQENSVRMNAHGVDLNRNFGTPDWADK
FT                   ALEYWEKDTLRDPRRYPGPAPLSEPESRWIAQEIESFKPDVIVSIHAPYGLLDFDGPPK
FT                   NPPKRLGSLYLSPLGTYPGSLGRYAGMYKKIPIITIELKYAGIMPSNSEIRNIWMDLVR
FT                   WLSRNVNPATRQVGVDHDPDQDTNHAIPREASHS"
FT   sig_peptide     45368..45445
FT                   /locus_tag="Mmc1_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.713 at
FT                   residue 26"
FT   gene            46312..47529
FT                   /locus_tag="Mmc1_0044"
FT   CDS_pept        46312..47529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0044"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   ppu:PP1588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42573"
FT                   /db_xref="GOA:A0L3N0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019878"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N0"
FT                   /protein_id="ABK42573.1"
FT                   /translation="MNPEMARLNPYPFEKLAVLFEGITPNGALSPLNISIGEPKHPTPA
FT                   FVTQRMMEALQDGDMAKYPTTRGERALRESMAAWLTRRFELQAGSVDPDRHVLSANGTR
FT                   EAIFSVALAVVDRAKGGVVLTPNPFYQIYEGACFMAGVEPVHIDATEETHLRPPFTQLD
FT                   AELLARTQMVYLCSPSNPTGAVHPLEELQELIRLADTYDFVICADECYSEIWYDAPPPG
FT                   LLQACAAMGRHDFARCLVFHSLSKRSNMPGARTGFIAGDAQLLDHYFKLRTYTGCATPP
FT                   FIQKAAIAAWDDEQHVEENRRAYRAKLEESMAILSPVLPVTRPEASFYLWLKVPGGGAL
FT                   FARTLYEKYNVVVLPGGYLGRQGAHGNPADGYIRIALVATLEQNREAMHRIAQCAQEMI
FT                   GQSQAV"
FT   gene            47652..48503
FT                   /locus_tag="Mmc1_0045"
FT   CDS_pept        47652..48503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0045"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: mag:amb3873
FT                   tetrahydrodipicolinate N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42574"
FT                   /db_xref="GOA:A0L3N1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N1"
FT                   /protein_id="ABK42574.1"
FT                   /translation="MSDLQAIIEKAWDERDGINSSTAGEVRRAVLETIEAIDAGTLRVA
FT                   EKNPDHPEAEHGWVVNQWAKKAVLLYFKLHDNQVMGDEGATYFDKVPLKFAGWDEARFK
FT                   QAGFRAVPPATARKGVYIAPGVVLMPSYCNIGAYVDSGTMVDTWATVGSCAQIGKNVHI
FT                   SGGAGIGGVLEPLQANPVIIEDNCFIGARAEVAEGVIVGEGSVLSMGVYLGKSTKIVDR
FT                   ASGEIHMGYVPPYSVVVSGTMPGKPMPNGQPGPNLYCAVIVKTVDAQTRSKTGINELLR
FT                   EF"
FT   gene            48503..49666
FT                   /locus_tag="Mmc1_0046"
FT   CDS_pept        48503..49666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0046"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: tcx:Tcr_1291 succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42575"
FT                   /db_xref="GOA:A0L3N2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3N2"
FT                   /protein_id="ABK42575.1"
FT                   /translation="MTVYSPEMVDPVALARALIQAPSVTPMDHGCQDLLIRHLEDLGFT
FT                   VHRLRFGHVENFYARLGSKGRNFTFAGHTDVVGAGDTSRWSSDPFAATLEEGYITGRGA
FT                   VDMKGGLACMVAATARFLAARPHFAQQHSLSFLITGDEEGDALDGTLKVLQWLESQQEK
FT                   MDYCLVGEPTSAAQLGDCIKNGRRGSVNGRLTIRGVQGHVAYPHLVDNPIHRAAPVLAA
FT                   ISSMTFDQGDRFFQPTSLQFTAVQSGGSATNVVPGELTAGFNIRFSAMHTPESLEARIR
FT                   QVLDGAEVDYDLQMMTSGLPFITEGGPLVEAVKATVAQVTGLEPQLSTGGGTSDARFIS
FT                   RHCVQTVEFGLVGSTMHKVDERVPVADLEVLTEVYRRLLERLYPPQG"
FT   gene            complement(49806..50117)
FT                   /locus_tag="Mmc1_0047"
FT   CDS_pept        complement(49806..50117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0047"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="KEGG: mca:MCA0256 ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42576"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N3"
FT                   /protein_id="ABK42576.1"
FT                   /translation="MKPKHHVFVCMNRRPEGHPRGSCQASGSQGTFEAFNTELEKRGMY
FT                   EQVFVTGTFCMGPCDRGPVAVVYPEGVWYGNVKPEDVSEIFDKHFVDGGEPVERLRIM"
FT   gene            50570..50905
FT                   /locus_tag="Mmc1_0048"
FT   CDS_pept        50570..50905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0048"
FT                   /product="DsrC family protein"
FT                   /note="PFAM: DsrC family protein; KEGG: tbd:Tbd_2480
FT                   putative sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42577"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N4"
FT                   /protein_id="ABK42577.1"
FT                   /translation="MSSFELNGTTYETDEDGYLVDLGQWNEDVANYLAKEEGIDMTESH
FT                   WEVVHFLREYYEEYKIAPMIRILTKAIGKKLGKDKGNTKYLYDLYPGGPAKQACKVAGL
FT                   PKPTGCV"
FT   gene            51232..51933
FT                   /locus_tag="Mmc1_0049"
FT   CDS_pept        51232..51933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0049"
FT                   /product="Nitrate reductase, gamma subunit"
FT                   /note="PFAM: Nitrate reductase, gamma subunit; KEGG:
FT                   mag:amb3373 nitrate reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42578"
FT                   /db_xref="GOA:A0L3N5"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N5"
FT                   /protein_id="ABK42578.1"
FT                   /translation="MLMILAYLALGIFVVGILARIVKYARTPAPLKIPTTPAPLTKQGV
FT                   AWRLFTEVAFFNSLFKGDKWTWMGGYLFHVALALVTLRHLRYFVEDIPEVAGHFQIVGI
FT                   VAGIAMVGGLGFLFLRRLMVDRFRHISSKADYLILLLLMAIGGSGLLMTFAIHPDVVEI
FT                   KAAMMGWLGMQGFETPSDVVFLLHFLLVLALMIIFPFSKLMHMVGIFFSPTRNQTDTPR
FT                   EAKHVNPWSKY"
FT   gene            52041..53543
FT                   /locus_tag="Mmc1_0050"
FT   CDS_pept        52041..53543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0050"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="KEGG: mag:amb3374 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42579"
FT                   /db_xref="GOA:A0L3N6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N6"
FT                   /protein_id="ABK42579.1"
FT                   /translation="MADDIHVPEIGDDIVTPAPVVGTMSHLKPIPAQAKHMEPLDFPGE
FT                   RVENWQQAGIEKFGDLLSKYRSLQVFMDICVKCGSCTDKCHYYLGTQDPNNMPVQRAEL
FT                   MREVYRRYFTPGGKLFPSLVKASDFNEETLEKWFTYFHQCSQCRRCSVFCPYGIDTAEV
FT                   TMAARELMDSIGVGHKYSAEIVGKVHDLGNNLGIPKPALKGTLDFLEDDILETTGHEVR
FT                   LPLDQKGAEVLLVPPSADFFSAPHVDSLMGYAKVFHQAGISYTISSVASEAANFGMFIG
FT                   NFDQMQKIAKRISDQARELGVKRIVVGECGHAWRVAYAFWNTLNGPFDYLDPRYPVPQH
FT                   ICEFTNDLYNRGALTMDRSANDDKIITFHDSCNVARASRMGPNPGGQFEIPRALIRASA
FT                   NRFVDMDPDTIHEKTFCCGGGGGLLTDELMDLRIKGVMPRVTALKKVMEEDNVNFLALI
FT                   CAICKAQFTKVLPYYGIPMDTVGGVHQLVSNAIQLGAKKGIV"
FT   gene            53544..54275
FT                   /locus_tag="Mmc1_0051"
FT   CDS_pept        53544..54275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0051"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: bpm:BURPS1710b_3051 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42580"
FT                   /db_xref="GOA:A0L3N7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N7"
FT                   /protein_id="ABK42580.1"
FT                   /translation="MNSSLRISGRRPDEMRAVTITRHYTKHAEGSCLIAFGDTQVLCTA
FT                   TVEESQPRWMRNEDRGWVTAEYGMLPRSTNVRMGREAAKGKQSGRTLEIQRLIGRAMRA
FT                   VVDLQALGKRTIWLDCDVIQADGGTRTASITGAFVAMHDAVTGLLKAGLIRHNPLRDHV
FT                   AAVSCGMVAGMPALDLDYQEDSRCDTDMNFVMTGAGGFVEIQGTAEGVPFTRPEFESMA
FT                   ALADQGIKALVQAQKLALLKG"
FT   gene            54428..55600
FT                   /locus_tag="Mmc1_0052"
FT   CDS_pept        54428..55600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0052"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: pol:Bpro_1341 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: putative
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42581"
FT                   /db_xref="GOA:A0L3N8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N8"
FT                   /protein_id="ABK42581.1"
FT                   /translation="MTIFPLSLYLHIPYCVHKCPYCDFHSRVEVQVPQERYVDALLMEL
FT                   GMWRRRFSQDARPLQSIFLGGGTPSLFDPPQIGRLMAGIGAIWPLESGCEVTMEGNPES
FT                   LTQGRLAGYGEAGITRMSVGVQALDEGRLRQLQRPHDRAQALQGLGWLAQAGFSSWSAD
FT                   FIFATPGHTVAGWLEELAEVLAFAPPHLSCYGLTVEPGTPFFQRQQGGEALVADEERQL
FT                   ALLEATYERLTAAGLPSYEISNFARAGHGCRHNVNYWRFGDYLGVGVAAHGKWSDADGV
FT                   VWRSANLADAARYMACVEAGRSPWVRDQRLTPQEAGNEALVMGLRMGEGMSKATYQWVR
FT                   GVSLQQSVGDGLAWFERQGMLAQSATHVWLTPRGLRLADGVMAELMEVEP"
FT   gene            55693..57591
FT                   /locus_tag="Mmc1_0053"
FT   CDS_pept        55693..57591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0053"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   gka:GK3116 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42582"
FT                   /db_xref="GOA:A0L3N9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3N9"
FT                   /protein_id="ABK42582.1"
FT                   /translation="MFCSAIINYYVLRHHGAFGIIPSMYIRRTQTRNTATGESYYTHRL
FT                   VQSLRVGTKVRQVTLLNLGRHFAIGQNHWPTLCSRIDQLLSPQKTLISLDCPSQVEREA
FT                   QRIVAQLLTRQPEAIPSAKETETGLSPEDVQTVLVDSLEMSRPRSVGVEQVGLWAMGKA
FT                   GFTELLADVGLTGPQRAAAIGAIIGRMAAPGSERALHRWLSAQSGLGELLDVDFETMSL
FT                   MQFYRVSDLLIRNREAIENRLFSKINDLFNLPGTVTLYDLTNTYFEGEAEGNSKAQRGR
FT                   SKEKRCDSPLLTLGLVLDGSGFVRRSQIFPGNVSEGSTLEGMLKGLNAPNGTLVVMDRG
FT                   VATEANLVWLRDKGYRYLVVSRERERQFDFNGAACIETAAKEQIHIQKVLSDDGQEVRL
FT                   YCHSQRRAEKEKGISRRFAERFEAGLTKLSEGLSKPRTTKNIDKLWERIGRLKEKNRGI
FT                   GQHYHIEIIPDDSGLQAQAIHWKQKPLDGTSLTHPGVYCLRSNETGWDEERLWRTYITL
FT                   TDLESVFRSLKSELGLRPLFHRKEERSDGHLFITVLTYQIVQIIRQQLAEKGIHGRWST
FT                   LRDILSSQCRITASFRRPDGHSLQVRKATRPEPEQQKIFQALGIHANPGGVKKMVV"
FT   gene            57757..59304
FT                   /locus_tag="Mmc1_0054"
FT   CDS_pept        57757..59304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0054"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache, type 2
FT                   domain protein; KEGG: rme:Rmet_5641 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42583"
FT                   /db_xref="GOA:A0L3P0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P0"
FT                   /protein_id="ABK42583.1"
FT                   /translation="MLQRLRVRSLRFTVLAMAGLVVVVVVVFGLFAVAQLGTQQTMERQ
FT                   QGLKVLAAGLHGQLERIYTLERLGAYHRDEAQLLAREAVLAMALGEGRGLWLMDMKLHM
FT                   VVDSSRPTWVGKDLGRVVDAQGKPFFRDLVGVVRGAGEGGVVYRWGEGAQERLVYVKGF
FT                   KPWGWVIGVEVGLGDITVWGGGSGLVVGLGVLLLLVLWMIGSMGHLLRRQLGGEPEHVQ
FT                   RICRGVAKGDWGAVGGYIGESQGLGVVGELQRMQRRLMGVMARLQGGIEGVGGYGERLA
FT                   QGCDALMGRTDEQVSTLHETVAAMGAMTHTIAQNSQHAQGAEGIARRAYEGAQSGGVAV
FT                   QEAVEVMHHIAQKIGIIEEIARQTNLLALNAAIEAARAGEQGKGFAVVAAEVRKLAERS
FT                   QLAAAEIGTLSGRTVGVVERAGGLIAALVPQIQQTADLVAEIARTSEEQSQGVGQVNEA
FT                   VQQMEGGIDHNVVLLQQVSEMVTGLMGQVEQMERDLGVKHRGGRFGPQALGCKPYLP"
FT   sig_peptide     57757..57861
FT                   /locus_tag="Mmc1_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.613 at
FT                   residue 35"
FT   gene            59521..60642
FT                   /locus_tag="Mmc1_0055"
FT   CDS_pept        59521..60642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0055"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="KEGG: dde:Dde_1553 alanine dehydrogenase; TIGRFAM:
FT                   alanine dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding; Shikimate/quinate
FT                   5-dehydrogenase; alanine dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42584"
FT                   /db_xref="GOA:A0L3P1"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P1"
FT                   /protein_id="ABK42584.1"
FT                   /translation="MIVGVVKEIRNQENRVALTPDGVETLIQHGHAVWVEQQAGLGSGF
FT                   ADHHYTERGAQLCPTAAQVWQSAQLMLKVKEPQIQEYPLLQPEQMLFTYFHFAASQSLT
FT                   QAVIDAKCVAIAYETVENRAGHLPLLTPMSEVAGRMAIQESAKYLERAQGGRGILLGGV
FT                   PGVAPATVVVIGAGVVGTEAARMAAGLGAHVKVLDINLERLRAIADMLPANVTTLAATP
FT                   GTIREALQTADVVVGAVLLKGARAPKLISRALLKQMQPGAVIVDTAIDQGGIFETSRAT
FT                   THENPVFIEEGIIHYCVTNMPGAVPITATRALTNATLPYVVKLADMGWQAACRDDAGLA
FT                   MGLNIVQGQVVCQAVAQTFNLPHTPRATQLGVA"
FT   gene            complement(60705..62090)
FT                   /locus_tag="Mmc1_0056"
FT   CDS_pept        complement(60705..62090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0056"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: eli:ELI_12635
FT                   putative Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42585"
FT                   /db_xref="GOA:A0L3P2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P2"
FT                   /protein_id="ABK42585.1"
FT                   /translation="MFKHLLNHPLLGLFMLLNALVLPYSAHAEKSISLITDPEVMALMD
FT                   AMGKPLVEAAGLNATRVKFFVILDNNINAFALPNHYVVFHSGLLLKAKHYDEIAGVMAH
FT                   ELGHLKAGHHIKMKADARTALAKQVVGAALGIAAGMAGSGEGASALIMGGSAAARQGML
FT                   DSTRVKEQQADRLAVEYMVASSLDPNGVSRFFKTLYQLQRMNPVPPAYLSTHPLGLERL
FT                   QAGQDLIDRLQNQMGPFPIQEHPEWQQRLQRVQAKLEAAASDDPRAFLHQQQLKLRRLL
FT                   PGSSEHFAARYGSALAMRYAGQLGKAEQALRQLLKEQPNDPYLLRELGLALLDWGRPEQ
FT                   AIPLLRQAVAGAEAYPDMHYRLAVALHEVGQLDEAANILYRLTSKPIELLDPLYLLGVI
FT                   EGKRGNLSMSHIALARYEHRRLDTKRALWHYKQALKLLSEQDPLRRRIDLEIKAVKEEK
FT                   EQE"
FT   sig_peptide     complement(62004..62090)
FT                   /locus_tag="Mmc1_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.995 at
FT                   residue 29"
FT   gene            62251..62706
FT                   /locus_tag="Mmc1_0057"
FT   CDS_pept        62251..62706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0057"
FT                   /product="flagellar export protein FliJ"
FT                   /note="TIGRFAM: flagellar export protein FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42586"
FT                   /db_xref="GOA:A0L3P3"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P3"
FT                   /protein_id="ABK42586.1"
FT                   /translation="MAVNRFSRLVELRRLREEAQGGEYAKVLADLNALQQQVVDLDQET
FT                   EQARVDALEMVGNAASILSGEMLTGFFEGQKIRRKRLLTQISRTKPVVEAAKQRWLEAR
FT                   KGLRQAEILEEKTSQQLQKEALKVENRMLDMAGVVRHIRQRDKENML"
FT   gene            62706..63218
FT                   /locus_tag="Mmc1_0058"
FT   CDS_pept        62706..63218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd3399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42587"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P4"
FT                   /protein_id="ABK42587.1"
FT                   /translation="MNGMKKIVAVAVLAMAFMIQPVGAAQDQNGSPRDPVDLLKTLEIR
FT                   QNELETRAKVLDLKEQELKRMGEEVERRLKALTALREQVRQDILEEKQIDSNNIARLAR
FT                   IYSSMKPKVAAGQLKDLERETAVKVLKVLKEKVAAKIFDKMDPQDALPLADAIGMSLQK
FT                   RRMLRVQ"
FT   sig_peptide     62706..62780
FT                   /locus_tag="Mmc1_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.826 at
FT                   residue 25"
FT   gene            63688..64506
FT                   /locus_tag="Mmc1_0059"
FT   CDS_pept        63688..64506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0059"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pha:PSHAa0781
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42588"
FT                   /db_xref="GOA:A0L3P5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P5"
FT                   /protein_id="ABK42588.1"
FT                   /translation="MPLYINTNVASLNAQRKLTKSSDDLSTTFARLSSGLRINSARDDA
FT                   AGLAITNRMTSQIRGLNQAVRNANDGISVAQVAEGALDETTNALQRIRELAVQSANAIY
FT                   NSSDRLNLDKEVDQMLAEIQRISDDTQFNKLNVLDGTYVGQKFQVGAFSGQTITLSINS
FT                   ASLGLLGVTNLTISTQAGAEAALALVDNALDSISDVRANLGAIQSRFSAVIGNLSNVVE
FT                   NMSAARSRIQDADIAAETANLTKTSILQQAGTAVLAQANQQPQLALQLLG"
FT   gene            64649..65251
FT                   /locus_tag="Mmc1_0060"
FT   CDS_pept        64649..65251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42589"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P6"
FT                   /protein_id="ABK42589.1"
FT                   /translation="MSFHVRSHPWSLRADGSGESGWVHSPDGLYRVAAKGCHGEVLRQV
FT                   PGLGMVGRFLHMMGPMEMSDTAHVGVEGLARMAELADLGRPDGQAQRHIYELAELAMQG
FT                   RVTCDDREVLRVAVRRLMEAINAAANDEPYELEGGTLNPMGRLRDGQFVPLGMVEGLLV
FT                   DGVDRVMEPRHQTTFNQGQTGTDGRTASVLGESDVET"
FT   gene            65238..65969
FT                   /locus_tag="Mmc1_0061"
FT   CDS_pept        65238..65969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42590"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P7"
FT                   /protein_id="ABK42590.1"
FT                   /translation="MLKRNSQAAGGGTGCHSRAGLRLVARGSMPRWATQIELGWVRQLG
FT                   PMPVVRLQQGYLLAEVWREIRMAIRSVSRKGCSRLVGRVEREHAGGLLGVGRLMLLHGP
FT                   ETPSLRAQRSVGSHGQQVEVENLGAVFPLLMESRKPIQVPHSRTIGQWRIRNGRVIRSG
FT                   TLRRRPNGLMPRRGPLSNGVVEPHEGAMGWSIFNDGTSLLMGLPVERVEARSLGAWQVS
FT                   QAGEIERSARNRMIWRSMLDS"
FT   gene            66117..66887
FT                   /locus_tag="Mmc1_0062"
FT   CDS_pept        66117..66887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0062"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: neu:NE1593
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42591"
FT                   /db_xref="GOA:A0L3P8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P8"
FT                   /protein_id="ABK42591.1"
FT                   /translation="MLTRASNGLQTHYERLASGRRINSAADDASGLAITSRTTAQVRGF
FT                   NQASRNANDGISFLQVADGALEETHAMLQQLRELAVESANGSYNALDRGNMQQVVSELT
FT                   AEIQRIGSERKYNDHVMLDGTFANQTFQIGAFSSENITVTIASATASALGVEDLSFSTQ
FT                   AKAEAALATLDSALDAVSDIRLDLGAVQNRFMSAMGNLGSMSMHTSAMQSQMMDTDMAA
FT                   ETALLTRSSVIQQAGVAMLSQANQRPQLALQLLA"
FT   gene            67016..67822
FT                   /locus_tag="Mmc1_0063"
FT   CDS_pept        67016..67822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0063"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42592"
FT                   /db_xref="GOA:A0L3P9"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3P9"
FT                   /protein_id="ABK42592.1"
FT                   /translation="MALSVNPNAFWLNAQQSVNGSALGIGKSTEQRTSSKRAHVAKQDQ
FT                   QVLAAAAMTAKVRERNQESHATNDGISVIQVAQEALYQTTSTLEKVRCLTQVLEDGGVA
FT                   QQKEGVCEQIEVLLAEIDRIAAQTVFNQQTLISTGGWTGIVDLAPHQVICLTVGSATQR
FT                   ALGLDEMDLSERQGQKVEGVLKQVDNAMTSVADMRAQLGDMQVRFKEIIEQIAQVEAKN
FT                   GGVRIRSAQVAREAALHVKGSIQIFSDRSIVAQANQQPLLAVNLMN"
FT   gene            68873..69688
FT                   /locus_tag="Mmc1_0064"
FT   CDS_pept        68873..69688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0064"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42593"
FT                   /db_xref="GOA:A0L3Q0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q0"
FT                   /protein_id="ABK42593.1"
FT                   /translation="MALYVNTNVSSLNAQRKLNNSTNALSKTYERLSSGFRINSAADDA
FT                   AGLTVSTRMTAQIRGLNQAARNANDGISLVQVSEGALAETEAALQRMRELAVQAASGTY
FT                   TNTDRSDLNDELTQLVSEITRIATETKFNGMVTLSATQTFDIQVGADAGQKITINTTAA
FT                   GASALGVTAASITSAGLASAAITKIDAAIASVSDMRSVLGAQQNRLEAAIANLTNVSER
FT                   TQAARSRIMDADIAQETAALTRNAILQQAGTAILAQANQQPQLALSLLG"
FT   gene            69892..70707
FT                   /locus_tag="Mmc1_0065"
FT   CDS_pept        69892..70707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0065"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42594"
FT                   /db_xref="GOA:A0L3Q1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q1"
FT                   /protein_id="ABK42594.1"
FT                   /translation="MALYVNTNVASLNAQRKLNNSTNALSKTYERLSSGFRINSAADDA
FT                   AGLTVSTRMTAQIRGLNQAARNANDGISLVQVSEGALAETEAALQRMRELAVQAASGTY
FT                   TNTDRSDLNDELTQLVSEITRIATETKFNGMVTLSATQTFDIQVGADAGQKITINTTAA
FT                   GASALGVTAASITSAGLASAAITKIDAAIASVSDMRSVLGAQQNRLEAAIANLTNVSER
FT                   TQAARSRIMDADIAQETAALTRNAILQQAGTAILAQANQQPQLALSLLG"
FT   gene            70911..71726
FT                   /locus_tag="Mmc1_0066"
FT   CDS_pept        70911..71726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0066"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42595"
FT                   /db_xref="GOA:A0L3Q2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q2"
FT                   /protein_id="ABK42595.1"
FT                   /translation="MALYVNTNVASLNAQRKLNNSTNALSKTYERLSSGFRINGAADDA
FT                   AGLTVSTRMTAQIRGLNQAARNANDGISLVQVSEGALAETEAALQRMRELAVQAASGTY
FT                   TNTDRSDLNDELTQLVSEITRIATETKFNGMVTLSATQTFDIQVGADAGQKITINTTAA
FT                   GASALGVTAASITSAGLASAAITKIDAAIASVSDMRSVLGAQQNRLEAAIANLTNVSER
FT                   TQAARSRIMDADIAQETAALTRNAILQQAGTAILAQANQQPQLALSLLG"
FT   gene            complement(71868..72170)
FT                   /locus_tag="Mmc1_0067"
FT   CDS_pept        complement(71868..72170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sai:Saci_2354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42596"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q3"
FT                   /protein_id="ABK42596.1"
FT                   /translation="MSTLLTCPDLQLRGAHALCPIPEPLENRFTPLAGNLASLNQRFTP
FT                   LAGNLASLNQRFTPLAGNLASLNQRFTPLAGNLASLNQRFTPLAGPFWTSFPSPA"
FT   gene            72401..73216
FT                   /locus_tag="Mmc1_0068"
FT   CDS_pept        72401..73216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0068"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42597"
FT                   /db_xref="GOA:A0L3Q4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q4"
FT                   /protein_id="ABK42597.1"
FT                   /translation="MSMSIITNVASLQAQRKLSGTTNALSQTYERLSSGLRINGAADDA
FT                   AGLTISTRMTAQIRGLNQASRNANDGISLVQVTEGALQETEAALQRMRELAVQASSATY
FT                   TNTDRADLNDELTQLVTEITRIATETKFNGMVMLSATQTYDIQVGADAGQKITVSTTAA
FT                   GASALGVTAASITSAGLASIAIGKIDAAIASVSDMRSVLGSQQNRLEAAIANLDNVSER
FT                   TQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQLMLSLLR"
FT   gene            73748..74563
FT                   /locus_tag="Mmc1_0069"
FT   CDS_pept        73748..74563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0069"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42598"
FT                   /db_xref="GOA:A0L3Q4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q4"
FT                   /protein_id="ABK42598.1"
FT                   /translation="MSMSIITNVASLQAQRKLSGTTNALSQTYERLSSGLRINGAADDA
FT                   AGLTISTRMTAQIRGLNQASRNANDGISLVQVTEGALQETEAALQRMRELAVQASSATY
FT                   TNTDRADLNDELTQLVTEITRIATETKFNGMVMLSATQTYDIQVGADAGQKITVSTTAA
FT                   GASALGVTAASITSAGLASIAIGKIDAAIASVSDMRSVLGSQQNRLEAAIANLDNVSER
FT                   TQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQLMLSLLR"
FT   gene            75111..75926
FT                   /locus_tag="Mmc1_0070"
FT   CDS_pept        75111..75926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0070"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42599"
FT                   /db_xref="GOA:A0L3Q6"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q6"
FT                   /protein_id="ABK42599.1"
FT                   /translation="MSLYINTNIASSNAQRQLLKSTNALGKTYERLSSGLRINSAADDA
FT                   AGLTVSSRMTAQIRGLNQSARNANDGISLVQVAEGALAETEAALQRMRELAVQAASGSY
FT                   TNTDRSDLNDEVTQLVSEITRISTDTKFNGVSLMSSNQTFDIQVGADAGQKITVSTTAA
FT                   GASALGVTTASITSAGLASIAIGKIDAAIASVSDMRSVLGAQQNRLEAAITNLSNVSER
FT                   TQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQLMLSLLR"
FT   gene            76171..77304
FT                   /locus_tag="Mmc1_0071"
FT   CDS_pept        76171..77304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0071"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42600"
FT                   /db_xref="GOA:A0L3Q7"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q7"
FT                   /protein_id="ABK42600.1"
FT                   /translation="MTGSMRVGSIAEGVRMTGVNTPVREPTAEVPTQIEWTGHGEGDDR
FT                   DRETRVPWGRAALYKVRSRDRYGIGLGSERGQDRWPMTPWKEGLLGENSDSESQRMSRA
FT                   FTMFMYLNAYRATDRLQRKLKSSSQELGKAYVRLASGYRINGASDDAAGLAVSTRMTAQ
FT                   IRGLNQSARNANDGISLVQVAEGALVETEAALQRMRELAVQAVSGTYTDSDRSDLNDEV
FT                   SALISEITRISTQTTFNGAVLMSSTMTFDIQVGADVGQKITVSTAAAGASALGVNTTSI
FT                   TSVGLASVAITKIDAAIARVSDMRAVLGVQQNRLEAAVHNLSSLCAHTEVARGRIMDVD
FT                   MAQETANLTKQSILQQTGAAMLAQANQQPQLLLGLLR"
FT   gene            77939..78754
FT                   /locus_tag="Mmc1_0072"
FT   CDS_pept        77939..78754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0072"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42601"
FT                   /db_xref="GOA:A0L3Q8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q8"
FT                   /protein_id="ABK42601.1"
FT                   /translation="MSMYINTNVASSNAQRQLSKSTNALATTFERLSSGLRINSASDDA
FT                   AGLTVSTRMTAQIRGLNQSARNANDGISMVQVAEGALAETEDALQRMRELAVQAASGSY
FT                   NNTDRSDLNDEVTQLVTEITRISTDTKFNGVSLMSSNQTFDIQVGADVGQKITVSTQGA
FT                   GASALGVTTASITSAGLASIAIGKIDAAIASVSDMRSVLGAQQNRLEAAITNLENVSER
FT                   TQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQLMLSLLR"
FT   gene            79378..80193
FT                   /locus_tag="Mmc1_0073"
FT   CDS_pept        79378..80193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0073"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pca:Pcar_1115
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42602"
FT                   /db_xref="GOA:A0L3Q9"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Q9"
FT                   /protein_id="ABK42602.1"
FT                   /translation="MSLYINTNIAASNAQRQLTKSTNALGKTYERLSSGLRINSASDDA
FT                   AGLTVSSRMTAQIRGLNQSARNANDGISLVQVAEGALAETEAALQRMRELAVQAASGSY
FT                   NNTDRSDLNDEVTQLVTEITRISTDTKFNGVSLMSSNQTFDIQVGADVGQKITVSTQGA
FT                   GASLLGVTTASITSAGLASIAIGKIDAAIASVSDMRSVLGAQQNRLEAAITNLSNVSER
FT                   TQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQIMLSLLR"
FT   gene            80287..80652
FT                   /locus_tag="Mmc1_0074"
FT   CDS_pept        80287..80652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42603"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R0"
FT                   /protein_id="ABK42603.1"
FT                   /translation="MSMERDKTFVSEEQPFRRLYWTAVPVLQTQTSAAVRSNRAWGSLR
FT                   AAAGRAAREMDDLGCLLEELGGSTASAEETQQAQHAVHFMRRIMAETVAFEARLEHMAP
FT                   ASSSLFPAYGDDEVLPH"
FT   gene            complement(80649..81017)
FT                   /locus_tag="Mmc1_0075"
FT   CDS_pept        complement(80649..81017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42604"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R1"
FT                   /protein_id="ABK42604.1"
FT                   /translation="MLNGAVITQPCCFRSVPAENPIHHPILDGGCLHLSIVPVKNPFFT
FT                   IPDKALNNPSSQLIASPAQPYLLSWLLCQSFKPIRHLWADPAKKSVPTPSGEGTLSKGR
FT                   GHDVKRHTHGDRANARPP"
FT   gene            81137..81964
FT                   /locus_tag="Mmc1_0076"
FT   CDS_pept        81137..81964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0076"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: ade:Adeh_1342
FT                   flagellin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42605"
FT                   /db_xref="GOA:A0L3R2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R2"
FT                   /protein_id="ABK42605.1"
FT                   /translation="MGLTIYGNVFSLDAHRARSRRSDLSDRGTFKRLISRIEPDAGEPA
FT                   VLDMLRDYRRANRLRTVNQARQNANAGISTIQVAEQALRETESALQRIQEITSRPLDGE
FT                   PVEGSKRAKYDQEVAQLVRDIDGLAGESQRHSMRLMRGGLSSHSFAVGVDQPEEICFTV
FT                   DDTSSAQMGVEASVAWDDPQLALDALANIHRAMNRVAQVRQELDQVHNRFNTVLERLSS
FT                   LSEQALTERRGIESAQEAETVVAGLHSALSQQAEAAITMQANQHTMLVNLLLN"
FT   gene            82288..83112
FT                   /locus_tag="Mmc1_0077"
FT   CDS_pept        82288..83112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0077"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: mfa:Mfla_1986
FT                   flagellin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42606"
FT                   /db_xref="GOA:A0L3R3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R3"
FT                   /protein_id="ABK42606.1"
FT                   /translation="MALTINTNMAALIASKNLNNVQGSLNKSFQRLSSGLRINSAADDA
FT                   AGLSQASRMSSTIRGSNQAIRNTNDGISIAQVAETALNETESALQRIRELTVQAANGTM
FT                   TTTDRSDISKEVQALAAEIQRISTDTKFNGNTLLSTGGFSAYIKTNAEATAATVAVQVG
FT                   SATSTALGIYQTLSFATASKATSALTAIDNALSSVSSMRASLGAVQSRLESVVSGLQGI
FT                   VENTTSARSRIMDADVAAETTNLTRSAIIQQAGVAILAQANQQPSIVLALLS"
FT   gene            complement(83294..84106)
FT                   /locus_tag="Mmc1_0078"
FT   CDS_pept        complement(83294..84106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0078"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG: cbu:CBU_1133
FT                   inositol-1-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42607"
FT                   /db_xref="GOA:A0L3R4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R4"
FT                   /protein_id="ABK42607.1"
FT                   /translation="MNPAPALHVAIRAARRAGQIALQQFDRPEKLEIHEKAPHDLVTSA
FT                   DLAVEKELMDQLSRGYPQYGFLTEESGSHRPHAEFQWIIDPIDGTTNFVRGIPHFAISI
FT                   ALARRGEVVAGVVHDPFKDETFTAEKGGGAFFNERRIRVSGQERLSHALLGTGFPFRHR
FT                   SVMPSYLKAFGQVMENVSEVRRAGSAALDLAYVAAGRFDGFWEMRLAPWDIAAGQLLVT
FT                   EAGGYVCSVTGEKDYMKSGDIVAATPGIHEKLLHLLQGAGLHQAPKRG"
FT   gene            84532..86298
FT                   /locus_tag="Mmc1_0079"
FT   CDS_pept        84532..86298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0079"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   KEGG: lic:LIC13451 flagellar hook-associated protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42608"
FT                   /db_xref="GOA:A0L3R5"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R5"
FT                   /protein_id="ABK42608.1"
FT                   /translation="MQGKMAVTISSLLNISKTGLLSNQYALSSVSQNIANVNTAGYSRQ
FT                   TAALTSNQGALRGNTDGIGGGVAVSDLKRSVDALVDNRIQLGLGEKGRLETRNQYLNMI
FT                   ENVFNDQDGDGLSTRLDEFFSMVDKLADNPTSPASRAELVASAQNVTNFANKMYDDLAG
FT                   LALPVDQEIDVLVNTINTKLKSLAEVDSAIQLREKTNNPALDLKDQRDEMIRELSGMID
FT                   VQVLSNQDGSTTLMTAGGELLMDHGFTATFGRGALDTTTGFAGITVNGKSGDYTDKLSS
FT                   GSLKALLEVRDQVVGGSSGYLTKLESIVDELRFQVNSITSTSSSMYLNQSQTGVFDLGT
FT                   QTATAVNAQDYTTVNAPPPDLGRVVDGTVTFAYGSDANNLSFDSVNITSSMTIDEVVAA
FT                   LNASNAVSASVNANNQLSIAAKSTYYAVSADSSNIMAAMGIGALFGGTGASNMAVNSEM
FT                   VADQTTVPVGRIRTDANGLPQFDNADNDGVLALGDLRNTKFTLFGESLTLSAHYASTIS
FT                   QLGAEQASNEEQLGAATSTYNFMQQVRASISGVSLEEELTDLMRFQRAFQASSKMVVTA
FT                   DELLQSVIGMVR"
FT   gene            86321..87526
FT                   /locus_tag="Mmc1_0080"
FT   CDS_pept        86321..87526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0080"
FT                   /product="Flagellin and related hook-associated
FT                   proteins-like protein"
FT                   /note="KEGG: sat:SYN_02811 flagellin and related
FT                   hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42609"
FT                   /db_xref="GOA:A0L3R6"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R6"
FT                   /protein_id="ABK42609.1"
FT                   /translation="MLRVTQSTLYSTTVTQLQDQYRTMSQIQEKSTSGQEVNRPSDDPT
FT                   IAYRDMLFSTQLSEVDALVRTTDLASERMRMAETNLSTMEGKMLDAQQLVLTLGTAVQS
FT                   GQPSVFNAAAREAQAIYEDLLSSVNAELDGVPLFSGGKTTLPYSESNLTTSAVKIREGG
FT                   QGQVKATTGYSAALTGTPTDIPASVRVIYRSTDDAGTALATPQYQVNVNGVEGSTIDST
FT                   GFPQTLDLGDGMQLQVDSAPGDKDALFFEVVPAYQGGAADREVRIATGQRLEGNVTGEE
FT                   VMQGTGNGRGADVFAAVAGLRGALLRNDYEEINAWLTPVQDGRAQIQDLEAVTGVRTVL
FT                   MESVNDSLELDSDALKTVKAVNISVDAFDIYSQLQQTSQAMQMMTASERQILDNSLLDF
FT                   IR"
FT   gene            87557..88045
FT                   /locus_tag="Mmc1_0081"
FT   CDS_pept        87557..88045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0081"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   dsy:DSY3025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42610"
FT                   /db_xref="GOA:A0L3R7"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3R7"
FT                   /protein_id="ABK42610.1"
FT                   /translation="MEIQGTRFGTLEFDEKEIIYLNEGLLGFPLSKQFLMFPYGEDSSF
FT                   FWLQSVDEPEIAFIVINPFDFFSDLEFAVEDEDASSLVLARSEDVEIFTLVTIPEGRPE
FT                   EMRTNLAGPVVVNVQNRLGKQILCKDYSPRQPLIPDSMRSQLKEQARSSKGGHVAGGR"
FT   gene            88268..89086
FT                   /locus_tag="Mmc1_0082"
FT   CDS_pept        88268..89086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0082"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: pha:PSHAa0781
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42611"
FT                   /db_xref="GOA:A0L3R8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R8"
FT                   /protein_id="ABK42611.1"
FT                   /translation="MALYINTNVASLNAQRNLSNSTGKLGTTFSRLASGLRINSARDDA
FT                   AGLAITQRMTAQIRGLNQAIRNANDGISVSQVAEGALDETTNALQRIRELAVQSANAIY
FT                   NSSDRLNLDKEVDQMLAEVQRISVDTEFNKLNVLDGTYTGQAIQVGAFASQTITISIAG
FT                   AQLSHLGITNVTISTAAGATAALSLIDLALDSIADVRANLGAIQSRFGAVTANLSNIVE
FT                   NMSASRSRIQDADIAAETATLTKNAILQQAGTAVLAQANQQPQLALQLLG"
FT   gene            89154..89534
FT                   /locus_tag="Mmc1_0083"
FT   CDS_pept        89154..89534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0083"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="PFAM: flagellar protein FlaG protein; KEGG:
FT                   cvi:CV3877 Flagellin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42612"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3R9"
FT                   /protein_id="ABK42612.1"
FT                   /translation="MMQISAISQSYVPYEVWVRVGERALSQDSDRAVVGRDGEKAQEAA
FT                   KIADLGSDVSRLLEKNVKKLENALSAFTSLRFAVDRDTEERVVRVVNRQTNEVIRQIPT
FT                   EEMLTLSRRLRNAQSLLLETTA"
FT   gene            89589..91028
FT                   /locus_tag="Mmc1_0084"
FT   CDS_pept        89589..91028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0084"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein; KEGG: gme:Gmet_0444
FT                   flagellar hook-associated protein 2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42613"
FT                   /db_xref="GOA:A0L3S0"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S0"
FT                   /protein_id="ABK42613.1"
FT                   /translation="MATGSITFGGLASGLPADIVDQLMQSEQARLTKMNQTSNQVSATK
FT                   STYSSLESQLLALKSKAEDMQSADFFRPHTATSSDEDVATISADSDAQEGNHSITVNQL
FT                   ATYDTFVSKGSVTTTTAGLSADTTFSFDYNGTSYSVALTAGDTLADIADAITNTTYDNE
FT                   DDGEGVTASVLYDGSNYRLLLNARDSGTNSGASRLDLSGAADLAFDSGETITGGVTGSN
FT                   DNSAWWNSVAGVDASLTVDNIAVTSTTNEVSDVLAGIKMSLKSTGNFTISITNDEETLK
FT                   TNVQSFVDSFNSVISFINNNKSSFGGDSLARNTINMLRAEINTPTSDSSSPYSELSTYS
FT                   TLSSIGIKTDRSSGLLSIDSTDFSEAMSNGFSKIASIFTSKPSSADETAFETAGGNEGL
FT                   SYRMESLVYSLTTDTDNPFDAKSSGLQARLDSMATSIEREESRLEKVRDRLTKQYANLE
FT                   QLMSQMQSTQSALTSALAGLS"
FT   gene            91126..91491
FT                   /locus_tag="Mmc1_0085"
FT   CDS_pept        91126..91491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0085"
FT                   /product="flagellar protein FliS"
FT                   /note="PFAM: flagellar protein FliS; KEGG: bba:Bd0611
FT                   flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42614"
FT                   /db_xref="GOA:A0L3S1"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S1"
FT                   /protein_id="ABK42614.1"
FT                   /translation="MAAIQVKQEQVVPSQDQLGLLIDLYEGAIRFLEQAVQAGQAGDMV
FT                   GFRTNLGRGRRIIQEFQRTLNPRHGGDVPSQLNRLYQFMIDTLNEVDLTGETAPVKQVV
FT                   GQLGTLLDAWRGVVPML"
FT   gene            91595..92116
FT                   /locus_tag="Mmc1_0086"
FT   CDS_pept        91595..92116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0086"
FT                   /product="flagellar protein FliS"
FT                   /note="PFAM: flagellar protein FliS; KEGG: bba:Bd0611
FT                   flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42615"
FT                   /db_xref="GOA:A0L3S2"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S2"
FT                   /protein_id="ABK42615.1"
FT                   /translation="MSYGLRSYKSSRANTASREDLLILLYEGAIRFLEKSLQAHTAGTL
FT                   SEHKMMLQRAMAIISELQNTLDFEKGGDLAMQLFDLYNYMLDRLTKANINRDMSAISEV
FT                   IEHLNVLLDGWRQAVAQVKRQGGMAALVANGGSASTDPVDTVTASKPVAPRPQQKAPGA
FT                   LPRLSRPQVL"
FT   gene            92165..92506
FT                   /locus_tag="Mmc1_0087"
FT   CDS_pept        92165..92506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42616"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S3"
FT                   /protein_id="ABK42616.1"
FT                   /translation="MEHHIRELKRILDALEAPDGMDSAKIHTLELEMKQVESAIVESAK
FT                   LPWPEAQRKKWGDRLDEQVRRMPSIQARLLQERGRISAQLMNENRRVKRMRDDRASVAV
FT                   NNRVIGRTA"
FT   gene            complement(92618..92691)
FT                   /locus_tag="Mmc1_R0001"
FT                   /note="tRNA-Gly4"
FT   tRNA            complement(92618..92691)
FT                   /locus_tag="Mmc1_R0001"
FT                   /product="tRNA-Gly"
FT   gene            complement(92776..93432)
FT                   /locus_tag="Mmc1_0088"
FT   CDS_pept        complement(92776..93432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42617"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S4"
FT                   /protein_id="ABK42617.1"
FT                   /translation="MVERLPADPFERIQAGLKISLERPMLSNELTMPGVKREDPDSVRP
FT                   LEEEWQAARQRIAQFNAQRNWMGVLNTLLEMSNNDRHPEAYLARLQAAWLVVKLPQAPV
FT                   SHVVIVLYNLLASLESGHPAAGPLAALANLMALHRTPDHPERELAQMQAQQMWDMAAHN
FT                   LGIEPGSHFESWMERNGLNDPNSFVPRIMGMLEKMENRPWWIDKEAIQEDMMQQA"
FT   gene            93583..93849
FT                   /locus_tag="Mmc1_0089"
FT   CDS_pept        93583..93849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42618"
FT                   /db_xref="GOA:A0L3S5"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S5"
FT                   /protein_id="ABK42618.1"
FT                   /translation="MQETEKRFFLWRFIDDLDWFVLIVVAIMLGAVPFGEPHLWQKLTM
FT                   LAAGTLTKPLDIFDLCMHGTPSVLLAIKAIRHYGGFAPVKEKS"
FT   gene            93846..94439
FT                   /locus_tag="Mmc1_0090"
FT   CDS_pept        93846..94439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0090"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: lic:LIC20099 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42619"
FT                   /db_xref="GOA:A0L3S6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S6"
FT                   /protein_id="ABK42619.1"
FT                   /translation="MNICLIGMRGSGKSNLSRRLSVLTKRTVFSTDALISYEQEGQSIE
FT                   EIVRNAARGWHDFRDLEYQVVRRAARMQGVIIDCGGGVIVDLDSQGSEVYSSRKVGALK
FT                   RSGIVVWLRGDVDRLVQKAQTKAMAEDPNRPQLDTTQSLKALMEHRLPFYEKAADIILD
FT                   IDGKKRRDLAVELMKRTSDAAWHSMVMRRGQELD"
FT   gene            95149..95442
FT                   /locus_tag="Mmc1_0091"
FT   CDS_pept        95149..95442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42620"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S7"
FT                   /protein_id="ABK42620.1"
FT                   /translation="MTHAMDIHGARVYDRLSRPAAPQQNRVQQVSDAPSGRTAAPVRDQ
FT                   VTISASVERVTDAIDTLVADTLDNMPGRWDARIEREALEQSMISLRLGTLYA"
FT   gene            complement(95540..95830)
FT                   /locus_tag="Mmc1_0092"
FT   CDS_pept        complement(95540..95830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0092"
FT                   /product="integration host factor, alpha subunit"
FT                   /note="TIGRFAM: integration host factor, alpha subunit;
FT                   PFAM: histone family protein DNA-binding protein; KEGG:
FT                   ade:Adeh_1969 integration host factor, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42621"
FT                   /db_xref="GOA:A0L3S8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3S8"
FT                   /protein_id="ABK42621.1"
FT                   /translation="MTMTKADIVQTVYQRLGLSKKESADIVESVFELIRNQLENGDPVK
FT                   ISGFGNFTMREKNPRQGRNPKTGEEVEISARRVVTFKASQILLNKVNNGKG"
FT   gene            96408..97709
FT                   /locus_tag="Mmc1_0093"
FT   CDS_pept        96408..97709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0093"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: psp:PSPPH_4384
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42622"
FT                   /db_xref="GOA:A0L3S9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3S9"
FT                   /protein_id="ABK42622.1"
FT                   /translation="MDQRGGTMSRSASLFQQAAGLIPGGVNSPVRAFKSVGGIPPFIRE
FT                   AAGAMMTDEDGKSYIDYVGSWGPMILGHAPKEVVAAIQQAAVRGCSFGAPTSNEILLAQ
FT                   KLIELVPSLEMVRLVNSGTEATMSALRLARAATGRDAILKFDGCYHGHADSLLVAAGSG
FT                   LATFGVPSSPGVTRGTAKDTLTVPFNDLAAVEACFAQHPEGIAAVIVEPVAGNMGCVLP
FT                   RPGYLKGLRDICTKYGTILIFDEVMTGFRVDLRCAQGFYDVTPDLTCLGKVIGGGLPVG
FT                   AYGGKMELMNQVSPAGPVYQAGTLSGNPLATAAGLATLEAISQPGFYETLTSRTQRLTV
FT                   GIGKALDEAGIPHVSYHIGSMFGLFFTDAREVYNFADAAKNDHNRFKDWFHCMLEEGVY
FT                   FAPSPYEAGFVSIAHDEAIIDLTIEKARKVAKTL"
FT   gene            complement(97882..99483)
FT                   /locus_tag="Mmc1_0094"
FT   CDS_pept        complement(97882..99483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42623"
FT                   /db_xref="GOA:A0L3T0"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T0"
FT                   /protein_id="ABK42623.1"
FT                   /translation="MNQRNHFRLHDPSIPTYVRRLIPSKRATTLKRGEGGALEGKWQKV
FT                   TLWDLSAGGYSFVFPEESLRPGDKMEVRIAIAQVEEVPPMQMRSMIVGGRNHDKFGAYR
FT                   YFCKFDSMRPNEAETLARHIQNRQRLQLMEESQKNWEEDAEWEAQANAWDEQALTPEGT
FT                   DDQQTDENAKPKKKRAFRFGQALPTVAMEKTEDAPAQPPPKKDRAFDRVDEVIPFVWRK
FT                   ITPAEYAEAETLFQAGQPLPQAFKSGYQPINVDPLKRCWAVIQVQSPGAAMNLQKLWQR
FT                   IDSLCAQVSANKKVNLFVPLRDQLVKTTNLLVNHNMVSAAQTETLDRIETILADVVSDH
FT                   GRATAESRKQRRELVKRVRDDVRNLKRSGTSQSDGIPELFERLTDVIDKINIFGYDHVF
FT                   GHAPQDLNLSGGGIAFVEEASKSASQSLLKRSDKEEGGSEIVSLKRGDCVVVRVGLHAD
FT                   PWRWVFAYGKIVMVKSLSRRASAQMDKDGGILPPRRVAVEFTLIGKEDVQALIAATHSK
FT                   QLDERRKAYAEDDQIY"
FT   gene            99703..100650
FT                   /locus_tag="Mmc1_0095"
FT   CDS_pept        99703..100650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0095"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   tbd:Tbd_1103 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42624"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T1"
FT                   /protein_id="ABK42624.1"
FT                   /translation="MRGRLIFCLLYFIMLPLHAGEKVRAYPPVQVADGVYVMHGPLGVP
FT                   SVANQGFMNNPAFIITQTGVVVIDPGSSVQAGRMVVEQIRTVTEKPVTHVLNTHVHGDH
FT                   WLGNHGIVEGYAGVQILAHPAMIEEALGSQAERWLEYMVKATEGFTQGTQAVIPTVPVG
FT                   DDTVLTLGGVRMEILAPPKAHSGTDMMIYLPSQRLLFTGDNVTSERFGRLDDGTFKGGI
FT                   AACDRALERPVEVVVPGHGATGGVGLIAVYRTYLRTLYDTVKVLYDEGTLDTPHAMKPR
FT                   VVEALSVYHDWVDFDEMVGRHISAAFQQVEASEF"
FT   sig_peptide     99703..99780
FT                   /locus_tag="Mmc1_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.651 at
FT                   residue 26"
FT   gene            complement(100922..101356)
FT                   /locus_tag="Mmc1_0096"
FT   CDS_pept        complement(100922..101356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42625"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T2"
FT                   /protein_id="ABK42625.1"
FT                   /translation="MGAVWVPTTVCSIKPVKTQGSHRFRPAGGDFPLRVLLLIFWARPS
FT                   LRELSGLFLPLSNQRATLLIPYWGSLASFSKEAPIGDAKCPCGVSVRAVVGKWRGSPPS
FT                   HSVSKRGFHPSHLGPNRPPRWRVTSLPYAPYRTPTKPVLS"
FT   gene            101607..102569
FT                   /locus_tag="Mmc1_0097"
FT   CDS_pept        101607..102569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0097"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase;
FT                   KEGG: mca:MCA1096 sigma-54-dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42626"
FT                   /db_xref="GOA:A0L3T3"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T3"
FT                   /protein_id="ABK42626.1"
FT                   /translation="MTPHDPKQEILTRTPEMESVMRAATLVAQTNVTVLITGESGTGKE
FT                   RIGHLVHAESRRNKGPWVPVNCAALQDNLAESELFGHVRGAFTGATDAHQGRVRASSGG
FT                   TLFLDEVGELSLPLQAKLLRLLENSECQVVGQAQPVRVDIRIVAATNVDLAQRVREGLF
FT                   REDLFYRLNIAPLTLPPLRDRPRDIPLLMDHFLLEAAARFERKPPRFTSKALQQIQNHR
FT                   WPGNIRELLNFCTRMVIYHGGEEVDLPALPVELRGTVPEVASGSPFDLPSQGVDLTAVE
FT                   RGLIKQALERATGNKSKAARLLGLTRDTLLYRLKKHTLD"
FT   gene            complement(102678..103601)
FT                   /locus_tag="Mmc1_0098"
FT   CDS_pept        complement(102678..103601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0098"
FT                   /product="dihydroorotate oxidase B, electron transfer
FT                   subunit"
FT                   /EC_number="1.3.98.1"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   noc:Noc_0363 dihydroorotate dehydrogenase electron transfer
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42627"
FT                   /db_xref="GOA:A0L3T4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T4"
FT                   /protein_id="ABK42627.1"
FT                   /translation="MSQAMRPKLCRETAQVVFNRALPGDQYVIRLRAPGLAQGCRPGHF
FT                   AQVDCGPTTTLPRPLSILDADAAAGTVDIFYKVVGRGTELMAQWQAGAEVTLMGPVGRT
FT                   FTLIDAPKRAVLIGGGVGAAPVDFLARTLAGRGVECTLFLGMESESPFVLEQAKQPLPG
FT                   VERSIILALAPLQGAGVRSRMAALTPRQGWFTGYVTDLAAAYLAALTDQQREETVLYTC
FT                   GPTPMMAAANRVAKRFALSGQASMEEHMACGFGGCAGCVAPIRVGGALGWNYRRVCVDG
FT                   PVFDLDEIAWEQMGYAPAPVQACGCP"
FT   gene            complement(103804..104160)
FT                   /locus_tag="Mmc1_0099"
FT   CDS_pept        complement(103804..104160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42628"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T5"
FT                   /protein_id="ABK42628.1"
FT                   /translation="MSETQLVENKLITAYLPDDGSDKEVLKALHGKGIYTANSVGLRGI
FT                   SMLRPAKGKAGRLPESEAVKMVTVMVAGEEADEMFEFIFDKGHVGRQGGGFMFVSTLSA
FT                   ATLFTLPEDVQAEH"
FT   gene            complement(104173..104538)
FT                   /locus_tag="Mmc1_0100"
FT   CDS_pept        complement(104173..104538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0100"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mma:MM0930 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42629"
FT                   /db_xref="GOA:A0L3T6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T6"
FT                   /protein_id="ABK42629.1"
FT                   /translation="MSERNITYLTDVSLITCIVQRGLGDVIVKAAREAGAQGATVYYAK
FT                   GSGVRERLGALGVAVEVEKEVVNLVVSKEQQDLVFNSAYLAGNLDTPGMGFMYVTPLEK
FT                   AATYIPHEVIQRLQQAS"
FT   gene            complement(104535..106340)
FT                   /locus_tag="Mmc1_0101"
FT   CDS_pept        complement(104535..106340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0101"
FT                   /product="protein of unknown function DUF1538"
FT                   /note="PFAM: protein of unknown function DUF1538; KEGG:
FT                   wsu:WS0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42630"
FT                   /db_xref="GOA:A0L3T7"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T7"
FT                   /protein_id="ABK42630.1"
FT                   /translation="MGQNYRYGDYQREATIERNEISYNNLTPKLERDEQGHYKPYSPPP
FT                   VKLRSVDVFKLLKPYISVRFMDQLKAVVPLAIYLALFQFFVLRQLVQDSFSITAGLFAV
FT                   CLGLMFFMEGLKLGLMPFGEVIGNTLPKKSPLPVVLLIAFLLGIGVTFAEPAIGALKQA
FT                   GQIVSVERAPYLYTLLNDWSGVLVLVVGGGVGLAAILGTLRFLYGWSLKPMVYLSLAPA
FT                   LALTMYASGNPELTKILGLAWDCGAVTTGPVTVPLVLSLGIGIAAAAGKGDSGLSGFGI
FT                   VTLASIFPIIGVLILSLVVANTVTPEEIIAAAKIASAAAPVGPAPWYESSPGVEVILGI
FT                   RAILPLVLFLYLVLRYLLKEQVKNAGEITYGITLTIVGMCVFNLGLTYGLSALGEQSGS
FT                   LVPASFIEIKIAAAGMYTAYGPIYSAIVGMILSLGFAWVLGFGATLAEPALNALGATVE
FT                   NLTNGVFKKQTLMIAVSIGVAFGLAIGLAKLIFELPLQWLLIPSYALGIILTYFSTEEF
FT                   VNVAWDSAGVTTGPITVPLVLAMGLGFGNAVDALEGFGILSMASICPILSVLITGLWVR
FT                   YRAKTQAKAATHAGSASPDKEVQTI"
FT   gene            complement(106509..107795)
FT                   /locus_tag="Mmc1_0102"
FT   CDS_pept        complement(106509..107795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0102"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: gsu:GSU1272 dihydroorotase, multifunctional
FT                   complex type; TIGRFAM: dihydroorotase, multifunctional
FT                   complex type; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42631"
FT                   /db_xref="GOA:A0L3T8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3T8"
FT                   /protein_id="ABK42631.1"
FT                   /translation="MMRTESLFIRGARVVDPANERDEIADILIVDGVIREIGKLDAPAH
FT                   VPVIEADGLIAAPGLVDMHVHLREPGYEYKETIAGGTRAAAAGGVTSVAAMPNTKPVND
FT                   DPSVTGYMLDKARVAGFANLFPIGAVSKGLQGKEITEMGLLQAAGCVAFSDDGLPIMNS
FT                   GLMRRALDYSRAFGGLIIQHAEDSGLVGCGCMNEGEVATRLGLSGICNAAEDILVERDI
FT                   RLVELTGGRYHVAHISSAGAVASVAKAREKGLRVSCEAAPHHLVLNDTHVGNYDTNAKM
FT                   APPLRNQRDVNAIQEALARGVISVIATDHAPHEEDSKRVPFCQAANGVVGLETLLPITL
FT                   ELVEAGVLPLAKALAAISCNPARLLGMPRGTLSLNAVGDVVLFDPQQSWTVDALALHGS
FT                   SKNTAFAGRQVKGRVKYTILAGRIVHQEA"
FT   gene            complement(107792..108781)
FT                   /locus_tag="Mmc1_0103"
FT   CDS_pept        complement(107792..108781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0103"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain; KEGG: pca:Pcar_1615 aspartate
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42632"
FT                   /db_xref="GOA:A0L3T9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3T9"
FT                   /protein_id="ABK42632.1"
FT                   /translation="MDPEQNAWTRRHMLGMDGLARHEIGAILDSAQAFRDVNYREIKKV
FT                   PTLRGKTVINLFYENSTRTRTSFELAGKRMSADVINISASSSSAAKGETLLDTVATLQA
FT                   MRPDVVVLRHGDSGAPHFLARHLDAGIINAGDGQHEHPTQSLLDLLTIQDHLEEMGKSS
FT                   FEGMNVAICGDVLHSRVARSNAFALRTLGANVRFVGPPTLMPSEATKVFGVTVHHNMEE
FT                   GLRGVDVIIMLRLQLERMTSAYLPSVREYFAYWGLTRGRLELTQPHALVMHPGPINRGV
FT                   EIASDVADNPNRSVILEQVANGLAVRMAVLYHLCTGAARNSAQLGESL"
FT   gene            complement(108831..109379)
FT                   /locus_tag="Mmc1_0104"
FT   CDS_pept        complement(108831..109379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0104"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: dra:DR1110
FT                   pyrimidine operon regulatory protein PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42633"
FT                   /db_xref="GOA:A0L3U0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U0"
FT                   /protein_id="ABK42633.1"
FT                   /translation="MNAILENTLMTPDQIHQAITELAETILPSISDPTQWCVVGIRRGG
FT                   AVIAQQLRDSLSASLQVKLPIGFLDITFYRDDLSTIGPHPTVGATDLGLLDVEHARVIL
FT                   VDDILYSGRTVRAGLDALFAFGRPELVKLAVLVDRGHRQLPIQPDFCARQVPTELHDNL
FT                   KVVTHADQRLSLVHTRALP"
FT   gene            109450..110055
FT                   /locus_tag="Mmc1_0105"
FT   CDS_pept        109450..110055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0105"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pfl:PFL_0541 ADP-ribose
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42634"
FT                   /db_xref="GOA:A0L3U1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U1"
FT                   /protein_id="ABK42634.1"
FT                   /translation="MVKLLTLEPLSSGFLKVVRAVVDYQRSDGGRSGPHPLECVKRPPA
FT                   AVMIPYDPRRDELILVRQFRIGAYMEDSSRGWALEFPAGLCDQESDPMQTARRELLEET
FT                   GYQAISVEPVMTFLVNPGFVSERIHLFLTIIDAEHPVALGGGLEHEQEDIQTLRVTYDE
FT                   ALAMVADGRMDGGPPILALQWLTLNRARIRAEAAALHE"
FT   gene            110180..111577
FT                   /locus_tag="Mmc1_0106"
FT   CDS_pept        110180..111577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42635"
FT                   /db_xref="GOA:A0L3U2"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U2"
FT                   /protein_id="ABK42635.1"
FT                   /translation="MHGSSPSVSLLRWLPALFLLVLGLVYLWLNLPEWSVKHYPDSNSY
FT                   LLLEKQTFIEALSHVRTMGYPAFAWALKTLTGSYAAVPVVQYVLHLLAALLLWYGLCVY
FT                   GLRPWSALVVTLPVLFANIIRYFSHALLSDALGATLVVVVVALLLLYIARPWQWGYGVA
FT                   LAVAVFVAFQVRPANQVLVPMLVLVGGLLYGMRPARLRSDGAMGFWSMLGRLSAAGFVP
FT                   LLGFFTLRLLLVGHFGLVAATGIPLIGIAGSLITPDLLPQIREEVRPLAQTIVDDREKD
FT                   GMEVPFSTLGWIRYGEWYRQYDWNNYHNTVLAHARRMHNGNHVMADQSLQQLAVQVLRL
FT                   RFSYYAKWIMAAAGDALGVLLRRDFNLQLTGLLWLLAVLFYHTLRGMRVWRGKPIVAAR
FT                   DAQAMWEISVVVVVGLLYAGMATLLVILTAPPIERYLQNTAIFLPGVVALLAYIRVQEG
FT                   WQLWRSS"
FT   gene            complement(111585..112298)
FT                   /locus_tag="Mmc1_0107"
FT   CDS_pept        complement(111585..112298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pho:PH0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42636"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U3"
FT                   /protein_id="ABK42636.1"
FT                   /translation="MNATPTITLCLLTFNELEGCRHDLPHLPLDHFDAVYALDGGSRDG
FT                   TDTFLREQGITVHTQQKAGYNAAYLEAFAHCQTDVLVLFHPKGCIDPQSVLNFKPLFQA
FT                   GNDLVIASRLGPGAHNEEDEQLLKPRKWFVQGISILAALLWRRDRGPHLWDVLHGMRGM
FT                   RVAAFHAIAPRDHGLSIDLEMVVRSYRLKLKRAAFPVHERTRLAGQTHFKALPTGWKLL
FT                   KYMASELCRPKTEPR"
FT   gene            complement(112295..113317)
FT                   /locus_tag="Mmc1_0108"
FT   CDS_pept        complement(112295..113317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_1530 conserved hypothetical protein
FT                   ZK105.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42637"
FT                   /db_xref="InterPro:IPR005049"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U4"
FT                   /protein_id="ABK42637.1"
FT                   /translation="MKTTLIVTSIHAPNPVMHALAQGCQAAGYDFILAGDSKSPDSFAL
FT                   DGCHFLSLEQQRQSGFRLGLSSPIKHYARKNIAYLQAIAQGTQCILETDDDNWPRAAFF
FT                   APRSRMVETVTVQQPGWLNVYGLFLQPDDHALPLWPRGLPLDAVRQSLPPLTAMQSVDC
FT                   PIQQGLADENPDVDAIYRLTLPLPRNFIADRQIALGEGVWSPFNSQNTLWWRDAFPLLY
FT                   LPATCSFRMTDIWRSFVAQRLAWSCGWRVLFFSPTVWQERNEHDLNRDFQDEVPGYLHN
FT                   AAIAAGLAQLNLPTGTAHLLDNLHTCYAWLVEQGHMQPLELSLLQDWIFDLTQCGWKAP
FT                   "
FT   gene            113431..113673
FT                   /locus_tag="Mmc1_0109"
FT   CDS_pept        113431..113673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42638"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U5"
FT                   /protein_id="ABK42638.1"
FT                   /translation="MSTPMGILFLSIATSGGWVAASQHDGGYRCWNRLPSNFIARCMET
FT                   LKCAEFGVMDGEAGVMQGHSRFSGRVGRSRSRMGG"
FT   sig_peptide     113431..113496
FT                   /locus_tag="Mmc1_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.512 at
FT                   residue 22"
FT   gene            114158..115123
FT                   /locus_tag="Mmc1_0110"
FT   CDS_pept        114158..115123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0110"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: tbd:Tbd_1427 putative
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42639"
FT                   /db_xref="GOA:A0L3U6"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U6"
FT                   /protein_id="ABK42639.1"
FT                   /translation="MFYWFTELADALVFGLLGMDATTRAASALHFFIEDVAKIFFLLIV
FT                   IVFLLGFFRSLVSAERARRMIGGQSPWRSYPLAVALGAVTPFCSCSSVPLFIGFLEAGI
FT                   PLGVTMAFLITSPMINEVAVLMLASTMGWKMAAAYVVTGLVVGLAGGLVIAALKLEHHV
FT                   EAYVWQIRMGQAALPEVDATWRGRLRYAAGQVREIVGRIWPYVLGGIGVGALLHGFVPE
FT                   HFFLQYAGADNPWAVPVAVLAGIPLYSNATGVIPVAEALLAKGVPIGTALALMMSVAAI
FT                   SLPEMIILRKVIKLPLIAIFVAWLFVAFVVVGYLFNAWFA"
FT   gene            115146..115379
FT                   /locus_tag="Mmc1_0111"
FT   CDS_pept        115146..115379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0111"
FT                   /product="thiol-disulfide isomerase and thioredoxins"
FT                   /note="KEGG: rpd:RPD_3416 thiol-disulfide isomerase and
FT                   thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42640"
FT                   /db_xref="GOA:A0L3U7"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U7"
FT                   /protein_id="ABK42640.1"
FT                   /translation="MKEIKVLGSGCKNCETTARIITAQAERMGVAIRLEKVTDMAVILG
FT                   YGVMSTPGVVVDGRVVHAGGLPGPDDVTAWLS"
FT   gene            115802..117094
FT                   /locus_tag="Mmc1_0112"
FT   CDS_pept        115802..117094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42641"
FT                   /db_xref="GOA:A0L3U8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U8"
FT                   /protein_id="ABK42641.1"
FT                   /translation="MAKIEGFRIKNFRALKDVTLGRLWNQQQADPLTSMTAVIGKNGVG
FT                   KSTLFDAFGFLSDALKSGVEEACDSRGRGGFERIRAQGQKGSIEFEVYYKEDGNARPIT
FT                   YEISIDVDSSGRPYVLKERLRQRRKGQKHGWPFSFLVLNSGKGVVWKGDQEGRQIDEEQ
FT                   GDFDLLGLMESIKSGEAKEESKETDVVELDDMRKLGIATLGSLKQHPRISAFRKFIEGW
FT                   YLSYFTPDAARSLPLAGPQKHLNIHGDNLGNVVQFMEREHPKRFQAILNRIAEKIPGIN
FT                   KIDTEKTNDGRLLLRFNDRGFQDPFYSQQMSDGTLKVFAYLLLLEDPTPPPFLCIEEPE
FT                   NGLYHKLLESLVNEFRDHATGRKGGSQVFITTHQPYLVDALESKEVWILEKGSDGYSVI
FT                   RRASNDAIVENMVAAGLPLGGLWYSDYLDAR"
FT   gene            117099..117803
FT                   /locus_tag="Mmc1_0113"
FT   CDS_pept        117099..117803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cte:CT0910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42642"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3U9"
FT                   /protein_id="ABK42642.1"
FT                   /translation="MHFEILVEDQSGKKALDILVPKIIGDDHTFNVHFYKGIGRIPKNL
FT                   GNKADASKRILLDQFPKLLRGYGNTFAKYPADYPAAVILVCDLDDKCLKAFRQELFNIL
FT                   NACDPQPETRFCVAIEEGEAWFLGDIPAVKSAYPKAKDAVLNAYVNDSICGTWERLAEA
FT                   VYTGGSTALSEKGWQAVGAEKSQWAEKISPHMDVTNNASPSFAYFRQKLLELAGARGVP
FT                   GGSSGDIYGPTP"
FT   gene            complement(118084..118248)
FT                   /pseudo
FT                   /locus_tag="Mmc1_0114"
FT   gene            complement(118245..118673)
FT                   /pseudo
FT                   /locus_tag="Mmc1_0115"
FT   gene            118832..120241
FT                   /locus_tag="Mmc1_0116"
FT   CDS_pept        118832..120241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY3991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42643"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V0"
FT                   /protein_id="ABK42643.1"
FT                   /translation="MIFNRPLPFISAFVEEIDGALREQHTHSVGMSVCQRSWFGFCIMA
FT                   IMLTNSICWAQFERAGLGRYGLGALAWMFRSSKIPWERLFQMSVRVVLRRHGITHGVLV
FT                   VDDTDKRRAKVTTRISHVHKMRDKSSGGYLFGQQIVFLLLVADMVTIPVGFAFYRPDPA
FT                   RTVWRKEVKAQKRKGILKSKRPVEPARNPDYPTKPELALRLLRQFKQWHAVVQVKAILA
FT                   DALYGAADFVDQGSSLYAGIQCVSQLRKNQKVRFLSRDLTVEEFFQRYPGVTGRLPVRG
FT                   GENRAIVFRSARIHVKAHGVKRFVIALKYDGEQDYRYLFASDLTWRTEDILKVFTLRWL
FT                   IEVFFQDWKAHEGWGNLTKLQGDEGSSQGLILSLMVDHCLLVQPDQLAQLKHKQPAFTV
FT                   GSLINHIKADNLVALIHDLLNANAPEQELTQLADVLAKQFRLNLSEKHMVGRDLGRQAP
FT                   SASLKYKTALA"
FT   gene            complement(120076..121734)
FT                   /locus_tag="Mmc1_0117"
FT   CDS_pept        complement(120076..121734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0117"
FT                   /product="putative nitric oxide reductase activation
FT                   protein"
FT                   /note="KEGG: tbd:Tbd_0555 putative nitric oxide reductase
FT                   activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42644"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V1"
FT                   /protein_id="ABK42644.1"
FT                   /translation="MEELVGHAWDRLITAKLKSRHPEAAVRLEHLERRVGILFRSAGGN
FT                   PALEIKGVPDHYHGGKRGFWRRLAGVERHYPMAWRDQDHLYLPERIDLFPKAELNGDLY
FT                   RWWAYLLPLTPPISGNPAVWFGNARTATHVLLSHFPTLEPLYVRLVSAHLEQRPVIAAS
FT                   NAALQASERQLRLALLQPHREIAPPPMLSVLWPIPLWPHPEPPQSSTTTPSLEEARHPK
FT                   GGSQNMGAEEQRLRKRGQRSEQQEREDGLMIYRFEALLSWAEMIHINRPSDEEEDAQSA
FT                   KRASRDMDTLTLTRGGDAPAKSIRFDLDLPAPALDDRPLGPGVHLPEWDYKRARLLPDH
FT                   CLLQLMETENVSPQPLPVHLRRVSRRIQGQITHWKPDGVWLRRREEGTELDLEACLEHA
FT                   VNRRCGQGPAEAGLWRDYLRGSRDLSTLLLADLSLSTDAWVNDEQRVIDVIRDALFIFA
FT                   EALAATGDAFSLYGFSSKKRDHIRFNSMFKFSALDSRSRCHANAVLYLSDADGACRPRS
FT                   RPTMCFSERFSLNCLASTSANWVNSCSGAFAFNRS"
FT   gene            complement(121739..122698)
FT                   /locus_tag="Mmc1_0118"
FT   CDS_pept        complement(121739..122698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0118"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="KEGG: tbd:Tbd_0556 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42645"
FT                   /db_xref="GOA:A0L3V2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V2"
FT                   /protein_id="ABK42645.1"
FT                   /translation="MNHASQPSYHPQPTRLHRIQFNRRLTRTAFFTLFLVAPTLDLFRI
FT                   DLANGHLVLFWHRFTPGVGSFLHEAATSPLAAAMGIALYLLLPVATVIVTVLWISRRWG
FT                   RLYCGWLCPHFTVVEWINGLMEKALGKPTLWEPTPMGRRTSRAWLLIMLLSGAAMGLLW
FT                   AVSLITYVLPPQMIFEHIWHGTLTFAQGLFIAVASVVFFIDFIFARHLFCRFGCAVGLA
FT                   QSLAWMSNPAALSPFLNSRERGSCSGCPAPCVTGCPMRLDPRGGKRRISTCTQCGICVQ
FT                   GCADISQVRAKNAPLIWTHGAAVSARPTSLFIHKGTEE"
FT   gene            complement(122737..123549)
FT                   /locus_tag="Mmc1_0119"
FT   CDS_pept        complement(122737..123549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0119"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; CbbQ/NirQ/NorQ C-terminal domain
FT                   protein; KEGG: tbd:Tbd_0558 putative nitric oxide reductase
FT                   activation protein NorQ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42646"
FT                   /db_xref="GOA:A0L3V3"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V3"
FT                   /protein_id="ABK42646.1"
FT                   /translation="MDASTPSTESSTTQPLYRPVGQEIELFEYAYKHQLPLLVKGPTGC
FT                   GKTRFIRHMAHRLKRPLFTVACHDDLTAADLVGRHLIGPDGGAHWHDGPLTRAVRAGGI
FT                   CYLDEVVEARKDTTVILHPLADDRRQLPIERTGETLDAPPEFMLVVSYNPGYQNLMKGM
FT                   KPSTRQRFVALRFDFPPAPVETRVLIDETGIAPHIAQRLITLGTALRALGEVDLEEGVS
FT                   TRLLIYAARLIQGGFPLLAACRSALAESLSDDPEVIAALMEVIEVHMG"
FT   gene            complement(123629..125011)
FT                   /locus_tag="Mmc1_0120"
FT   CDS_pept        complement(123629..125011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0120"
FT                   /product="nitric oxide reductase, NorB subunit apoprotein"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   hch:HCH_04410 nitric oxide reductase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42647"
FT                   /db_xref="GOA:A0L3V4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V4"
FT                   /protein_id="ABK42647.1"
FT                   /translation="MTYQSQSVARLYFIGALGLFVGQILFGLVLGTQYVIGDFLFPEIP
FT                   FNVARMVHSNLLIVWLLFGFMGASYYLVPEESETELWSPLLAKLLFWVFLVAGALTILG
FT                   YLLVPYAKLAELTHNDLLPTMGREFLEQPTITKIGIVIVVLGFILNIGMTMLKGRKTSI
FT                   SIVLLTGLIGLAVMFLFSFYNPSNLVLDKFYWWWVVHLWVEGVWELILGAILAFVLIKV
FT                   TGVDREVIEKWLYLIIAMTLITGILGTGHHYYWIGTQEYWQWVGSLFSALEPIPFFMMV
FT                   LFAFNMINKRRRNHPNKAATLWAMGTAVMAFLGAGVWGFLHTLAPVNYLTHGTQITAAH
FT                   GHMAFYGAYVMIVLTIISYAMPYLRGHGPTSGERAQIWEMWGFWLMTIAMVFITLFLTG
FT                   AGILQTYMQRMGDDPGAFMDVQEKIAFFYWLRLAAGFVFMGGLVVYLMSFFKGKPGQTE
FT                   NA"
FT   gene            complement(125025..125465)
FT                   /locus_tag="Mmc1_0121"
FT   CDS_pept        complement(125025..125465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0121"
FT                   /product="nitric oxide reductase, NorC subunit apoprotein"
FT                   /EC_number="1.7.2.5"
FT                   /note="PFAM: cytochrome c, class I; KEGG: hch:HCH_04411
FT                   cytochrome c, mono- and diheme variants"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42648"
FT                   /db_xref="GOA:A0L3V5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V5"
FT                   /protein_id="ABK42648.1"
FT                   /translation="MNEKMTISMARNIFFGGSLFFVLVFLGLTLGTMRSLPERDHRENI
FT                   TPQVALGKKVWEDNNCVGCHTLLGEGAYFAPELGNVYLRRGGKDGGIDFIKDWIRAQPS
FT                   GVEGRRQMPQFNLTEEELDAVATFLKWTSEINTAGWPPNIEG"
FT   gene            complement(126903..127619)
FT                   /locus_tag="Mmc1_0122"
FT   CDS_pept        complement(126903..127619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42649"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V6"
FT                   /protein_id="ABK42649.1"
FT                   /translation="MPCGLLDAYITACYAVRNTSFREVKTMKRFIAVLIAVAALTGCAG
FT                   GIKGVSNSNLYGKLPPGGTFALQLISGDSLIGRKIERMISHQISKQGYRPTDSSPDILV
FT                   SYAFDVHSAGSVSSAYTSINTVPQKSFVYGNTIYTKPSTSTATTSVSTTKLYQKTIVVR
FT                   ISDARTGEKLWESNVSEQGWCNQIFVTAPSILALMFEGFPHEQTNVNKMVTHADPAAKE
FT                   LMNLFPESTNWGCTRT"
FT   gene            127974..128348
FT                   /locus_tag="Mmc1_0123"
FT   CDS_pept        127974..128348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42650"
FT                   /db_xref="GOA:A0L3V7"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V7"
FT                   /protein_id="ABK42650.1"
FT                   /translation="MTVNNHQNSNKKQSSDIMNGPASLLDDVYISSTSKTSASSAAKSG
FT                   LGKTTQSAKVKLDLAHSKSALAKGGAFAGGSSAKWASGLILAAPAFAAGMLVGVGCVCL
FT                   HYAGSRSNRRSYAQSVAIPS"
FT   gene            128914..131037
FT                   /locus_tag="Mmc1_0124"
FT   CDS_pept        128914..131037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0124"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor G, domain IV; KEGG: gsu:GSU1933 translation
FT                   elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42651"
FT                   /db_xref="GOA:A0L3V8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V8"
FT                   /protein_id="ABK42651.1"
FT                   /translation="MCEDVLPHYFDAEGEKGMTESQITRIRNVALMAHGGGGATTLAET
FT                   LFYNAGVIPKRGTVEGKNTVLRSEPEELERGLTIAPQIGHFQWKGVEINIIDTPGYIDF
FT                   IEHTRAVLNVVGGAVLVYSGASGVKTENTRFWSMIQEAQVPGIGFINKMDKPRADFIRV
FT                   LGEIEQDLQVTTLPVTIPIGQGESFAGIVDLIPMTAWSAKDGVFTQIEMPDSVKQDVAY
FT                   YRTQLIEKIIETDDELLEAYLENETLPTEEQLHERLKEAVLTRRLLPIFCGSGGANIGV
FT                   RALANGISQYLPSPIDKAAIKPLIGVNPNNRDQEIARSVSEEDPFSAVVFKTAIDPFSG
FT                   KLSVVRVFSGTLQADSALLNGTRDLKEKGGHLYLLEGNDMTQVDVLKAGQIGAIARLAH
FT                   THTGDTLCDISAPIHYHRVRYQEPVFSYAVEVETKMEDKVATGLAKLCDEDPTLHFYRD
FT                   EDTHEMILAGMGQTHLAVTLDRLQRKYGGKASLKVPKVAYRETITRACRVQGKLKKQSG
FT                   GRGQFGDCWIEVEPLPRGAGFVFEDRVVGGVIPRNFIPSVEKGVVEAMNKGVVGGYPVV
FT                   DVQVNLVDGSHHSVDSSDNAFRTAGSMAFRSAMEQGGAVLLEPLMSMEISVPDEVMGDV
FT                   IGDMNSRRGKITGVTPRGNGQTIHCETPMSEILDYGNSLNAMTSGRGIYTMRLANYQEV
FT                   PSHIARKVLEQQN"
FT   gene            131289..131552
FT                   /locus_tag="Mmc1_0125"
FT   CDS_pept        131289..131552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42652"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3V9"
FT                   /protein_id="ABK42652.1"
FT                   /translation="MADKRTRDLFFFSLNDAKECVMRPFDSYPGMVSILDVPQRRSQES
FT                   TQRGTFRGVVAGQPHLSRGGRGDFQTILQQTLNKAGKRSDEY"
FT   gene            131620..132234
FT                   /locus_tag="Mmc1_0126"
FT   CDS_pept        131620..132234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL1814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42653"
FT                   /db_xref="InterPro:IPR041651"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W0"
FT                   /protein_id="ABK42653.1"
FT                   /translation="MAEIQATQVEMAYLTAVRNQQTAGSAVKSPTTETKTATDVLTLAQ
FT                   RMRVVASDAADFSSPQDMVAYANQRLQESLQQELERGMGSFKNSEALAAFQEMRGVTDP
FT                   GQTAGFIVSQVSSYFGNYLDNHTDVSFEENLQGFRELVDGAIDKGFSQAQAFLGEAVDL
FT                   FEGIQRMLEETRQKINEKLGQFVEMQRRDQQAPSGEPVVDA"
FT   gene            133279..134679
FT                   /locus_tag="Mmc1_0127"
FT   CDS_pept        133279..134679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0127"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   pca:Pcar_3059 peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42654"
FT                   /db_xref="GOA:A0L3W1"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W1"
FT                   /protein_id="ABK42654.1"
FT                   /translation="MGSFSINQESSPLHPMDMEAFSLAHPLTEPHYGTSQLDNGLTVVS
FT                   FPMPWLHEVGVTILARSGSRFERDREAGIAHFLEHMLFKGTKRIPDPTELHTQLEALAA
FT                   DMNAATGPETNLYWLNVPLIHLEESLSLFAELFTEPALLGIENERQVILAEMREDENEA
FT                   GENTHPFVMASGQLWKNHPLERSVLGTRETVENVEVADLHRYLQKHYRGDNMAVAFFGP
FT                   VEHAHVHALAEKTLGALAAGPGEPTPPPPPMPAGPHWLAVNDPTAQLSLSLFFRCAGQQ
FT                   EPNRFYPTAAMRRLLDDGFASRLQAEVREKEGLVYDLWAAYSAYTDTGTLEIGASVSPE
FT                   NLEVLFHNLIQQLHKLRTEPAGQEEWLRLKTRWYAALGSSLDRPSELVERYVSDQLFHC
FT                   VEPVTESWQRVLQLTPEQVQFQAELLLRPENLVVVLVGPNAEKHRKKLKARFSETLASW
FT                   HISSPWQG"
FT   gene            complement(134709..135095)
FT                   /locus_tag="Mmc1_0128"
FT   CDS_pept        complement(134709..135095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0128"
FT                   /product="protein of unknown function DUF486"
FT                   /note="PFAM: protein of unknown function DUF486; KEGG:
FT                   neu:NE1692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42655"
FT                   /db_xref="GOA:A0L3W2"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W2"
FT                   /protein_id="ABK42655.1"
FT                   /translation="MADCSLMMVWMTMNTLLQTILLLVASNVFMTFAWYAHLKHLDAKP
FT                   WYIAAGISWGIAFLEYMLQVPANRIGFTVLSLPQLKILQEVITLTVFVPFAVFYMHQPL
FT                   KLDFLWAGLCLVGAVYFMFRGALS"
FT   gene            complement(135318..136931)
FT                   /locus_tag="Mmc1_0129"
FT   CDS_pept        complement(135318..136931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0129"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="TIGRFAM: type I restriction-modification system, M
FT                   subunit; PFAM: N-6 DNA methylase; KEGG: noc:Noc_0439 type I
FT                   restriction-modification system M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42656"
FT                   /db_xref="GOA:A0L3W3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W3"
FT                   /protein_id="ABK42656.1"
FT                   /translation="MTKEELSQLGKTLWAIADDLRGAMNADDFRDYMLSFLFLRYLSDN
FT                   YEAAAKKELGPDYPKLQEDDRRTPLAVWYAANTEDIPDLEKQMRRKMHYVIHPDYLWSS
FT                   IYERARTQDAELLQTLQRGFKYIENESFASAFQGLFSELNLHSEKLGRTPVDRNKKLCA
FT                   IITKVAEGIAQFSTDSDILGDAYEYLIGQFAAGSGKKAGEFYTPQSLSTILSRIVTLDS
FT                   QEPATGKKRKLSCVLDFACGSGSLLLNVRKQMGTHGIGMIYGQEKNITTYNLARMNMLL
FT                   HGVKDSGFQIHHGDSLINDWDMLSEMNPAKKVKCDAIVANPPFSYRWEPNEALGEDFRF
FT                   KSHGLAPKSAADFAFLLHGFHFLSDEGTMAIILPHGVLFRGGVESRIRTKLLKDGHIDT
FT                   VIGLPANLFFSTGIPVCILVLKKCKKPDDVLFINASEYFEKGKRQNQLLPEHIDNIVET
FT                   YQYRKEEERYARRVEMAEIEKNDYNLNISRYVSTAMSEQQIDLGAVNHKLVALEEKIVA
FT                   ATQKHNGFLEELGLPPLPLG"
FT   gene            complement(136928..138028)
FT                   /locus_tag="Mmc1_0130"
FT   CDS_pept        complement(136928..138028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0130"
FT                   /product="anticodon nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42657"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W4"
FT                   /protein_id="ABK42657.1"
FT                   /translation="MNAPQTFASLDALARHLRERLDKKYVLLFAFNGTGKTRLSMAFKD
FT                   MGKETVEDDEGNEVTTRDTLYFNAFTEDLFHWDNDRRVLRMHTDSRFFDGLQELEMESR
FT                   IRPLLARYADIDFLIDYATSEITFFREKDADGAPIPIKVSRGEENIFVWCFFLAVAQLA
FT                   VDGQESYRWVKYLYIDDPISSLDDNNAIAVASHLAQLLKKSDGQIRTVISTHHHLFFNV
FT                   MGNELKPAQYFLSKEDGQFLLKNTGKTPRFHHIALLKELNAVVESGQIFTYHFNILRNI
FT                   LEKTATFHGFQHFSACIQQFSDDEDGILRERMIQLFSHGNYSLFEPQEMMPENKEYFRK
FT                   ILRDFMNNYRFNPELFPEPPQESVTP"
FT   gene            complement(138025..139032)
FT                   /locus_tag="Mmc1_0131"
FT   CDS_pept        complement(138025..139032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0131"
FT                   /product="DNA-binding protein"
FT                   /note="KEGG: eba:ebA2608 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42658"
FT                   /db_xref="GOA:A0L3W5"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W5"
FT                   /protein_id="ABK42658.1"
FT                   /translation="MSGLILYTTEDGQSRIQLRADGQTVWLTQLEMAELFQTSKQNIAK
FT                   HLKAIFAEAELSAEAVVNHWLTTAADGKNYRIAHYNLDAILAVGYRVRSPRGAQFRRWA
FT                   STVLGEYLKKGFVMDDERLKNPDGRPDYFDEMLARIRDIRASEKRFYQKVRDLFALSSD
FT                   YDKSDRAAQQFFATVQNLLLHAVTGQTAAELVSARANPADPHFGLLNWKGARVRKQDIL
FT                   VAKNYLTEDEIDTLNRLVVIFLETAELRAKRQTQTSMAFWRDNVGLIITNNGFPLLSNA
FT                   GSISHERMEQQVDKQFQDYDQQRKAQEAQAADAQDEAELKALERRIKNRKGRAS"
FT   gene            complement(139029..140312)
FT                   /locus_tag="Mmc1_0132"
FT   CDS_pept        complement(139029..140312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0132"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: sab:SAB0265 type-I specificity
FT                   determinant subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42659"
FT                   /db_xref="GOA:A0L3W6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W6"
FT                   /protein_id="ABK42659.1"
FT                   /translation="MSKAMKDEKKALVPRLRFPEFRDAGEWEKTTIGEIGKFYYGKSAP
FT                   KWSLEEDAPTPCVRYGELYTKFGPIITETYSRTNIDPGKLRFSKGGEILVPRVGEKTED
FT                   FGKCCCYLPLGDIAIGEMISVFETAQNPLFYTYYFRRLYRQFSKVVEGQNVKNLYYVEL
FT                   EPLEIYRPPLTEQQKIADCLSSLDALIAAQADKIDALKTHKKGLIQQLFPREGKTVPRL
FT                   RFPEFQEAGEWTEHRLENMAKRGSGHTPNKKFPSYYNGGIKWVSLADSNKLDDGYIYDT
FT                   KVEISDDGINNSSAVLYPAGTVILSRDAGVGKSAVLYSPMAVSQHFMAWQCYENMLSNW
FT                   FFYYLLQKLKATFESIAVGNAIKTIGAAYFKEMTITAPSLPEQQKIADCLVSLDGMIAA
FT                   HTEKLDSLKTHKNGLMQQLFPSPEAVEA"
FT   gene            complement(140391..141236)
FT                   /locus_tag="Mmc1_0133"
FT   CDS_pept        complement(140391..141236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0133"
FT                   /product="DNA-damage-inducible protein D"
FT                   /note="KEGG: cch:Cag_1524 DNA-damage-inducible protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42660"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W7"
FT                   /protein_id="ABK42660.1"
FT                   /translation="MKHELVHTLTESFEGHAQETENGVEYWLARDLQHLLGYTKWENFL
FT                   NVISKAKTACEVTGHDIADHFADVGKMVELGSGSQREISDIMLTRYACYLTAQNGDSAK
FT                   QPIAFAQTYFAMQTRKAELIEQRLLEAERVSARKKLSTTEKELSDVIFEQAGGNQNFAL
FT                   IHSKGDTALFGKNTKAMKAQWRVPDNRPLADFAPTIILKAKDFATEITIHNAREHNMRS
FT                   ERQISGEHVTNNEAVRQTLLDRGIRPESLSPAEDVKKVERRLASAEKKALKNPDGLEDK
FT                   "
FT   gene            complement(141254..144301)
FT                   /locus_tag="Mmc1_0134"
FT   CDS_pept        complement(141254..144301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0134"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: mfa:Mfla_1215 type I site-specific
FT                   deoxyribonuclease, HsdR family; TIGRFAM: type I
FT                   site-specific deoxyribonuclease, HsdR family; PFAM: type
FT                   III restriction enzyme, res subunit; protein of unknown
FT                   function DUF450; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42661"
FT                   /db_xref="GOA:A0L3W8"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W8"
FT                   /protein_id="ABK42661.1"
FT                   /translation="MIGIDSMTEQQIEQDFITKLGELKYSFRKDIRDRASLENNFREKF
FT                   NALNRVRLTDAEFTRLRDEIITADVFQAAKTLREYGYIEREDGTPLDYMLVNLKDWCKN
FT                   EFEVIHQLRINTDNSHHRYDVILLINGLPLVQIELKSLGINPRRAMEQIIEYRNDSGTG
FT                   YANTLLCFMQLFIVSNRDDTWYFTNNHNQHFAFNAEERFLPIYQWADKDNRKVCHLDDF
FT                   AEKFLAKCTLGQMISRYMVLVVSEQKLLIMRPYQIYAVQAIVDCIHQNRGNGYIWHTTG
FT                   SGKTLTSFKASTLLKDNLDIEKCLFVVDRKDLDRQTRIEFNRFQEGCVEENTNTETLVR
FT                   RLLSEDYAHKVIVTTIQKLGLALDETGNKAQQYKEKGKPTFKERLAPLRDQRIIIIFDE
FT                   CHRSQFGENHKAIKEFFPKAQLFGFTGTPIFEQNASYTQVDGELASHKTTEEIFEKRLH
FT                   AYTITHAIDDRNVLRFHIDYFKPEAASPAGDKAKANTTSLTRPETQRLVVDTILKKHDA
FT                   ATDHRRFNALLATASINDAINYYELFKQAQAERREEDPDFIPLHIACVFSPPAEGNKDV
FT                   KQLQEDLPQEKDDNQQEPERKKAALQQIIADYNTQYGTNHKLGEFDLYYQDVQLRIKDQ
FT                   KYPNSDFLRKNKIDLTIVVDMLLTGFDAQYLNTLYVDKNLKHHGLIQALSRTNRMLNDT
FT                   KPYGNILDFRAQKGAVDEAIALFSGEDVTRSREIWLVDPAPKVIDKLDSAVKRLEAFMQ
FT                   AQGQPCTPAAVNDLKGDVARAEFINCFKEVQRLKTQLDQYTDLSDAQKQQIEQYLPAEQ
FT                   LRGFKGMYLETAQRLKAQQGKSGIEASEAKDAIEQLDFEFVLFSSAMIDYDYIMGLVSR
FT                   FTQQLPGKQSMSRDQIINLLATNSNLMAEREEITAYIKTLEEGQGRSVEAIRDGYQSFK
FT                   AHKAEGELAALAQRHGLERDALQGLVVGILDRMIFDGEQLNDLFAPLELGWKDRSKAEL
FT                   ALMEELVPLLKKQAGGREISGLAAYE"
FT   gene            complement(144686..145177)
FT                   /locus_tag="Mmc1_0135"
FT   CDS_pept        complement(144686..145177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0135"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase; KEGG: rru:Rru_A3621
FT                   methylated-DNA-(protein)-cysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42662"
FT                   /db_xref="GOA:A0L3W9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3W9"
FT                   /protein_id="ABK42662.1"
FT                   /translation="MSFLPYDSQVGMLWLEIRQGALVALSWSLPDSMAEPLEDAALCRR
FT                   ITHWLDDHFRRAPRGVDFPVRPAGTVFQQKVWREISRVGPGQTITYGELAKRLNSSARA
FT                   VGVAAGQNPIPVVIPCHRVVGAKELGGYSGHGGLHTKRTLLSLEGALIGDIGIPFRQAC
FT                   "
FT   gene            complement(145506..145715)
FT                   /locus_tag="Mmc1_0136"
FT   CDS_pept        complement(145506..145715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0136"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="PFAM: ribosomal protein L31; KEGG: gme:Gmet_0377
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42663"
FT                   /db_xref="GOA:A0L3X0"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3X0"
FT                   /protein_id="ABK42663.1"
FT                   /translation="MKEGIHPKYEEATFTCASCSNEIKTRSTAGDLTLGICSECHPFYT
FT                   GKHKLVDTAGRVERFRRKYGMQDQ"
FT   gene            complement(145879..147144)
FT                   /locus_tag="Mmc1_0137"
FT   CDS_pept        complement(145879..147144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0137"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: gsu:GSU3108 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; Ribonuclease B, OB region
FT                   N-terminal domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42664"
FT                   /db_xref="GOA:A0L3X1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3X1"
FT                   /protein_id="ABK42664.1"
FT                   /translation="MCTLMNLKDLKAMNASQLSEIAEERKIENYSGMRRQELIYALLKT
FT                   ESENNGQIYGEGVLEVLQDGFGFLRAPDTNYLPGPDDIYVSPSQIRRFGLRTGDVVEGQ
FT                   IRAPKESERYFALLRVERINYEDPLKARNKILFDNLTPLYPDERLKMEIADESSNLEAR
FT                   VMDLIVPIGKGQRGLIVAQPRTGKTMLMQKIAHSIAENHPDTVLLVLLIDERPEEVTDM
FT                   KRSVKGEVVSSTFDEPATRHVQVAEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVA
FT                   PSSGKVLSGGIDANALQRPKRFFGAARNVEEGGSLTILATALVDTGSRMDEVIFEEFKG
FT                   TGNMEVHLDRKLVEKRTFPAIDIAKSGTRKEELLTERDELSKLWVLRRILLPMGPLDSM
FT                   SFLLDKLRATKDNSEFFESMNG"
FT   gene            147442..148494
FT                   /locus_tag="Mmc1_0138"
FT   CDS_pept        147442..148494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0138"
FT                   /product="Pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="PFAM: tRNA pseudouridine synthase D, TruD; KEGG:
FT                   dge:Dgeo_0594 pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42665"
FT                   /db_xref="GOA:A0L3X2"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3X2"
FT                   /protein_id="ABK42665.1"
FT                   /translation="MNHEISDIQPHLPKLTSQPGLGGQLKQQPEDFLVEELRPNPLSGE
FT                   GEHWIVRIIKRDLTTDQVAAWLAKRFAVPQKDVGFAGQKDRQAVTIQDFSVYLPGQAPP
FT                   QGWADDPLPGITIHSVGRDRRKIKPGMLSGNRFVIRLRGCDGALSASQRQQLADATQAR
FT                   LLRYGAPNYFGPQRFGRDGDNWQAGLKLLRAGRKRRKGNRNTEALQISAVRSELFNRVV
FT                   TARLQQGLFNTLLLGDVVQLAGRTAAFRVEDLAAEQPRFDAVQIHPTGPLFGRDMLAPT
FT                   GQAAEIEAAIAQAEPEAIELLEQFDMQGVRKSLRLIPGELSHHWEQADLIVTFTLPRGC
FT                   FATSIMREYM"
FT   gene            complement(148539..149393)
FT                   /locus_tag="Mmc1_0139"
FT   CDS_pept        complement(148539..149393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0139"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   plt:Plut_0809 2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42666"
FT                   /db_xref="GOA:A0L3X3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3X3"
FT                   /protein_id="ABK42666.1"
FT                   /translation="MDHAYQGELCMSTANDYNATVVERLDITPNLMIIRVKPDVTPFPF
FT                   LAGQFAILGLQRNAPRIPEADPEEVPEDKALRLVRRAYSISSGSHETHLEFYISLVQSG
FT                   ELTPRLFALAVGERLFLGKSASGHFTLDRVPPGHNILMVSTGTGLAPYISMVRTMALGI
FT                   GCPITPMAVVHGASYSWDLGYRTELEGLNRQCDHFRYVPVVSRPQDDKDWSGRTGRLNV
FT                   WVENKKALEEACGFPVDPAHTHIFLCGNPGMIEFTEKYFVEQCGYDAGSKKEPGNLHAE
FT                   KYW"
FT   gene            149649..150197
FT                   /locus_tag="Mmc1_0140"
FT   CDS_pept        149649..150197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdy:SDY_3404 stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42667"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3X4"
FT                   /protein_id="ABK42667.1"
FT                   /translation="MVTTDQPSKPDIIRYLLEQEGRVMLCVDATQERVEVPRRFANDNS
FT                   LRLVLNRQMPQTIHVGEDALESELRFGGIPHYCIIPYETLWGAFNPDTGHGMLWPDTMP
FT                   NEVRQNYWLSQALRQEGGFEMPEGALKQLQKLREEQAAASGRPQLQVVPSDGPASPPAH
FT                   PTDQEPPPERRKPTLRLVK"
FT   gene            150542..151063
FT                   /locus_tag="Mmc1_0141"
FT   CDS_pept        150542..151063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sru:SRU_1567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42668"
FT                   /db_xref="InterPro:IPR024755"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3X5"
FT                   /protein_id="ABK42668.1"
FT                   /translation="MLKKIISGGQTGVDRGALDAALSQGLLCGGWVPANRRAEDGPIPP
FT                   RYPVRALVRGGYLVRNRLNVQDSDATLIITDGALSGGTARSVEFARRLGRPFLVLQITR
FT                   CLQDADLLIKLCQWLKVYDVQVLNVAGPRESRKPGIYQLTRQFLVQLIKRSQDPCPLDQ
FT                   PYEGTPHNAL"
FT   gene            151501..152022
FT                   /locus_tag="Mmc1_0142"
FT   CDS_pept        151501..152022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0142"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: rru:Rru_A3350 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42669"
FT                   /db_xref="GOA:A0L3X6"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3X6"
FT                   /protein_id="ABK42669.1"
FT                   /translation="MAILPIVTAPDPVLKKRAEPVVAVDASIQQLMRDMLETMYAAPGI
FT                   GLAAPQVGVSKRVIVVDVTYSEAAAQDGEPYCLANPEIIAAEGEITWEEGCLSVPESYG
FT                   KVDRKEHVVVRGLNAQGELVTLEAHGLFAVCLQHEIDHLDGTLFIDHLSSLKRTMIIKK
FT                   LKKLKTEQAS"
FT   gene            152019..152957
FT                   /locus_tag="Mmc1_0143"
FT   CDS_pept        152019..152957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0143"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: ppu:PP0067
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42670"
FT                   /db_xref="GOA:A0L3X7"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3X7"
FT                   /protein_id="ABK42670.1"
FT                   /translation="MTAWRVVFMGTPDFATGTLQALLDGPDTVVAVFTQPDKPVGRGMK
FT                   MQKTPVKQLAEQHGIPVYQPNRLREAEAVTALRALRPDVVVVVAYGQILSREVLEIPTH
FT                   GCINVHASLLPRWRGAAPIQRAILAGDAQSGVTIMAMEEGLDTGPMYSTVVQSIDNHTT
FT                   GGQLHDQLMAAGGGLLVETLARIKHEGLTPQIQPEQGVTYAAKLKKEEGLVDWSQPAIQ
FT                   IQRAVQAFDPWPCAFTLWQGKPLKLFAASVVVGHGTPGEVIEVEKDGFVVACGDGALRV
FT                   AQVQAAGKKRMSSGEWLRGHGVKQGERLGEG"
FT   gene            153069..153914
FT                   /locus_tag="Mmc1_0144"
FT   CDS_pept        153069..153914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0144"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: cvi:CV4263 heat
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42671"
FT                   /db_xref="GOA:A0L3X8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3X8"
FT                   /protein_id="ABK42671.1"
FT                   /translation="MNTMKTAMLLAALTALFMMIGFALGGQGGMLIALLFAGGMNLYAY
FT                   WNSDQMVLRMHNAQEVGPREAPELYGLVQSLAKRGKMPMPKVYVIHDPSPNAFATGRDP
FT                   EHAAVAATTGLMQILTREELAGVMAHELGHVMNRDTLISTISATFAGAITAIANMAQFA
FT                   AIFGNRDEEEGGGGPMGLIMMILAPIAAALIQMAISRTREYKADRVGAELCGNPLWLAS
FT                   ALHKLERGVQQIPSPVAQAHPEAAHLYICNPLAGGLGSLFSTHPPIPERIRKLQRMTGR
FT                   "
FT   sig_peptide     153069..153146
FT                   /locus_tag="Mmc1_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.352 at
FT                   residue 26"
FT   gene            complement(153996..154907)
FT                   /locus_tag="Mmc1_0145"
FT   CDS_pept        complement(153996..154907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42672"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3X9"
FT                   /protein_id="ABK42672.1"
FT                   /translation="MGQYLENRPRFGYGHPVHCDKRLLRVISFQRLMGYMGRWLHGVPS
FT                   QIGTQQDFQRRVKDLRGELDYLDSLGMVLPHVANRHNGLHGDPHHFTTFADALELTIDT
FT                   ILGRITTRRADRYKSDDFSAYLALTLKEQQAGCLPTNRDGLHTLNIRARQLGCVLTAMV
FT                   TLLMTREQWRELFIYAYDDEQLGRYAHLEAQLTRGRQWIPDYLSYLGITGSYLLQRRLQ
FT                   RATTDPGLNGQDCQALIDRIHATGFDDERFLAQVNRARQTALHASHGCREFIMDDAGGW
FT                   QERVHGGHPGRAWTALVPYKTV"
FT   gene            complement(155144..156010)
FT                   /locus_tag="Mmc1_0146"
FT   CDS_pept        complement(155144..156010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0146"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ana:alr2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42673"
FT                   /db_xref="GOA:A0L3Y0"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y0"
FT                   /protein_id="ABK42673.1"
FT                   /translation="MSKKDKKPEAQAAEAAPLIHTIDEKSEKKKKLDSKFYEKELVKLQ
FT                   VELVKLQEWIKAEGLRVVVIFEGRDAAGKGGVIKRITERFNPRICRVVALGTPTEREKT
FT                   QWYFQRYVANLPAAGEMVLFDRSWYNRAGVERVMGFCTDEEYKEFLRSCPEFERMLVRS
FT                   GIILIKYWFSVSDDEQERRFHARVEDPVKRWKLSPMDLESRQRWVEYSKAKDEMFAHTD
FT                   IKQAPWYVVNGEDKKRARLNCITHLLSMIPYQDLTPEPIKLPKRRANMLGYVRPPKGEQ
FT                   TLIPEKY"
FT   gene            complement(156172..158757)
FT                   /locus_tag="Mmc1_0147"
FT   CDS_pept        complement(156172..158757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0147"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: dsy:DSY1668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42674"
FT                   /db_xref="GOA:A0L3Y1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y1"
FT                   /protein_id="ABK42674.1"
FT                   /translation="MKQEQLTSKSAEALNSAVGLAAERNHQFVEPEHLLLAMLEQKDGV
FT                   IPALLIKMNTPLPALQQATSVAVENLPRVHGGGAAQTLPSRRLQSLWQDAEREAATLRD
FT                   DYTSTEHFLLAMTEHKEGALPSLLRPFTITRTRVLEALKTVRSGQRVTSKEPEGTFQAL
FT                   EKYARDLTALAKSGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   LRMERGDVPESLKGVRVVALDMGALVAGAKYRGEFEERLKAVIKEVQEAQGKIILFIDE
FT                   MHTIVGAGQSEGAMDAGNLLKPALARGDLHCVGATTLDEYRKHVEKDPALERRFQPVQV
FT                   REPSVEATISILRGIKDKYELHHGVRITDAAIVAAATLAHRYISDRFLPDKAIDLVDEA
FT                   AARIRMEITSKPQVLDSLDRQILQLQIEQSALSKEKDSASRERLTKLEAELADLKENAH
FT                   AMTIRWEQERLNIKQVGILKETLESTRLQLEQAERSGNLEKAGELRYGTLPKLEQELQK
FT                   AQELAAQSRENPLLKELVDEEEIATVVARWTGIPVARMLEGEKDKLLKMEERLGHQVVG
FT                   QERALQAIARAVRRARAGLQDNNRPIGSFFFLGPTGVGKTELSKALAQFLFNDESAMVR
FT                   LDMSEYMEKHTVARLIGAPPGYVGYEEGGQLTEQVRRRPYSVVLLDEVEKAHPDLFNTL
FT                   LQVLDEGRLTDGHGRTVDFRNTVLIMTSNIGSHLMAEGGPTAQVEHRVMELLKQTFRPE
FT                   FLNRLDEIIPFHALQREHMGAIVDIQLKRLHKLLDKLNIRLELEPAARAALAEEGYDPI
FT                   YGARPLKRVMQRLVQDPLAEAMLSGHLHEGDRVVIHFDGEQFVINPVHR"
FT   gene            158901..159929
FT                   /locus_tag="Mmc1_0148"
FT   CDS_pept        158901..159929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0148"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: dde:Dde_3250
FT                   polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42675"
FT                   /db_xref="GOA:A0L3Y2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y2"
FT                   /protein_id="ABK42675.1"
FT                   /translation="MRHDGAQTPLVDPQPQAHASMLSTLHIVMYHYVRPLRQSRYPAIK
FT                   GLEKEAFLGQLDYIQRHYQVIGMEQLAAALVGAEPLPPRSALLTFDDGYLDHYLHVFPH
FT                   LLARGLTAAFFPPVCAVERRQLLDVNKIHFILASVADQDRLISALNQAIEAASAHYGLA
FT                   SVAHYEATWKKPFGYDTAQVIYFKRMLQHVLPQALRQQITHDLFSQFVTQDETAFAHEL
FT                   YMDSAQLRVMIQGGMHVGGHGDAHHWLNHLDAEAARQDIQKTRSFLDDLGASTPIASFC
FT                   YPYGGYNATTQQLLQEYGFSVAVTTEPLGVDLGRDTALSLPRLDTNVLPRQGDADYLQL
FT                   AP"
FT   gene            159960..160250
FT                   /locus_tag="Mmc1_0149"
FT   CDS_pept        159960..160250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42676"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y3"
FT                   /protein_id="ABK42676.1"
FT                   /translation="MQQATIAAILAEAITELNRQLPAESRLQSQDSETILVGEGGVLDS
FT                   LSLITLFVAVEEQLQEQLDLSLSLLDAMADEGNMAHFHTLGRLTQWLVEQA"
FT   gene            160250..161941
FT                   /locus_tag="Mmc1_0150"
FT   CDS_pept        160250..161941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0150"
FT                   /product="FkbH like protein"
FT                   /note="TIGRFAM: HAD-superfamily phosphatase, subfamily
FT                   IIIC; FkbH like protein; KEGG: rsp:RSP_1535 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42677"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y4"
FT                   /protein_id="ABK42677.1"
FT                   /translation="MVMAISKTPLTLISDFNLSVLARLLNHAQQDTPLEATLSPFGQPY
FT                   QTLAAPPEREDAVVMVWCRAEGVLPSFAQGLQFEAVDEQVLEGEVRHFAQQLRHHATQV
FT                   KHLLVSSWVLPPQERGYGMLDWQPGLGLRYLLARANLLLAQQLADAANIHLLDTQAWLQ
FT                   SAGNKAASPRMAYASKTPYGNGVFEAAAADILAVLDGLQGRSRRLVLVDLDDTLWGGII
FT                   GETGWQGIRLGGHDHGGEAFQDFQRALKGLIKRGVLVGVVSKNTEEVALAAFEKHPEMV
FT                   LKKEDLAGWRINWQDKAQNVVELSQQINLGLQSVVFIDDNPAERGRVREALPQVLVPEW
FT                   PKQPSEYAAFLRAMNCFELPALSDEDRQRAAMVRAERARQETKGTLANHGDWLQSLGMQ
FT                   VRLSPITPVNLPRVEQLFNKTNQMNISTRRLSESQIHHWAQQPGHVLWAASVTDRFGDS
FT                   GLTGILAVALEGEEAVITDLILSCRVMGRQVEHLLLHRGVAWAMAQGAKRLVAHYRPTD
FT                   RNAPCLSFLRGSGLTEAPEHTFSWSCVTPYPQPQHVMLEELPHVQG"
FT   gene            161928..162956
FT                   /locus_tag="Mmc1_0151"
FT   CDS_pept        161928..162956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cjr:CJE1501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42678"
FT                   /db_xref="GOA:A0L3Y5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y5"
FT                   /protein_id="ABK42678.1"
FT                   /translation="MSKVEIRRCEMHERDAVMAFIDEHWSKGHIMGNHTGLFEWQHRGV
FT                   GRQGYDFMLAWRGSELLGVLGYITMTRFDAALAGRHGIWLALWKVREDCGVAGLGLALL
FT                   RTLMQQEPHSWIGAVGINTAVMALYKALGFHTGQLSQYVLFHPTLVPQLAHRPRDFVAP
FT                   TVPLGDAQLVPLHAAALQAWPDLNGQAVPAKSNRYLQSRYLEHPYYDYQLFGVVRGEQP
FT                   VALLVARKVCHGGHCALRVVDYVGELHHLGACGGALSQQIVQQQCEYVDLWAHLPDTTP
FT                   LQQAGLHRVDAQGELMVPNYFEPFEARNVCIYYAFKGEAQHRIWRGDGDQDRPNRLAST
FT                   NK"
FT   gene            163172..163576
FT                   /locus_tag="Mmc1_0152"
FT   CDS_pept        163172..163576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0152"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42679"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y6"
FT                   /protein_id="ABK42679.1"
FT                   /translation="MSRAIDYDGWGTMIKTWNIKGKIHIQLDEPLNAKNQVAFLKAVET
FT                   HPQGEQVSLHMDLVPYIDSSGLASLLQLRDHAHGFHNVILCNPSERVLHTLRVSNFHRL
FT                   YTIQQSPKTAQSTATAASVQPMLNGGHNAL"
FT   gene            163846..164055
FT                   /locus_tag="Mmc1_0153"
FT   CDS_pept        163846..164055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42680"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y7"
FT                   /protein_id="ABK42680.1"
FT                   /translation="MANRVKRVEWINAEEADLFQYEDYLDAIMRPSERSLISGSQLPDM
FT                   LQGCEVLLRQAPCSTNRKSPFSTD"
FT   gene            164855..165130
FT                   /locus_tag="Mmc1_0154"
FT   CDS_pept        164855..165130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42681"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y8"
FT                   /protein_id="ABK42681.1"
FT                   /translation="MHQSFMADAIARRRIFAQLNDPTLIELQELANSGQLQDAELRRLD
FT                   RIIAKLYDEAARLSGAQCQVDSHTPDNWFEDEDLFPPADAFEDDWS"
FT   gene            complement(165365..165859)
FT                   /locus_tag="Mmc1_0155"
FT   CDS_pept        complement(165365..165859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42682"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Y9"
FT                   /protein_id="ABK42682.1"
FT                   /translation="MPISTQKHSFINLLQAEHHELLTLLDAVDAHGVEHPFGFYGLQAA
FT                   EQLIKEHLLREIEFLYPFLRQSVAHDAQLIHELVLLETDMKSILHWVELFFETYAHSTT
FT                   HENLKIDYQKLKHAIQERIQLARERLLPLYQELTALTPAPHDRGLTTTINRDSSPHTHH
FT                   C"
FT   gene            166168..167097
FT                   /locus_tag="Mmc1_0156"
FT   CDS_pept        166168..167097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0156"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG: dps:DP0663
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42683"
FT                   /db_xref="GOA:A0L3Z0"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z0"
FT                   /protein_id="ABK42683.1"
FT                   /translation="MSQPSTAPVKSKERITDKKVISLIKKALEEGSNLEVQVNNRSEVL
FT                   FTRFLDHPPQAVDGEVAEKSKYQPFSYLSAKDHLVIARVVPEESNENMVPGSLLRLRFY
FT                   NGKKAIESYVVLIEPIEIGGQHAYKLGFPTTMEAWDQRRHFRVKVIPELEIGIVEPMKA
FT                   RIMDLSVGGMAICFPSDMEPIPAGTPMNFKIKVPPSLEVQHQHEIKTKSGLVMELPSNP
FT                   DFELMGYVRNYGSANDQQICPKGQRCGVQFQISSALKAMQVGELYGFVEREFLRKQALS
FT                   KGDQGNFHAKSPHEGHSLLDKIKSALLG"
FT   gene            complement(167323..168606)
FT                   /locus_tag="Mmc1_0157"
FT   CDS_pept        complement(167323..168606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0157"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   mag:amb1309 uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42684"
FT                   /db_xref="GOA:A0L3Z1"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z1"
FT                   /protein_id="ABK42684.1"
FT                   /translation="MNGIFIALIFIAFSMAAFNTLTGDATAMQALSTAMVDAAKSSVDL
FT                   ALGLVGVMALFLGLMKVVEKGGLLTILAKLIRPLMIRLFPEIPPNHPAMGAMILNLAAN
FT                   ALGLGNAATPFGIRAMQALDSLNPQKGTATNSMALFLAINTSSVTLLPTGVITLRAAAG
FT                   SLDPAAILPTTLFATICSTTVAILAARLYQRFSPAPTSQTNNAENITMDDSLSIDQKEM
FT                   LQNSHTATSTTASYLFLAAILCLVPLTILYGKAISPWVMPGLMVGMLGFGMLRGVKVYE
FT                   AFIEGAKEGFDVALKIIPYLVAILVAVGMFRASGAMNLLIGLLSPITSWFGLPAEALPM
FT                   ALLRPLSGSGAYGILADTIQNPAIGPDSYVGLLVSTLQGSTETTFYVLAVYFGAVQIKR
FT                   VRHALATALTADLAGILAAVFICHLLFA"
FT   sig_peptide     complement(168523..168606)
FT                   /locus_tag="Mmc1_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.601 at
FT                   residue 28"
FT   gene            complement(169785..170987)
FT                   /locus_tag="Mmc1_0158"
FT   CDS_pept        complement(169785..170987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0158"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ppr:PBPRA2447
FT                   putative N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42685"
FT                   /db_xref="GOA:A0L3Z2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR030865"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z2"
FT                   /protein_id="ABK42685.1"
FT                   /translation="MRIDGVMTFSFFVEWAPWIVMGLILFGIGYRMGQHAPMEDMEEMA
FT                   RRRDAAFTYRGLNFLLNDEPDKAIEAFSQAVRVNSETVEVYLSLANLFLKQGELGRAIR
FT                   MHQNLLERPNLSRETRIAALYGLGEDYRKSGFVDRAVHAYHQTLEVDPGHLKALRALMT
FT                   LHENEKRWDKALEMLERIRKVTGDEDPRRAAHLRVQIGREQLRHDVAPPSVEDATRNFE
FT                   RAIEVHPGCVEARRIMAEVALKGGDPGHAVDLLKELRHTRPGHMFLLVDILRRSYDALE
FT                   DRCGFESCMDEAAHAQSASPQLMVQWGKWLEAEGRLEEVSALLEMGLRRRPDSAVLAQW
FT                   YVAFLGRHGRSDEGLLVATRCLDGIVGRQPNFRCTHCGFESHEIYWRCPQCHEWDEMEP
FT                   L"
FT   gene            complement(171166..173550)
FT                   /locus_tag="Mmc1_0159"
FT   CDS_pept        complement(171166..173550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0159"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: noc:Noc_2265
FT                   conserved hypothetical protein, AsmA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42686"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z3"
FT                   /protein_id="ABK42686.1"
FT                   /translation="MKKLLIALISLIVLVIVVLVAIPLFVDPNEHKPLIAEKVHEATGR
FT                   TLSLNGNLHLSLFPWAGVTIEAAELGNPADIGVGQAMVKLNKVDVRVKLMPLLSKQVVV
FT                   DRIIIDGLEAHLIRDKHGKDNWSDLSGGGKGAQTDTAAPQAGGTNQEKAAGSSPLAGLS
FT                   LGGVEISNAKVSFRDEQADLVASLNPLNLATGAVALGQPVDLTLDAKLAKRSISGKGEA
FT                   LDVGVQFSGQLQPAADMQSLLLNGMKLMIETTAKGLPVTKVQTQLSADVAVDLKGGTVK
FT                   ISRNKLAIEAEGSPELGMDTVRAALTGSIGVNLEPLTIEISGLDLTVQGNGGKLPGGSV
FT                   DLHMAADLLANMAAGTVGVKNLRLEGFEQQLKASGDVDVSNLNGDPRVGWQLTMQPTSP
FT                   KGLMSKLGLPALQTADPTALTKLALAIQGKLEMAGAGSVALSKFDLTLDDTHLTGTVSA
FT                   PRLDGTAARFDLRGDGLNLDRYMMTAGGEGAKAAQPNSTAEGKAAATGDEILIDQATMA
FT                   QLRKLDIKGQIVLDRLTAAKGHFEKVTIKVDAGDGVLKLNPFSVNLYKGSLVTTGQMDV
FT                   RGNEPKMAFRKVLQGVQVGDMLKEMADVTLITGQADLDLDTTTQGSTMKGLKRHVNGRI
FT                   QGGVTKGTLQGLDILGQIKAAYAMARGKPAPSGGSKDTAFDDMLLDARIVDGVIQHERL
FT                   KVSSNDLIMEGKGTVDLAEEQLDYHMEAKVRNLGGDGKSLTVPVLVKGSWNSPGVSVDT
FT                   AALLQSLAKEQAQDKINDVLDKKLGDKAAPVKQLLKGLKLF"
FT   sig_peptide     complement(173440..173550)
FT                   /locus_tag="Mmc1_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.805 at
FT                   residue 37"
FT   gene            complement(173579..174511)
FT                   /locus_tag="Mmc1_0160"
FT   CDS_pept        complement(173579..174511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0160"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain; KEGG:
FT                   mag:amb1437 nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42687"
FT                   /db_xref="GOA:A0L3Z4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z4"
FT                   /protein_id="ABK42687.1"
FT                   /translation="MATYLITGGCGFIGSHLADALLARGDGVRILDDLSTGKRENVQGT
FT                   CEIILGDVADSQTVRQAMQGVDGCFHLAAVASVARSNEDWVGTHRINQTGSVNVFDAAR
FT                   HAKDGQPVPVVYASSAATYGACQTLPIHEDAPRNPLTAYGADKLGSELHAVVASGVHGV
FT                   PTCGFRFFNVYGPRQDPSSPYSGVISIFTNRMRVGQDVTIFGDGGQTRDFVYVADVVAH
FT                   LLAGMDRATGEAKVYNVCTGREITLLQLALMIRSLLDSKIAIHHGEPRAGDIRESLGDP
FT                   RRATAELGVRAEITLEDGLKRLLDSLKNG"
FT   gene            complement(174594..175565)
FT                   /locus_tag="Mmc1_0161"
FT   CDS_pept        complement(174594..175565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afm:Afu2g17000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42688"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z5"
FT                   /protein_id="ABK42688.1"
FT                   /translation="MEPLAWIGIALGTMAVWFLWERGANKPSAPPPPPPQPRRENPKQT
FT                   VLPPEPKPEPKPKAAPATVTVEAVAEPDIEPIPASPPVAEPCVTPTAEAVPEKEAPPPI
FT                   TPTKPLVEKTVEPVTEPLVEKTVEPVTEPISVAQPKSRANDQKNALSEAKELMLPILSD
FT                   KYDKSYQGKNPLDENVESRMNPAQQICSCADFVQNRKDYPLGDIRRVCACQALKLTQIR
FT                   AKSCYEPLVWCAIIGGKQRDLSHFYQTDLLGDPAGIGFIPGGSVVALHTRAPKRGDDQG
FT                   HATGDYKVFEYDLSSREWLEPAPPIHLAEVAQPMLDDLFNTH"
FT   gene            complement(175862..176632)
FT                   /locus_tag="Mmc1_0162"
FT   CDS_pept        complement(175862..176632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42689"
FT                   /db_xref="GOA:A0L3Z6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z6"
FT                   /protein_id="ABK42689.1"
FT                   /translation="MSPNQLKNMLEQVANGTLTVQNALSQLKHFPTDTIQQQGQTIAQL
FT                   DTHRELRHGFPEVILAQGKKFAHLNAITSRALNHKRNLLITRIGKKRAAKLLANHPQLT
FT                   HHPLPRCVTWQPTANQPNIGLVAVLCAGTSDLAVAEEAALTARMLGAQVETHYDAGVAG
FT                   LHRLLAASTLLQTARVFIVVAGMEGALPSVVGGLVDRPVIAVPTSQGYGASLGGIAALL
FT                   GMLNSCASNVTTVNIDNGFGAGYVAALINRTSMP"
FT   gene            complement(177972..178988)
FT                   /locus_tag="Mmc1_0163"
FT   CDS_pept        complement(177972..178988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0163"
FT                   /product="thiamine-phosphate kinase"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein domain protein; KEGG: hit:NTHI1618
FT                   thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42690"
FT                   /db_xref="GOA:A0L3Z7"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z7"
FT                   /protein_id="ABK42690.1"
FT                   /translation="MGDKSVANLGEFGVIQHIFAPIQSKQGEGVQLGIGDDAACLVVPR
FT                   TQDLLATTDTMVEGIHFSSDADPYLLGQKALAVNLSDIAAMGGLPRWYLLSMAVPNRTS
FT                   QSWLEEFARGVKAASEMFHVALVGGDTVRSNAKIVITVQMLGLIGQHRAVARSGAQVGD
FT                   RLYLSGTLGDSAFGLAHLLGKLPAMLADDVSYLSRRHHLPEPRIQLGMALQDAALAHAC
FT                   IDVSDGLLADLQHICEASQVSAVVDVEKLPFSESAQRVIAQYGRSALELALTGGEDYEL
FT                   LFAISPGAADQVEKIVHQVGVSLVEIGEVVGVGERPGVVVRQGGEVLSIAQSGWTHF"
FT   gene            complement(178991..179488)
FT                   /locus_tag="Mmc1_0164"
FT   CDS_pept        complement(178991..179488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0164"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: deh:cbdb_A1206 N utilization
FT                   substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42691"
FT                   /db_xref="GOA:A0L3Z8"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3Z8"
FT                   /protein_id="ABK42691.1"
FT                   /translation="MAHKSDKSGKSRNTMRRGGRSKSREIALQVLYGCEIAHDPVGPAL
FT                   RNMLEDPHSEGMDQDYFSQLTLGVEAEREVLDSWIGRAGAAWSMDRFSVVDHNILRLGI
FT                   YELLKQPEVPHRVILNEAIELSKRFGGEESSRFVNGVMDKVANLVREEDAAPMRVWDTQ
FT                   ES"
FT   gene            complement(179498..179968)
FT                   /locus_tag="Mmc1_0165"
FT   CDS_pept        complement(179498..179968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0165"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   lip:LI0154 riboflavin synthase beta-chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42692"
FT                   /db_xref="GOA:A0L3Z9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L3Z9"
FT                   /protein_id="ABK42692.1"
FT                   /translation="MGDIIELEGHLTVDGKKFCLLLSRFNSFITERLLEGAIDCIVRHG
FT                   GKREDITVARVPGAFELPLVAQKAAKSGKYDGIVCLGAVIRGSTPHFDYVSSEVTKGVA
FT                   SISLAYDMPIGFGVLTTDTVEQAIDRAGTKAGNKGWEATISVIEMINLLDGM"
FT   gene            complement(179987..181213)
FT                   /locus_tag="Mmc1_0166"
FT   CDS_pept        complement(179987..181213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0166"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   GTP cyclohydrolase II; KEGG: sat:SYN_02371 GTP
FT                   cyclohydrolase II / 3,4-dihydroxy-2-butanone-4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42693"
FT                   /db_xref="GOA:A0L400"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A0L400"
FT                   /protein_id="ABK42693.1"
FT                   /translation="MSDFNSITEILEDFRQGKMVILVDDENRENEGDLIVAAEFCDAPA
FT                   VNFMTKHGRGLICLSLTQARVEKLQLPLMVVDNDAKFKTAFTVSIEAKVGVTTGISAQD
FT                   RARTIEAAIADTSGPEDISRPGHVFPLVAKDGGVLVRAGHTEASVDLARLSGLKPAAVI
FT                   CEILKDDGTMARVPDLIPLAKQMGIKLGTIADLIAYRRQTEQLVHRAVETRLPSAYGGE
FT                   WKLVAYTNDVDQHQHVALVKGNVDDGSPVLVRVHSECLTGDMFGSLRCDCGPQLQAAME
FT                   QIGQEGRGVIVYLRQEGRGIGLINKMHAYNLQDEGQDTVEANEALGFSADLRDYGIGAQ
FT                   ILKDLGVTHMKLMTNNPKKIVGLTGYGLDVVDRVPLEIKSGMTNERYLRAKKHKLGHML
FT                   RQFPESNES"
FT   gene            complement(181224..181895)
FT                   /locus_tag="Mmc1_0167"
FT   CDS_pept        complement(181224..181895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0167"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: gsu:GSU1689 riboflavin
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42694"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A0L401"
FT                   /protein_id="ABK42694.1"
FT                   /translation="MFTGLIETVGQVAALRKGHGEWQLSVQSDLPMAEVKLGDSIAVSG
FT                   ACLTVTQMAGRQFTVEVSQESVAKTTFAALQVGAAVNLERALRMGGRLDGHLVQGHVDA
FT                   VGWLESQQPRGGSMELWFRVPGEIGRYIIPKGSIAIDGISLTVNQVADGEDATRFSINV
FT                   IPLTQRKTTLGGLAVGGRVNVETDLLGRYVERLLRRGGNCAVKGSDHGITEAFLKERGF
FT                   A"
FT   gene            complement(182103..183233)
FT                   /locus_tag="Mmc1_0168"
FT   CDS_pept        complement(182103..183233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0168"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase / 5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="KEGG: mta:Moth_0915 riboflavin biosynthesis protein
FT                   RibD; TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase, zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42695"
FT                   /db_xref="GOA:A0L402"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0L402"
FT                   /protein_id="ABK42695.1"
FT                   /translation="MAKPDAGKDRAYMDHALRLAARGLGRTRPNPTVGCVIVKEDRIIG
FT                   RGWHRKAGGPHAEVEALRMAGEAARGATAYVTLEPCSHHGRTPPCCEGLIKAGIRRVVA
FT                   AMEDPNPLVSGQGFQRLKQAGVVVQVGVREEAAQMLIRPFITRILHNRPMVTLKSAASL
FT                   DGKTATRERHSQWITGEAARKRGHRLRDTHDVILTGIQTVLADDPRLTCRLKGGRDPIR
FT                   VVVDSSLKLSENAGVINPDSTAPVWVATTLRAPEEKRALFALLPGVEVIMCAEDDTGRV
FT                   DLYDLMEKLAKREITSVLAEAGGVLSGALLDKRLVDRIALFMAPMLIGGREASGILDSL
FT                   GAAKLTEAPRLDHVTLTSLDGDLLVEGCVVYGATEG"
FT   gene            complement(183412..184680)
FT                   /locus_tag="Mmc1_0169"
FT   CDS_pept        complement(183412..184680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0169"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   rsp:RSP_0823 serine hydroxymethyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42696"
FT                   /db_xref="GOA:A0L403"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L403"
FT                   /protein_id="ABK42696.1"
FT                   /translation="MNTADLKSFDPEVQSAIDEELGRQRHQIELIASENIVSPAVMAAQ
FT                   GSVMTNKYAEGYPAKRYYGGCEFVDKVEVLAIERAKQLFGCAYANVQPHSGSQANMAAF
FT                   MAIAPAGSTILGMSLAHGGHLTHGAKVNFSGQIYNAVQYGLNGESERIDFDQVQALAME
FT                   HKPAIIVAGASAYSRIIDFAKFREICDAVGAKLVVDMAHFAGLVATGEHPSPFPHADIV
FT                   TTTTHKTLRGPRGGMILTNDEELAKKINSKIFPGIQGGPLMHVIAAKAVAFKEALSPEF
FT                   KIYTQQVRKNAVALAEVLVEGGLRIVSGGTDNHLMLVDLTSRDITGKDTEHALERAGLT
FT                   CNKNAIPNDPRSPFITSGVRLGTPAATTRGFDEEAFRAVGRLIVRVVDAVAASGGAGDP
FT                   AIEAEVHKEVDALCQKFPIYADI"
FT   gene            complement(184748..185194)
FT                   /locus_tag="Mmc1_0170"
FT   CDS_pept        complement(184748..185194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0170"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="TIGRFAM: sugar-phosphate isomerases, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: mag:amb2338 ribose
FT                   5-phosphate isomerase RpiB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42697"
FT                   /db_xref="GOA:A0L404"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A0L404"
FT                   /protein_id="ABK42697.1"
FT                   /translation="MRIFFACDHGASELKQHLMAYLAKRDRVELVDLGCDGTTSVDYPD
FT                   YAATLCKAVLASAGDRGVLLCGTGIGISIAANRFAGIRAALCHDAYTARLCREHNDANV
FT                   LVLGGRTTGPAVAEEMLDLWLDTPYAGGRHQRRLDKIESNAREV"
FT   gene            185502..186671
FT                   /locus_tag="Mmc1_0171"
FT   CDS_pept        185502..186671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0171"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mac:MA4452 glycosyltransferase (group I)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42698"
FT                   /db_xref="GOA:A0L405"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0L405"
FT                   /protein_id="ABK42698.1"
FT                   /translation="MPPTKHPLSVAYVNSIDLPDNRRAHAMQMLKNGQAWSQCVEQFEF
FT                   ITNVWWHNRNRLTVENMAAFYGLTHPFTLIPYPLRRLEQSQYRWLRELYFQLAAWRCKR
FT                   KRVDLVYTRTYPLLAYTLKLGIPTVVETHSPPGRNEEADAMLSLADHPNLVALTTISEP
FT                   LAERYRAFGVPADKIMVLPDGVDLERFEPALTLAEARQQLGLPLNQSIATYVGHLYEGR
FT                   GIDTLLSAALKQPKVLFLIVGGYAKDMERWQHRAAQMGLENVRFEGFVANERVPLYLWA
FT                   GDVLVMPYGNACTTTEWMSPLKLFEYMAAGRPIIASDFPILREVLENGKNGLLVPPDDG
FT                   EALAAAMDALLADAPRRQALGAAALHQVRPYSWVNRVEQVINRFNRYGQ"
FT   gene            complement(186895..188607)
FT                   /locus_tag="Mmc1_0172"
FT   CDS_pept        complement(186895..188607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0172"
FT                   /product="SSU ribosomal protein S1P"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: mag:amb4261 ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42699"
FT                   /db_xref="GOA:A0L406"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0L406"
FT                   /protein_id="ABK42699.1"
FT                   /translation="MTDDLILDDIADEDFEALLEESFSKGVGREGSVVTGTIIQREGDE
FT                   FIIDVGLKSEGRLTIREFYDADGQLTIGVGDSVDVFVERCEDQNGLAVLSREKAKREEA
FT                   WVLLEEAFNDGKTVDGRIMGKVKGGYTVDLGGLAAFLPGSQVDVRPVHDISRLQEETQP
FT                   FDILKMDRRRGNIVVSRRTVIEKHRENARSALLETLHEGMVLDGIVKNITDYGAFVDLG
FT                   GLDGLLHITDMSWKRVKHPSAVVNVGDTVTVQVIKFNSDTQRISLGMKQLLIDPWEGIG
FT                   AKYPAGAKFSGHVTNITDYGSFVELEPGVEGLAHVSELTWTKKNIHPSKILEVNQIVEV
FT                   MVLDVDADRRRISLGIKQCQENPWEAFATSHPVGAMVKGEIKNITEFGLFVGLEGDIDG
FT                   LVHLSDITWDTNAGEEVLKDFQKGQEVEAMVLSLDPDKERISLGLKQAQPDAWGQWVDA
FT                   NPKGNVVMGKVKEVLSSGVLVQLADEVDGHIRKAEFSQDDREGTNLTLETEVECRVMQV
FT                   DRQKRKISLSIKAMEVQQERDAIKEYASDSSSAATSSLGEALSQALEKANAAE"
FT   gene            complement(188971..189648)
FT                   /locus_tag="Mmc1_0173"
FT   CDS_pept        complement(188971..189648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0173"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="KEGG: eca:ECA2592 cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42700"
FT                   /db_xref="GOA:A0L407"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L407"
FT                   /protein_id="ABK42700.1"
FT                   /translation="MAERLRIAVDGPAGAGKGTVCRAVARRYQWAYLDTGAIYRAVALH
FT                   ALNSENFEETSLAQWAAQMDFRFEVDAQGDAHAFLEGTEVTNKLRDEQVGETASQVAAM
FT                   PAVRTALLDFQRNYGSPQSVILDGRDVGTVVLPDADLKIYLTASLQARAQRRTLELQGK
FT                   GESVSMDRIKSRIEERDARDQSRATAPLAAAPDAQTVDTTYLSQTESIETVARLVASLL
FT                   EKP"
FT   gene            complement(189641..190978)
FT                   /locus_tag="Mmc1_0174"
FT   CDS_pept        complement(189641..190978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0174"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="KEGG: gsu:GSU2606 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42701"
FT                   /db_xref="GOA:A0L408"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L408"
FT                   /protein_id="ABK42701.1"
FT                   /translation="MSSTHPGRTIRSGATQNLSGTIRPAADKSISHRSVIFGALAEGET
FT                   HVKGMLEGEDVLRTITAFRTMGISIERCNEGEYRIQGQGLDGLKEPDDVLDMGNSGTAM
FT                   RLLCGLLASQPFHSILTGDHSLRSRPMGRVVQPLTKMGARIRGRDGGRLAPLAIEGTEL
FT                   VPITYNSPIASAQVKSAIILAGLNTAGETTIIEPAVSRDHTERMLIAFGAEVTRDGNQV
FT                   TIEGWPNLQGQEIEVPADISAAAFPMVAALITPGSDIILENVGMNPTRTGILDLLLAMG
FT                   GNIQRLNEREVGGEPVADLQVRYSQLQGIEIDPTVVPRAIDEFPVFFVAAALAQGQTLV
FT                   QGAEELRVKESDRITAMANGLKALGAIIEERPDGALITGNPDGLAGGASVDSFTDHRIA
FT                   MSLLVAGLRCKESVLVQRCDNINTSFPSFSQLMNSLGFQLEDVSHG"
FT   gene            complement(192502..193395)
FT                   /locus_tag="Mmc1_0175"
FT   CDS_pept        complement(192502..193395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0175"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: gsu:GSU2607
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42702"
FT                   /db_xref="GOA:A0L409"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L409"
FT                   /protein_id="ABK42702.1"
FT                   /translation="MSVLIKRLTLIGVGLIGASLAQALRKRDLVGEIVGVDRRRASLDY
FT                   ALEQGIIDRVETHAARGVEGATLVLIATPVSTIVSMVEDCVAGLGRGVVVTDVGSVKGR
FT                   IVERCEALMPEGCAFVGGHPIAGREHSGVEAALASLFDGARTILTPSSVTPRWALELVT
FT                   EMWESVGATVESMEPHWHDQVLAATSHLPHLMAYNVVNTLSDLEDHLRTEVFRYAASGF
FT                   RDFTRIASSDPTMWRDICLENKDAILSILGRFKSDLEKLTKRVEEEDADGLYGIFARSK
FT                   DTRARILQENKILRGE"
FT   sig_peptide     complement(193324..193395)
FT                   /locus_tag="Mmc1_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.654) with cleavage site probability 0.473 at
FT                   residue 24"
FT   gene            complement(193405..194511)
FT                   /locus_tag="Mmc1_0176"
FT   CDS_pept        complement(193405..194511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0176"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: prephenate
FT                   dehydratase; Chorismate mutase; amino acid-binding ACT
FT                   domain protein; KEGG: pca:Pcar_1887 chorismate
FT                   mutase/prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42703"
FT                   /db_xref="GOA:A0L410"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A0L410"
FT                   /protein_id="ABK42703.1"
FT                   /translation="MSHDPIDLNPSTLVELRDGIDAIDDRIHDLLMKRAELVMRVGELK
FT                   GKGPAGTPFYRPEREAQIHRRLEGRHGGPLPVEAVHRIFREIISASLNLEKQLSVAYLG
FT                   PEATFTHEAALKQFGSAFTMFSTRTITEVFHEVEIGRANFGVVPVENSLEGVVIHTLDR
FT                   FVRSPLNICGEVLMPVELNLLARGGVLGEVRVIYGHFSALDQCAQWLSHYLPQVKRVEV
FT                   ASTAEAAERARREEGAGAICGPFAANRYGLVVIAEHIEDQARLENRFLVVGRESPAPSG
FT                   ADKTSIMVSFLDDPGFLHRILGVFAERGINLSRIESRPTQERAWDYLFFIDMEGHRQDE
FT                   GVSAALEALGALSGVSVKILGSYPQHAL"
FT   gene            194853..196163
FT                   /locus_tag="Mmc1_0177"
FT   CDS_pept        194853..196163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0177"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: sde:Sde_2065 ammonium
FT                   transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42704"
FT                   /db_xref="GOA:A0L411"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A0L411"
FT                   /protein_id="ABK42704.1"
FT                   /translation="MMRFSSHLLKGGALFALLLITPTWAWAAEQGLDKADTAWILTTTA
FT                   LVLFMTLPGLALFYGGLVRSKNILSILMQCFAIACLVSVLWLAGGYSLAFEHGGPLNGV
FT                   IGSLQKAFFAGVAHNTVKGSLPEGVFAAFQMTFAIITPALVIGGFAERIRFAVILPFTA
FT                   LWLLLVYIPVCHWVWGGGWMQAAGVMDFAGGVVVHITAGVAALVAALVLGPRNGFQKTV
FT                   MFPHNLTMTYAGAAMLWVGWFGFNGGSALTADGSAGWAILATHMGAAAGSLAWMGMEWM
FT                   RHGKPSVLGIVTGMVAGLGTVTPASGYISPFGGFAIGLIAGVVCYLATMMVKQRWKIDD
FT                   SLDVFPVHGVGGMIGTLMTALFAAPLFGGHGLASNAQILPQLATQGVAVGVTALYTAVV
FT                   TWLIFKGLAQVMQLRVSRDQETEGLDLVDHDERGYNL"
FT   sig_peptide     194853..194936
FT                   /locus_tag="Mmc1_0177"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.975 at
FT                   residue 28"
FT   gene            complement(196232..197314)
FT                   /locus_tag="Mmc1_0178"
FT   CDS_pept        complement(196232..197314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ljo:LJ0641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42705"
FT                   /db_xref="UniProtKB/TrEMBL:A0L412"
FT                   /protein_id="ABK42705.1"
FT                   /translation="MARPSWYKYASSLTSLLIATLLMVQLWSRSEQLEPIPWLPPEVSQ
FT                   EAQPSLPLQVVQLPAPPVQTAATAQLPTPTAAPTLPQQSTAAHPPMPPLKPETNPVAHP
FT                   LLPTAMLNPVTPVQTIKPLKPSPLAPLEVTVQAMPQSSPSAAPLEIPAEARHALKPHPK
FT                   PVTQEAMPRVTPETTLQPANPTPQPTEVQVQQGRVLLKLLEHGKGPSITLRWPNQQRQT
FT                   LYRHMVQCRGMRSGVMDAQQHIFMPGGTPGVAWSINRDRYSGFMRLTNQVENQERLQLQ
FT                   EIRHYHGLESATTPIRLFPRRFDAALLGGLQHLIGPTYGTARSIEANYRLQQGRLWVEA
FT                   IKVDGGAVAGQIDLNLHPCL"
FT   sig_peptide     complement(197228..197314)
FT                   /locus_tag="Mmc1_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.611) with cleavage site probability 0.486 at
FT                   residue 29"
FT   gene            complement(197339..198001)
FT                   /locus_tag="Mmc1_0179"
FT   CDS_pept        complement(197339..198001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rno:304601 bromodomain adjacent to zinc finger
FT                   domain, 2A (predicted)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42706"
FT                   /db_xref="UniProtKB/TrEMBL:A0L413"
FT                   /protein_id="ABK42706.1"
FT                   /translation="MKYLLFNVVVGAALLYLFAGPSNLPSLPSKPTAQLPHDLDRVADR
FT                   MIKNLDQRLQENLIQRPQTQPAVEKRQPKSVPTPPNLEREASQLAEPSAPLAVSPQVTP
FT                   VSPPLPEQPAPPLFKAAPAARAIATKPQVDPPSQTEPPARVAVALEPAVMQRRAEVLAG
FT                   TGVVIPPEMIVEHHTTPNKVAVKLAEGESLMSPHNRRRELRALANDMESLYIDILTQ"
FT   sig_peptide     complement(197900..198001)
FT                   /locus_tag="Mmc1_0179"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.622 at
FT                   residue 34"
FT   gene            complement(197982..198572)
FT                   /locus_tag="Mmc1_0180"
FT   CDS_pept        complement(197982..198572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42707"
FT                   /db_xref="GOA:A0L414"
FT                   /db_xref="UniProtKB/TrEMBL:A0L414"
FT                   /protein_id="ABK42707.1"
FT                   /translation="MALPAPLQQGSAALSYLLGGVALALALATLATSLQVTDIIAWLKQ
FT                   VFGVTFLVLMSILLVIALTAWIHVWRSAATPESDGVWLESGMQAANGVTTLALTYTLLG
FT                   ISLGIGSLADQALTPETVQSIVGELTAHFSLAFMTTVVGLPLSAVLRAMLMVSHAHNVA
FT                   CWQHLAVMSQPQPLTAILMDADEEEKHHEIPAV"
FT   gene            complement(198575..198955)
FT                   /locus_tag="Mmc1_0181"
FT   CDS_pept        complement(198575..198955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42708"
FT                   /db_xref="UniProtKB/TrEMBL:A0L415"
FT                   /protein_id="ABK42708.1"
FT                   /translation="MTIQQTLAAMALLLVSTTAQGGTLDNLERERAILIGTLLSPEITY
FT                   AERETKVNHSTRRLVDLERMVWRDSNLAKEGGPSVKKALDNFDLTFLVHASIEKDRLVV
FT                   DHWLEQLGLTSTTLSTARMGRR"
FT   sig_peptide     complement(198890..198955)
FT                   /locus_tag="Mmc1_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.856 at
FT                   residue 22"
FT   gene            complement(198968..199864)
FT                   /locus_tag="Mmc1_0182"
FT   CDS_pept        complement(198968..199864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42709"
FT                   /db_xref="UniProtKB/TrEMBL:A0L416"
FT                   /protein_id="ABK42709.1"
FT                   /translation="MNSLRRCKPVTLGTLLLMAALMGHAQAASDQDTAQWRPQISEKLI
FT                   RLPPNMMNNALERDYADSGLAMAISDVGAQVGLKRQTLTDLKQAVQKADGDLKVEMQHQ
FT                   YLAEKRQFVTLMQQHLDLRKKRQQIKLDTYQRLMQQLRTAKESTPKEVTELQTKQENLQ
FT                   KRFERSVSKVDMKIFGTPDGESMPSRYNTVYQANQQAMHKLLAALEAHPMNRELDNHAL
FT                   EPESKQDFLRNLMVESEKEMALVSQERTILGYMAKMVALDALSLSEKVQDPDLLDSDVP
FT                   ADAQITTSVDLFVSDEK"
FT   sig_peptide     complement(199781..199864)
FT                   /locus_tag="Mmc1_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 28"
FT   gene            complement(199864..200442)
FT                   /locus_tag="Mmc1_0183"
FT   CDS_pept        complement(199864..200442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42710"
FT                   /db_xref="UniProtKB/TrEMBL:A0L417"
FT                   /protein_id="ABK42710.1"
FT                   /translation="MSKTVSPLSFGRAVALLLALTGLSGCASPGLPMGTLSPTEGVGFR
FT                   ESRFAALEALQNYRQCKQEALTMDREARSSGQAARYLASARLFEQCETRLPPGSADVAT
FT                   EERMRAYAVGILDYIKAGDLEQAHVNLDKFRRTFKDQDLYLKGGASFVDSMEILLRRTD
FT                   PDQFPRYSLLNVDSTLKDEMRRLNHWSHN"
FT   sig_peptide     complement(200359..200442)
FT                   /locus_tag="Mmc1_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.457 at
FT                   residue 28"
FT   gene            complement(200822..202267)
FT                   /locus_tag="Mmc1_0184"
FT   CDS_pept        complement(200822..202267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42711"
FT                   /db_xref="UniProtKB/TrEMBL:A0L418"
FT                   /protein_id="ABK42711.1"
FT                   /translation="MSIRVIIATTEGPVTVQRITLEDPDLQSVVCLNGTTRALPISGDY
FT                   DAFVRPPTGMIQDDFTQAAYRLDLSDTIDQGFSWQLGAYAAHLLFYHEELAQRDEPAQA
FT                   VWWLTGQVDRDHTVRGVEHVAEKFQESALLFRALVAQGIPIHLFLPTANQADIDLDLLD
FT                   ELASPDLIQITTLEQVEQLPNPGKRIAAAASLPLTLGTPPRLPVHAPVLTQPQAKATPW
FT                   LKGLLVVQLMVFAGLIWFAWQQGLPSWVVWAKSQDYAHRLQLQAALTTNQCDVCQRLFH
FT                   LYMDRQGGIQPIDPPQLSLERIVIQAPDSVRGCREMDHPPPGQAVQPQVSVLAAQDETL
FT                   PILMANRHLCQFKFRVVNGEETVHTRLWVIAKSDLPRSRNQTDEEGSRFWKMERALDAE
FT                   ETLLWNSPRVGPWIRTPLNYQVLILAARTPLESATTWLKESRRQARAAGQTWDWHTAQQ
FT                   QLAKLGVHLMQVNQPLHPMARQL"
FT   gene            complement(202264..202779)
FT                   /locus_tag="Mmc1_0185"
FT   CDS_pept        complement(202264..202779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42712"
FT                   /db_xref="UniProtKB/TrEMBL:A0L419"
FT                   /protein_id="ABK42712.1"
FT                   /translation="MKQSARDATTATLFTALSQLDTLRQPRDEHVERPIGYTQLMQYIQ
FT                   GDGPTSLAVVRALKADAKLKASYHQLLQRRAMCYFPAVVAASSGEINERQTDGWKIRWK
FT                   TSRADANQIYLLIELKPHMERTPTKLTVEEERITLPEPVNGTIQLLVEANCAIMQGLRN
FT                   KDSKVYLH"
FT   gene            complement(202776..204407)
FT                   /locus_tag="Mmc1_0186"
FT   CDS_pept        complement(202776..204407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42713"
FT                   /db_xref="UniProtKB/TrEMBL:A0L420"
FT                   /protein_id="ABK42713.1"
FT                   /translation="MNQGWASERMLLQEGISDHLLGLLSMVAETEQDGDIKFPPQTCHE
FT                   LQRMLVCRTYAQSMIELCYLLRAGHACGDHVTLFWEVGAARSQRFRHYFNERLPAQQVT
FT                   AESSGVVIADQQDRFTVHYSRMPLLAALWEFLFSALDYAQLDESITTMLMHHGDSRQAT
FT                   SQCANQLARLLYAFLKDHLPEAQQQRKFRRITQFIQNYTNNHTFAPDALDNSAILQFWQ
FT                   QFSLGHDEDGGDFKKFETVYHDFLNYRRALRAAIHQQALMHTHVLGTDRDAGEWEPDSE
FT                   QSAALWETLRELDEEASPLHHLNTPPCDEIKFFNNREQNLLKRIVEGNRDANDLALSLL
FT                   RCELFGHTQACIVQALRQKVEGADLLKTIAEINTPSYRQHQQSMQDIAHHLTRVQYASL
FT                   HLLLYHQEAESIRLILNLYPDLDLSKGREHHTESVGDEGSMDGVAQLRSILEQQGVWQS
FT                   VQREAARAYKGIARQGFRDNEMDSPTICAGHAQAAPLLEQMDKLLSRFLTTLHHLFPDE
FT                   NEADTLFAADRAAFTRQFRRMYGGES"
FT   gene            complement(204404..204901)
FT                   /locus_tag="Mmc1_0187"
FT   CDS_pept        complement(204404..204901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0187"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   gsu:GSU1826 lytic murein transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42714"
FT                   /db_xref="GOA:A0L421"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0L421"
FT                   /protein_id="ABK42714.1"
FT                   /translation="MIRSLLILICLMFSFSQPLLASPKQQRQQIQQLIIEEAKNLNIPI
FT                   SLALAVAHVESYFDPQVESHKGACGVMQIMPATAMGEYGIPKNMLWNPKINVRLGLHFL
FT                   QRLLQRYKGRVNLALSYYNGGSRVGDLPHAHIIPATRPYVAKVRHWQKQYQYKLYHGLD
FT                   LL"
FT   sig_peptide     complement(204836..204901)
FT                   /locus_tag="Mmc1_0187"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            complement(205097..205366)
FT                   /locus_tag="Mmc1_0188"
FT   CDS_pept        complement(205097..205366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dme:CG10910-PB CG10910 gene product from
FT                   transcript CG10910-RB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42715"
FT                   /db_xref="UniProtKB/TrEMBL:A0L422"
FT                   /protein_id="ABK42715.1"
FT                   /translation="MGTRALGETTHGPWALGETTHGPWALGETTHGPWALGETTHGPWA
FT                   LGETTHGPWALGETTHGPWALGETTHGPWALGETTHGPWALGYP"
FT   gene            complement(205704..206516)
FT                   /locus_tag="Mmc1_0189"
FT   CDS_pept        complement(205704..206516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0189"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   chy:CHY_0404 transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42716"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0L423"
FT                   /protein_id="ABK42716.1"
FT                   /translation="MKMRRGGHLLMRGVVVAGMALVVVMPIRGQAATRQEVKEMVVQEA
FT                   MRQDVPSTLALAVAKVGSDFQGLAQSKQDAQGVMQLPPNLVERLMVRVTDLSQDQLQRP
FT                   QVNIRYGVTYLKLLLKQYGENWEKALLHYLSGERPDRVSGGMVLEKEQETVLSMLRWEK
FT                   RYRDQMSVWQAATGVEVEKLTEQVSVLSRDLRAAREQSRVEDEDWYAPPPSMRGRRGPP
FT                   GHRHGFRGRGSHPHPPPPPHWRGGAAGDAADFWYGSGLKGGRAGMQWN"
FT   sig_peptide     complement(206421..206516)
FT                   /locus_tag="Mmc1_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 32"
FT   gene            complement(206550..206840)
FT                   /locus_tag="Mmc1_0190"
FT   CDS_pept        complement(206550..206840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42717"
FT                   /db_xref="UniProtKB/TrEMBL:A0L424"
FT                   /protein_id="ABK42717.1"
FT                   /translation="MKKLMLTIAMAAAMGAMMVPVKQAEAASIYFVNNYGNDKQSRWEG
FT                   KHNRHNQMIQRSVRHSLVESTRNPMWRDAVVKIVRERGSISRVVVILPQGF"
FT   sig_peptide     complement(206760..206840)
FT                   /locus_tag="Mmc1_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            complement(206837..207253)
FT                   /locus_tag="Mmc1_0191"
FT   CDS_pept        complement(206837..207253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42718"
FT                   /db_xref="GOA:A0L425"
FT                   /db_xref="UniProtKB/TrEMBL:A0L425"
FT                   /protein_id="ABK42718.1"
FT                   /translation="MDNHTTNNAMTEIALALAMGFFSIMVLAMVSMGGGVGSANKIAGA
FT                   VMAASDNAQTPKAVVEVQEQDRMILYYNGHFFDQNMHQVKPETLPQGGRTILALAPETS
FT                   MTQALKLRGLFGQRDVIVSTLDTRWIRALQEKTP"
FT   sig_peptide     complement(207107..207253)
FT                   /locus_tag="Mmc1_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.591 at
FT                   residue 49"
FT   gene            207565..208800
FT                   /locus_tag="Mmc1_0192"
FT   CDS_pept        207565..208800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0192"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: cps:CPS_3260 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42719"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0L426"
FT                   /protein_id="ABK42719.1"
FT                   /translation="MYRFAKAGWCSLFILLLLYNPAAMAAPLAPYHIYMDADWSGANPS
FT                   SQAIEWGIRTALDERNNTIAGHPVKIVRANHRGNNRRHLRNQQIFLDDARALLVYSGLH
FT                   SPPLLANKKFINDHAILTLNPWAAAGPITRSLAPNWIFRLSIDDAVAGQVIVHHALTKR
FT                   GFKKLVLIAEDTSWGRFNHQNMSKKANEYGMEELPVIWSNWGISKAAAKIILRQAASMG
FT                   ADAVLLVVNPAESITFATAMAELEPQRRRPIQSHWGVSAGSFSQKVGENVLKVLDLEYV
FT                   QTRFSFLNGMLSEHAKQVLARAMRLFPDAIKTPQHIRPPAGFKHAYDLTRILLAAADQV
FT                   QLSGDVKQDRLLLHHALEHLQTPVQGLIKTYHMPFSPPKSDTSDDHEALHIHDFTMATF
FT                   DVLGNVQIQQEP"
FT   sig_peptide     207565..207642
FT                   /locus_tag="Mmc1_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            208802..211576
FT                   /locus_tag="Mmc1_0193"
FT   CDS_pept        208802..211576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0193"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: tbd:Tbd_1456 putative diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; histidine
FT                   kinase, HAMP region domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42720"
FT                   /db_xref="GOA:A0L427"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0L427"
FT                   /protein_id="ABK42720.1"
FT                   /translation="MECPPYRLSLSKRFGLVIGMALLVVALLLGTMLAQGMDRNFEQQL
FT                   QHLHELHLNRLAQQLRQYIQSRLTVLADMAANPLTIQGVLQPETSLLNTIDWLQNSRLI
FT                   GESFPLILMDYQGQILHQTVGDEQPAPTAVRAVLGGKQTQIQYLEGDHLNGDHQLWLIT
FT                   PVRWQASIEGALAVRIPLQHISPLTAQQGHFNHDGIRLWQGNRLLFSQGQMENGYSSRK
FT                   ILGELGLTIELVMDQKPLIKARSKLFRETLIVGILLLLLLSVTLYYWGQKRLVRPLMAL
FT                   SRQVDAVTKGDDPAPPMGTKMGTTIVEIIQLGEKFDHMHKEITATRRHLESLVNERTQA
FT                   LQIELQERTRTAAELRLLNDLQEAILESADAMIIATDAAGTVIKFNKAAQHKLGYADHE
FT                   VIYRLTLDAFHDPMELQHRHLPVTEGDTQNLSIPLQTLFSRAAQNRTDEREWRYRRQDG
FT                   TTFPVRLSITQVWDVESNNRRGFLVVGMDITELKSFQQALLRNQANLAHAQAIAHLGSW
FT                   QWELENGRMHWSDETFRIFGEPLQSFEPTFEDILSRTHPQDMKSLEQMVTRALANPEIP
FT                   FEMEARLRRANGDLRSVVMLGEVTYDQNRKPIRVSGTVQDITERKKAEDSLQLAKQIIE
FT                   CTSEAIVITDAQGIITDINPAYEEITGYSRGEVIGQSPAITQSGRHDPTFYQQLWHLLQ
FT                   QTGHWEGEMWDRRKNGELFPKWLTINALHNLYGQVSHYVGIFLDITKQRGEIERSKQNV
FT                   FYDPLTKLPNRILFQDRLEHILAVAAHKQERIGLFFIDLDHFKQVNINIGHDVGDLLLV
FT                   EVGKRLRRHLPPSDTVAHLVGDKFAIILPHSRTRTELAQLAETILHLFDESFLIRDHNL
FT                   SIGCTIGIAVSPADGTVYPELARNSNTALYRTKGLTRGRFAFYSEEISSSPMP"
FT   sig_peptide     208802..208912
FT                   /locus_tag="Mmc1_0193"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.799 at
FT                   residue 37"
FT   gene            211950..215048
FT                   /locus_tag="Mmc1_0194"
FT   CDS_pept        211950..215048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0194"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; Hemerythrin HHE cation
FT                   binding domain protein; KEGG: dde:Dde_0703 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42721"
FT                   /db_xref="GOA:A0L428"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A0L428"
FT                   /protein_id="ABK42721.1"
FT                   /translation="MKLKTKLITPVILLLVVTALVVLQVSSTALQQNTHILLDEQISAK
FT                   MVSVDQNIERMSNTALLASAIIANLPQVKEAYTLQTSDEAAARKLLAEHMAPIKKTVEQ
FT                   ITGMKQFRVHFHLPPVRSFLRIWNGTGGDDLSSFRNTVQQINVQGKPLKGIEIGRGGFV
FT                   LRGIAPIMNDAGVQVGSLETLLPMAEVMKKSKVLATEELAILLHDRYLSIAKKLEKSNP
FT                   KRAGKFVYTGSTKGFLADLVEPEALLSAMQSDQKRAHKQHTLAYHSIRDFSGAPVGVAV
FT                   YQLDHRKVLANQQQMITRLIVIILILMLFAGLAYALLIARFVKRIFHIAEEIGGITGGD
FT                   VTRRLAIATKPDELGAIGGNFNKMVHSLASTLRRVSLQAESLTAAVRQLGEVKTVLTED
FT                   ATAIRSRANQTDEETQHQVEVVAKIHQAVKETNTYMDNIALQSGDLAHSMDEVANDAES
FT                   VSSNVTTMAAAAEQMSMNVGGMQRNIEQVSQSMVSVNTAVEELRHALGGVAQRCQHARS
FT                   ESDRASQQSDETREAIEHLSGYTKEIGKVVELINAIAEQTNMLALNAAIEAAGAGEAGK
FT                   GFAVVANEVKELATQTSSATQSIADQINAIQKQTRVVYDATGDVEQIVQNINSANMEIA
FT                   EAVAMQTLAITEINHSVEAVREASNTTSGMAGELASAATEVAQSASMAAGGVERIANSA
FT                   AASAHATHEVTAASERAKQQIEQLFLVAQEVSTGVTNVEQNMSEVKDLSRYMEASVLQF
FT                   GTLVDMVSNSTENLNTTMIALNWGEAPFDVEGVKKAHLNWLTRLSHVIMRRTAMRAEEV
FT                   TDAHHCELGKWMDREGQEQFGQTPVWQEAVKVHERIHELAKEVVKASNAGNLEQANKLF
FT                   ADFNAYRINLFENLDAIFVGPEVDAEPIAVVWKPNMSVGVQIFDQDHRRLVSYINRLEL
FT                   AHRAGQSKTALERVLRALTDYTLIHFRREEKMMTESNYPGVQAHKAQHTKLEDQVADYN
FT                   RRMLQEESHITEEVLTFLKGEFLDHIMRTDHEYSDHFRSKGII"
FT   sig_peptide     211950..212039
FT                   /locus_tag="Mmc1_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.716 at
FT                   residue 30"
FT   gene            complement(215224..215565)
FT                   /locus_tag="Mmc1_0195"
FT   CDS_pept        complement(215224..215565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42722"
FT                   /db_xref="GOA:A0L429"
FT                   /db_xref="UniProtKB/TrEMBL:A0L429"
FT                   /protein_id="ABK42722.1"
FT                   /translation="MHKFTLAKFLARHALIGFFMSAILVTAMVYWDFQHMGTLILSSAA
FT                   PALVLGVLTFFVGLTLASAQMAIAVMLLAEPEDNGTRGKFIGLVVDWLTPPRPMVPVPV
FT                   KANRHPPQR"
FT   sig_peptide     complement(215482..215565)
FT                   /locus_tag="Mmc1_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.687) with cleavage site probability 0.346 at
FT                   residue 28"
FT   gene            complement(216041..216388)
FT                   /locus_tag="Mmc1_0196"
FT   CDS_pept        complement(216041..216388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0196"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: psb:Psyr_3452 sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42723"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0L430"
FT                   /protein_id="ABK42723.1"
FT                   /translation="MLTLHKEVQEGVVILILEGRFDVSSIETFQEAYADQPPGTIFKIH
FT                   LDKVTYIDSAAFGLFHALKQHLGNLGRVMLYNPSDEVTHAIQVLGAHRSFEIMRFTTHK
FT                   PLMHHGDDDGF"
FT   gene            complement(216566..217792)
FT                   /locus_tag="Mmc1_0197"
FT   CDS_pept        complement(216566..217792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42724"
FT                   /db_xref="GOA:A0L431"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A0L431"
FT                   /protein_id="ABK42724.1"
FT                   /translation="MCDYPSIHTEPACFGAERFSMLRVVLRYTLLLLVMVVALLLYMAQ
FT                   SPFPDGVLRVALDAPMDNYSRPMTSLWQKNRYFAWRSSQGMLFIGQRQQDGQFEATQLG
FT                   DTLPHQRQPILHVVQSGPHAGIVVVAYHDAQGHLLVQQTRRPADTRAWNPPQLVVDEEV
FT                   THINLLENPAGELLLVYQQPLGEQNQIFIRFSHDGGRQWGSATLLAHHSGTQKDQLLVA
FT                   GTPLASGYQISLFMLQPQAAAQSLHLLQGVIPTGSRSWQPIENKPLTKILATQPNTHYT
FT                   LQDLRVNGAWLRLLWRDDTLGVGHWLGWHQGEVHLHNLGAVAAAPCGMTLPQNPLEVTL
FT                   LRKAQVQQISLQDNTMQVVHVAPAQLGKGCHMYGIPDGEDLDLLLSHQAAPNRPSALLG
FT                   LSWRRLEQP"
FT   gene            217909..219450
FT                   /locus_tag="Mmc1_0198"
FT   CDS_pept        217909..219450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0198"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase;
FT                   KEGG: gme:Gmet_0339 sigma54 specific transcriptional
FT                   regulator with PAS sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42725"
FT                   /db_xref="GOA:A0L432"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0L432"
FT                   /protein_id="ABK42725.1"
FT                   /translation="MDDAEFLEGLLQLEAELEQRPAAGERHDYTMLTSFYLESLPRAMH
FT                   CDAVQLYLLEANQWYRMLANPLHGEPITLESGSTIPACIESHQALITRQPGHQARLCMP
FT                   LVSRVRRRVLGVIELLRFGEQAQFTAADLTRLEPGAENLCQALDNLLVTGALVTQPGQP
FT                   SQPPPPVDVTIRSVGVVAESAVMREVFTLANTLSAVPVNVFISGENGTGKEVVSRYIHD
FT                   NSTEGEQPFVAVNCAAIPESLAESEFFGYEKGAFTGAVGSRKGHFEAANGGVLFLDEIA
FT                   DLPLSIQPKFLRALQEQEGQRLGGQKSVPYHFRVISATNKDIRQEVAAGRFREDLFYRL
FT                   FAVDIHIPPLRERREEILPLARAFLRDINQRFGKKVPGLNPEVAERFERYHWPGNVRQL
FT                   RREMERLVALTPDGASIGLAACSPELRHSSPVPPALESSTLPLSGSLLTPTAAVFPLHP
FT                   HLPMAQQMVLFERHLIETALQQHNHNRTHAAQQLGITRQWLLKRLRYYEQLDQTT"
FT   gene            complement(219479..221020)
FT                   /locus_tag="Mmc1_0199"
FT   CDS_pept        complement(219479..221020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0199"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: dsy:DSY2161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42726"
FT                   /db_xref="GOA:A0L433"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0L433"
FT                   /protein_id="ABK42726.1"
FT                   /translation="MDRSWHTTTDTPYSRPKQRLSIPAMTAALHSQRPAAEKAYRLDDT
FT                   LHHAKLVLTRDVVLDGITYLTAGSDLESRTIVRLLNLGIDQVYAQPRIAERIKQCASRL
FT                   DAMFDATRAVIFAEGVKSTRDALELLKRKGRLDLQPFKEQIGSLLEEIMDHYTEFAAES
FT                   IKELSEHDEPTVVHGVETALLCVELAKGLQWPKERLIQAGLAGMLHDVGKAAVSKEILS
FT                   HQGPLTDLQRQEVERHALIGYLMLSNNEQLHDLPAFCAGAHHESFQSGMPGYGILSDFS
FT                   ELQGDPRQRYTPQEQALAQLVCIADVYSALRQGYTLKGPVSPLETLIEMNRMAASGRFN
FT                   PEFYRVWYTTFKRQHRLLLQKGLMIAMPPQLEGALHRADGTPFVLPQHEARISFEEIGR
FT                   LQILPKLLAIGCKLPELKRHNGITCHLLERAGVALDTAQLQEMGITLHKPVHYNLVLVD
FT                   TDHVEQIQCLVIKQGDSLKDLHLAVGHKRLDNIQQQLLELRNLPIDFKPLIGCPV"
FT   gene            complement(221242..221682)
FT                   /locus_tag="Mmc1_0200"
FT   CDS_pept        complement(221242..221682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42727"
FT                   /db_xref="UniProtKB/TrEMBL:A0L434"
FT                   /protein_id="ABK42727.1"
FT                   /translation="MFTFDICNIDGIGLPLAVVKGVGRLQRTTKPRSQPMFRQLWHQAR
FT                   QTIAQGCCVWHALVMALAVMVLGQGTPAVSAPPQPLATQRALYATTLVSRLYDPMLSQR
FT                   GVVGEGRWHHRNPSLYGEAQRRDVPRHTPPLYTGVEPANRHR"
FT   gene            222331..222588
FT                   /locus_tag="Mmc1_0201"
FT   CDS_pept        222331..222588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0201"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   rru:Rru_A3570 protein of unknown function DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42728"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:A0L435"
FT                   /protein_id="ABK42728.1"
FT                   /translation="MGCLMRWEHQPEKRSLMWRLAISNLRNQMESTLQENESDLMDRLD
FT                   LNAVYRQLKPAIAREARTQVPDSCPYSVDDLVDPYFWPNE"
FT   gene            222753..223202
FT                   /locus_tag="Mmc1_0202"
FT   CDS_pept        222753..223202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42729"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0L436"
FT                   /protein_id="ABK42729.1"
FT                   /translation="MTLIPNFPHDGVITINRVLLKPQYSADDLQERVAELCENVKTYHS
FT                   TTGFVGGMVTMNSGKISNEGSDVGQAVVSPLQGREALIITFWRSYAEHESSHRSETFQP
FT                   LFAKVLELCENGNEEIAYDMLWAGQAYDAETAQAAQAQKARYAMA"
FT   gene            223407..224483
FT                   /locus_tag="Mmc1_0203"
FT   CDS_pept        223407..224483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0203"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: nmu:Nmul_A0104 Sel1-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42730"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0L437"
FT                   /protein_id="ABK42730.1"
FT                   /translation="MYRWMLILMLCIPRGLYGAALPWQEVQSAAVGGHVEAQRMLGQFY
FT                   LEGEGGVEKDPKRAGYWLEKAARGGDGLAQSLYGYLLSQGLGRAVDEEGAVYWYRLAAA
FT                   QGEPKAMIALALKYRAGLGVKRDARQAVQLFRQAAELGDGRAQYYLGDHLARGEGIPRD
FT                   GAQAAQWYERAARSGSLLAALALGQMLEQGKGVQADGAMARHWYEQAAQGGHAEAQFRL
FT                   ALMWEEGRGGVRDVAVAVDWYRKAAAQGDTRGAVNLGYLLAHGVGAPRDEQQAVALYTQ
FT                   AAQGGSATAMYNLGVRYSMGSGVKQDLIAAYQWFHLAWQQHYKGADAAREQVAMQLKGA
FT                   QIAQARAQAAQWLSDKGR"
FT   gene            224619..225653
FT                   /locus_tag="Mmc1_0204"
FT   CDS_pept        224619..225653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0204"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: noc:Noc_2705 Sel1-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42731"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0L438"
FT                   /protein_id="ABK42731.1"
FT                   /translation="MLLRILTIPLMITLLLFGAALAEAQTPSAEALPVELQGLKTRAQD
FT                   GDHEAQYRWGLILAEGKGVPQDLNGAYSWFYTSATAGHAAAQFHLANMYLTGKGTEQDD
FT                   QAAFDWFQKSARQGHPLSQYNLGLMYFKQRGPDQDKDAPLKWFTRAANQNFPLAQFNLG
FT                   VMYFQQNRAPINYVESFMWLDLAARNGMDEAEKLRTILGRRLSDDELVQAEASIQRWIE
FT                   SYGDVRGAGRSVIAAQRQASGKVILASLSRGMEYLKKRFFTTPANQNAYDQFQEVLKVD
FT                   SRNGSAQEGIARIADGYMDLVDRDIGLKHWKKARNYLNRAEEILKKGYGDSKRLERLQT
FT                   SLSQ"
FT   sig_peptide     224619..224708
FT                   /locus_tag="Mmc1_0204"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.507 at
FT                   residue 30"
FT   gene            225892..226920
FT                   /locus_tag="Mmc1_0205"
FT   CDS_pept        225892..226920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0205"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: bja:blr4446 ABC transporter amino acid-binding
FT                   protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42732"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0L439"
FT                   /protein_id="ABK42732.1"
FT                   /translation="MIRLVWIVGVLLLVVVGAPAQAAPASDTLDKVRARGLLNCGVMTG
FT                   TPAFSQQQPDGAWHGFFADWCRALAVAVLDDARAVHFIQVTPATRFKALTELQVDVVMS
FT                   NTTWTLSREYQYQVRFPAIYLYDGQAIATRKDTRWHTLAQANQATVCVEPNSTSHANLQ
FT                   EYAQRNNLNFNYLALNQQGIITAFLEHRCDLITDDRIALTANLKTTASNDQDYVVFAET
FT                   LSREPLAPMVRADDERWQRIVRMVVQALLVADEKGVSRDALKQNRERLSDPEVQRLLGS
FT                   EDDPGQFVGLSRGWARRMIEAVGNYGELFARHLGAQSSLQMPRLLNRPWSRGGLFYAPP
FT                   FR"
FT   sig_peptide     225892..225960
FT                   /locus_tag="Mmc1_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.665 at
FT                   residue 23"
FT   gene            226901..229216
FT                   /locus_tag="Mmc1_0206"
FT   CDS_pept        226901..229216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0206"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; KEGG: pae:PA1611 probable
FT                   sensor/response regulator hybrid"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42733"
FT                   /db_xref="GOA:A0L440"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L440"
FT                   /protein_id="ABK42733.1"
FT                   /translation="MLPPSVKKHLLGYTIARRLRRSIALLVLLVLVMSLLALLALYKFQ
FT                   WGFQQTWQHDQVQLLIAADLNRQSERVGHIADTLLLAADRQSLEVQNELLENQLTLFQQ
FT                   LTLTLRTAGRQAGLVHRVEQVYQSLGDSVRQLYRLQGRILALQNAKSHKIQQIMQHYTQ
FT                   LQSTLLDQPSLGHYPQSQDRVLIGHLLWAGEARHEVLFEKRKAQVDHALANLREKLEHY
FT                   PQQREQWQPMLETLNSMVQNYLAQIPQWLLADRQRQGVMVENRRYITQFAETTQALYDA
FT                   YRQQVNNQARQQQSMMRWSIIIVVTLTLISLIILYLLVRYLLRDVLGRFAALHDTMSSH
FT                   AQGKSVPIVATGEDEISRMARAFALFVYKRAEAEQALSQAVEQAQRADRAKGIFLATMS
FT                   HEIRTPLHGIIGTSRQLNRMPLDRQVAHKAQVIEQASQALLGILNDVLDFSKIDTEQLV
FT                   LEEVVFDLPRMLQELYAVVHSQAEEKGLQLHLQLQEPLPRACRGDQTRLRQILNNLLSN
FT                   AIKFTQQGEVTLQVALTGETDPAPWVAFAVADTGIGIDEAHLERLFEPFKQMDESINRR
FT                   FGGTGLGLAISAKLAEAMGGSIRAKRRTEGGSLFTLMIPLRQVPIEQLPKPAQSHMEAA
FT                   DAMPGLKILLAEDDPINQEVAIGILQEDGHQVHCANNGQQAYEMAQQQAYDLILMDLRM
FT                   PIMDGLQATTKIRAAHTGLNHATPIFALTADVLKDSLQACRTAGMDEVLTKPIHLQHLR
FT                   YMLERVQPQHLSPPQERP"
FT   sig_peptide     226901..227023
FT                   /locus_tag="Mmc1_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.614 at
FT                   residue 41"
FT   gene            complement(229340..229681)
FT                   /locus_tag="Mmc1_0207"
FT   CDS_pept        complement(229340..229681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0207"
FT                   /product="Uncharacterized conserved protein UCP025560"
FT                   /note="PFAM: Uncharacterized conserved protein UCP025560;
FT                   KEGG: son:SO2062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42734"
FT                   /db_xref="InterPro:IPR008309"
FT                   /db_xref="UniProtKB/TrEMBL:A0L441"
FT                   /protein_id="ABK42734.1"
FT                   /translation="MKLTVFLRRFVPFMLAMLLTTALQASPLDEAKQAGYLGEQGDGYV
FT                   GLVTPSAPSSAKQLMQEINLKRRDKYREIASKNNISLRSVEGVAGQKLIERADPGTYVL
FT                   SPSGGWLRR"
FT   sig_peptide     complement(229604..229681)
FT                   /locus_tag="Mmc1_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(229710..229898)
FT                   /locus_tag="Mmc1_0208"
FT   CDS_pept        complement(229710..229898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42735"
FT                   /db_xref="InterPro:IPR025985"
FT                   /db_xref="UniProtKB/TrEMBL:A0L442"
FT                   /protein_id="ABK42735.1"
FT                   /translation="MRSPLLLTLLPVALLLGCSPRVSVEAPDKPITINLNVKIEHEVRI
FT                   KVEKDVDKLLDQSNDLF"
FT   sig_peptide     complement(229818..229898)
FT                   /locus_tag="Mmc1_0208"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.799 at
FT                   residue 27"
FT   gene            complement(230064..233459)
FT                   /locus_tag="Mmc1_0209"
FT   CDS_pept        complement(230064..233459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A1629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42736"
FT                   /db_xref="GOA:A0L443"
FT                   /db_xref="InterPro:IPR021730"
FT                   /db_xref="UniProtKB/TrEMBL:A0L443"
FT                   /protein_id="ABK42736.1"
FT                   /translation="MTQRFLSCAMVRFIPRRFNGAYSGNIGVMVSVQTVGRKSLRVLLF
FT                   TLTGLALLVSILLLVRLPLLNALLPHLLQQQGLPPLPVQITQLDLNRLVVGPTRSQDGT
FT                   LAWQRIELLYTPSLLLHGTLTALRLEGLQITLQQDAQGAIQWPMAQNQAPAQPSRAEPF
FT                   QLPTLPIDHVEIVHSQLQLNTPTGLLSAQLQGQLEHRLDHLHTLLQLSLPGLDMTLKGA
FT                   LSLFPPYGVELQSDLKLDHFQPPLLPIPYAGSQLTGLAGLRLDGPLQALLEGSQWPRLQ
FT                   AQHQLRIAHAHHPGHLLLKGQSRLQGGPQGNLTLSGTLAGAALQAWTTNLPLPPQSQIK
FT                   GYSAYHLTASVEDWLKQGVVRQGWSRFGLQLNHPHQGEIALTGELTQPAGSDAFKLHGQ
FT                   WAFNRLRGWQTLFQQPAATQLDGTMRYAVGGKFPLHAAWRPTLTLYPEFQLTALQPGAA
FT                   TGNLTATLTAQPEPQGMGLTLHPDTQVTLQHPLPPSLQTWAKSLGSDGRWVRIQAQLPQ
FT                   PLQLHWNGHQGLHLEGALQSNLALSAGGQLHATLSGSAQTQLDQPTQQLRFNLEQLEVQ
FT                   LKQLEWHALQINKLQLHGHGAGRLADYQGELQLESHLDGTLPGGSRLKQGRVAFKLPFS
FT                   GGEDHLHAALSHCMSLEYATFTPSAGLVLEGQQSPLCIHAPKLHFNWQQPTQPRLDLEL
FT                   IFPEHRTDLLIQQEKTPQLVQIRTPHMTLALTGSPTQWHASSTLLGGRFKHKGQDLLVR
FT                   DLDLQLQASADKGKITAHGTIAKVILRPMAATGQIAPFQYQGKLLVQNDHLTLDGRLAD
FT                   LKGILNWDLRVNHSLPTGVGNAALVMTPLLLRAQGIQPKDLLRMLKGKLEGVEGEVSLQ
FT                   SHLNWGAAERSDLTLRLHGVGMQTRPARLEGLDLTLELASLRPPKSRQPHRLHIDLLDV
FT                   GLPVRNIEAELLLRPDGVLVISWLKIPFANGWIKANHATFNLKDAHHELLLEVENVDLA
FT                   EMAKLVKLPGFTATGQLYGRMPVKMVGGRLLLDHATLFTHGGGIIANQTLSAEALKAGG
FT                   EQPSIVAKAMENLHYKQLTVTMDGDLAGALQVKVAAEGKNPDLYQGHALILNLSVEGAL
FT                   GDLFNREMEGFDIPAMLKREGILQ"
FT   gene            233691..234956
FT                   /locus_tag="Mmc1_0210"
FT   CDS_pept        233691..234956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbu:CBU_0937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42737"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A0L444"
FT                   /protein_id="ABK42737.1"
FT                   /translation="MTKKITVWVSGALFGTIPLPCMAAELPTVAEMWNIVLQQQQQMEQ
FT                   MHRQYQEVMVEQQLQLELLKQQIAQATLLMDQGQGGNTATSSGTSATGWTNRLTIGGQV
FT                   RVQASSTEHNGTSMSTLEHGSNIKVRLVELDVDAKINKWVKASTQLKYEHDGATAFNVD
FT                   QATITVGDSERYPMTLTVGKMTLPFGSYASSAIADPLTKELGEIVDAAALVAVKMRGFT
FT                   ADFYLFNGPSQKQGDENSIDQWGGDLSYRYERGVFTAEVALHYVNSVENAGGISTAIAK
FT                   VDSMTDMENYSAAWGLHGALTWQDTTLLGEYVQLMDAISSSTGSTGWNNSQLKPSAWHG
FT                   EISYTLPIGGKASNIALSYSGSDGAQAVGLMAQRVALHASVEVIENTAVQMEWSRDHDY
FT                   DSSEGGSGNSADTTTLRLRVKF"
FT   gene            complement(235057..235353)
FT                   /locus_tag="Mmc1_0211"
FT   CDS_pept        complement(235057..235353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42738"
FT                   /db_xref="UniProtKB/TrEMBL:A0L445"
FT                   /protein_id="ABK42738.1"
FT                   /translation="MDGYAVVHEGHGVLGAGQDQAAAIAMARRHTDLTLDEAQLRHHFD
FT                   AIYGELYLLPATEALVQAVTTSQPLHTFKIRQFGLGWIVDLTGEGEDEGEEEA"
FT   gene            235613..236113
FT                   /locus_tag="Mmc1_0212"
FT   CDS_pept        235613..236113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0212"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   tcx:Tcr_1731 protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42739"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A0L446"
FT                   /protein_id="ABK42739.1"
FT                   /translation="MKKQIVIALAAAAILAQTPVYAGEEAAVVPLKKMTLKTASTIAHK
FT                   VIEACRLKGVQIGVTVMDRDGIPQAILRDTVAPPITLTISKGKAYAAAMFRVPSSQLSQ
FT                   RAQSPIGRVPGVVMSAGAIPLEVGGIFLGSVGVSGAPSGETDEACAKEGAQGVLDELEM
FT                   SMM"
FT   sig_peptide     235613..235681
FT                   /locus_tag="Mmc1_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(236260..236514)
FT                   /locus_tag="Mmc1_0213"
FT   CDS_pept        complement(236260..236514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42740"
FT                   /db_xref="UniProtKB/TrEMBL:A0L447"
FT                   /protein_id="ABK42740.1"
FT                   /translation="MVYLLPIPVELYVRSLYGDGHNIGPENGNALSSRMTHGSICNAVT
FT                   TFITLIDGNQFADLMVRYSVGCLDEEILYIKKIDASFFS"
FT   gene            complement(236782..236994)
FT                   /locus_tag="Mmc1_0214"
FT   CDS_pept        complement(236782..236994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0214"
FT                   /product="Mrr restriction system protein"
FT                   /note="KEGG: mac:MA4541 Mrr restriction system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42741"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="UniProtKB/TrEMBL:A0L448"
FT                   /protein_id="ABK42741.1"
FT                   /translation="MRHVLELAAEGEVRIGDAVERIANRFGLTDEEKRTLLPSGKQAVI
FT                   SKRVQWASLISYKRGWFQRHAGRIL"
FT   gene            complement(237085..237648)
FT                   /locus_tag="Mmc1_0215"
FT   CDS_pept        complement(237085..237648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0215"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: regulatory protein, MarR; transcriptional
FT                   regulator TrmB; transcriptional regulator PadR family
FT                   protein; KEGG: pha:PSHAa2967 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42742"
FT                   /db_xref="GOA:A0L449"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0L449"
FT                   /protein_id="ABK42742.1"
FT                   /translation="MSVAPQQVTNRVLMTLRKIIRAIDMHSRYLVAQHDLTGPQAIILS
FT                   EILQRGGITGAELAKQVHLSKGTISGILARLESKGLITRLRDEGDRRRFWLQATPKAEQ
FT                   LLAQAPPLLQQSFVQKFNALAEHEQLGILTTLLHISDMMGADSLEAAQLLSTTPLLVEV
FT                   SRSEAIEGIRMDKEEPPTIEEEWE"
FT   gene            237795..239591
FT                   /locus_tag="Mmc1_0216"
FT   CDS_pept        237795..239591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0216"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="KEGG: sme:SMb20481 putative asparagine synthetase
FT                   (glutamine amidotransferase) protein; TIGRFAM: asparagine
FT                   synthase (glutamine-hydrolyzing); PFAM: glutamine
FT                   amidotransferase, class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42743"
FT                   /db_xref="GOA:A0L450"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017535"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0L450"
FT                   /protein_id="ABK42743.1"
FT                   /translation="MCGICGVMYFQPQTPQPAMLEKMVEKLHQRGPDGGGIEIDGQLGL
FT                   GHRRLKVIDLSENGHQPMQDDALGLTIVFNGCIYNYQALRQSLLELGYSFFSTSDTEVI
FT                   LKAYHAWGWQCVQRFNGMFAFAIYERQSGRVVLARDRLGIKPLYIHQDKSHLRFASSIP
FT                   SLLAGGGITTTLDPIALHHFLSFHSVVPAPRTLLQQVQKLPPATVRIVEKNGSETNHTY
FT                   WNLQMGPQAGDAERTEAEWQQLLDQALRAAVSRRLVADVPVGLLLSGGLDSSLMAGLLV
FT                   ESGQLSRGGLSTFSIGFEQAGGEEGDEFQYSDIVAAHFGTDHHKIFIETNNLPELLRET
FT                   VRAMSEPMVSHDAVGFYLLSREVAKHVKVVQSGQGADEVFAGYHWYPKVDAGQDAFQDY
FT                   RKAFFDRSHEECCEMVHRDIAAAWQQDYSSAFVESWFAHPHSGTAAVDKALHLDQNIML
FT                   VDDPVKRVDNMTMAWGLEARVPFLDHELVELAARIPGHLKLQQGGKGILKEVARPIIPH
FT                   AVIDRAKGYFPVPALKHMDGPVLKLAKEVLTSPRATQRGLIQPSYINRLLDHPTQHITP
FT                   LHGSKLWQLTLLELWLQTHDIH"
FT   gene            239600..241366
FT                   /locus_tag="Mmc1_0217"
FT   CDS_pept        239600..241366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0217"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sme:SMb20482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42744"
FT                   /db_xref="GOA:A0L451"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017534"
FT                   /db_xref="UniProtKB/TrEMBL:A0L451"
FT                   /protein_id="ABK42744.1"
FT                   /translation="MAADQSDTRLFVQATLASLKNWGEPHDSTAAMLDEAVIDCGWGKL
FT                   VFGQTFSDNQALCQAMRAEQPGQRNVALYLRDPHVVLSLYPQELFLDPSHTYRLALTQD
FT                   PWQDFTPPAALSILPIRGEQDMAVVRQLYETRRMVPPRAGFRLDGQEGCAPLFLIAIDE
FT                   QSEQIVGVVNGVDHRCAFNDPENGSSLWALAVDRKTAIGGVGEALVRALAHHFWQQGRG
FT                   YMDLSVMHDNEQAIALYNKLGFKQIPVYCLKNKNPINERLFSGPAPEANLSIYSRIIVD
FT                   EARRRGISVEVLDQSLELFRLKLGGRTVLCRESLSSLTSATAMTVCDNKRLTSRLLKSA
FT                   GLQVPEQMVVGKGERVENFLARHGAVVVKPVRGEQGRGISVDVRDLTSLEQAIAKAQQE
FT                   GDGEQVLLERLVVGDDLRIIVIGHEVVAAAVRKPPMIRGDGHSNIAALIQRQSRRRAAA
FT                   TEGESRIPLDGETQRCVQEAGLEMHSILDKGQQLLVRRAANLHTGGTIHDVTEQLHPAL
FT                   REAAEQASMVLDMPLVGLDFLVPDVQGPDYVIIEANERPGLANHEPQPTAKRFIDMLFP
FT                   QTTLPRCVSTEA"
FT   gene            241753..242256
FT                   /locus_tag="Mmc1_0218"
FT   CDS_pept        241753..242256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42745"
FT                   /db_xref="UniProtKB/TrEMBL:A0L452"
FT                   /protein_id="ABK42745.1"
FT                   /translation="MPWFKILLLLSMVGLVMPAQAATRHKIYYEQGPYTVRQYKVDGKR
FT                   VCKLEITFSKKGNAMAYLGLFNSPHFFGELFTERRTVGEAKSNLRIGFDGKRKMRINFA
FT                   KESAGREEVWRWRYFEVPADLLNQAAKGRSMQLAFYNGSHMFEFELSLKGSSKAIRMLK
FT                   RCDR"
FT   sig_peptide     241753..241818
FT                   /locus_tag="Mmc1_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            242270..242689
FT                   /locus_tag="Mmc1_0219"
FT   CDS_pept        242270..242689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42746"
FT                   /db_xref="UniProtKB/TrEMBL:A0L453"
FT                   /protein_id="ABK42746.1"
FT                   /translation="MRSRSLPKRSIACPVGLWQKCRRGSMAATLVLASLIPIALLSGCV
FT                   NGLIGAQRPVAHGPDAQPTVVVVPQRPTHCQTLDMVEGAGAASGQGRQGALEDVKRLAR
FT                   LRGGNHIWIVQEQQSTYTLNHYVTAEIFKCPIPKK"
FT   sig_peptide     242270..242455
FT                   /locus_tag="Mmc1_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.300 at
FT                   residue 62"
FT   gene            242740..243831
FT                   /locus_tag="Mmc1_0220"
FT   CDS_pept        242740..243831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0220"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M20; peptidase M42 family protein;
FT                   KEGG: eba:ebA5273 conserved hypothetical protein, predicted
FT                   peptidase M42 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42747"
FT                   /db_xref="GOA:A0L454"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017537"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A0L454"
FT                   /protein_id="ABK42747.1"
FT                   /translation="MSDQHASNAPIINTDYLLETLLTLLTIPSPSGMTDKVVRWVCHEL
FT                   TQLGVEYELTHRGAIRATLPGKDEKRVRGVVAHLDTLGAMVRELKGNGRLSVSPIGHWN
FT                   GRFAEGARVTLMAESGRHMRGTLLPLKASGHVYNEAIDSQPAGWDYVELRLDERAQCVA
FT                   DLMKLGVHVGDYVAVDSAPEVSASGFVNARHLDDKAGVAAMLAAVRTIMAQDITLPAPV
FT                   YVMFTISEEVGVGASHILHGDISELVSVDNGTLAPGQNTCEFGVTIAMKDSSGPFDYHL
FT                   THHLLDLCKEHAIMHSRDVFRYYRSDAAAALEAGNDIRTALVCFGLDASHGYERIHMDS
FT                   LHALAALLFYYMNHQLPVPDRGM"
FT   gene            244268..245017
FT                   /locus_tag="Mmc1_0221"
FT   CDS_pept        244268..245017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42748"
FT                   /db_xref="GOA:A0L455"
FT                   /db_xref="UniProtKB/TrEMBL:A0L455"
FT                   /protein_id="ABK42748.1"
FT                   /translation="MESRENSPQEHGLSQDDIDALRMLAERYVQIKVFIAYAEEIQVDH
FT                   KADILVYKELRDGMDHLMRVLYHRLSAQSADIEDLDGYRDINIGKSIGHLYRAAFDALD
FT                   ATILSLREHISANLSGYTMETVSDVIPNYYMLKIKLNQLTKQAADRRGKKDIGRITDDT
FT                   FDQYVQDVDELKKLHESVLYAGQELCEHKKSLKIKKWKDIIWSLFLVIFGVIFGIAVKA
FT                   GYDYLQPTHVESTKQAVQESNFSSKIE"
FT   gene            245558..246703
FT                   /locus_tag="Mmc1_0222"
FT   CDS_pept        245558..246703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0222"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pfo:Pfl_2616 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42749"
FT                   /db_xref="GOA:A0L456"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR021770"
FT                   /db_xref="UniProtKB/TrEMBL:A0L456"
FT                   /protein_id="ABK42749.1"
FT                   /translation="MNSCVMSRVRPATLEDLSALVALERACFSRDRISRRSFRHFIQRA
FT                   HAVFLVAVEENHTLSGYGVLLLRRGAQLARIYSLAVAPEMRGGGRAKLLLKALEEAALE
FT                   HRTAWVRLELHQDNEAAIALYQNRGYRPFERFIDKDEGFAEAVRMEKSLLRNLEPGDTP
FT                   WPYYAQSLPFTCGPASLMMAMGGFFPELALDRSLELQLWRESTTIFMTSGHGGCGPHGL
FT                   AVAALHRGYEVRIHTSVGKDLFVDSVRHPDKKSVIRLVESNFIDVLHQHDVNVQEEPMT
FT                   LEEISAALEAGWAVLVLISAYRLSGSKAPHWVIVAAINHGFVYVHEPDLDDEKGQTSTE
FT                   CIGIPIPCEAFVGMMSYGKARQQAAVLLRPPRMESITVDEN"
FT   gene            246803..247960
FT                   /locus_tag="Mmc1_0223"
FT   CDS_pept        246803..247960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A1920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42750"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:A0L457"
FT                   /protein_id="ABK42750.1"
FT                   /translation="MDHTVPLSLYRPLPVVESLTERLFPATSYQQLREHFLAAAKGCPH
FT                   RHMAYVHPLRGSRGEELAMDVVRLGHAQCHATLVITSACHGVEGPAGSALQSDLLRHAL
FT                   LENLPAGVEILLIHGLNPYGFSWGRRVDEKGVDLNRNFVDFASPLPFNQDYNALAEAIL
FT                   PRELNPASLQHAQAQRTAYRQQHGEIRYDHGVAAGQYSDPHGLFYGGVEPSWSRQTLEK
FT                   IWQHFGLTQRVKIAVVDIHTGIGPHGYGELICDLPPGGVGSQRAQRWYGASVTHPVLGG
FT                   SASGVRYGLTDYGWLAAFGERLSFVTLEFGTGPFDTLLQVLQGDHWCHRQKLATNHPTM
FT                   QHWRKQLEDFFNPPSASWQEMVIWRGRQVIRQTLEALADPSRPTT"
FT   gene            247999..248808
FT                   /locus_tag="Mmc1_0224"
FT   CDS_pept        247999..248808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr7352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42751"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:A0L458"
FT                   /protein_id="ABK42751.1"
FT                   /translation="MSKEVHYDLSNEESLIAQASYLGQRIQPLATGTKYPWQPPMTVNP
FT                   EGGLVVLYRFGVAVAFHTSPPRFEGLVEQLGDRLEPSEENQLHEETLVLQRTTTAEQAG
FT                   LLSHGKMLLSSFDTDRLKLIADVLAKSVLLAVYEEQVSQTLEKMEPLGLAMRKGHTFPR
FT                   REHGLVQHIGEALHVQNRMVGLAQIGEKPEMLWDRPDMEALFNRMEREYEIHERQAILE
FT                   RKLGLIQNTAQTLLELHQTRHALFLEWAIVVLIVIEVVFTVQEHFFK"
FT   gene            complement(248953..249198)
FT                   /locus_tag="Mmc1_0225"
FT   CDS_pept        complement(248953..249198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42752"
FT                   /db_xref="UniProtKB/TrEMBL:A0L459"
FT                   /protein_id="ABK42752.1"
FT                   /translation="MDMSKIVTRLKNLFDSSKSKKKQQCDDMQEVLKKLKKKEKKLQQQ
FT                   IADENSDKKKKRLEKDLRVLQSHWKKADKICRSIKN"
FT   gene            complement(249241..251067)
FT                   /locus_tag="Mmc1_0226"
FT   CDS_pept        complement(249241..251067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0226"
FT                   /product="Na+/Pi-cotransporter"
FT                   /note="PFAM: Na+/Pi-cotransporter; KEGG: tdn:Tmden_1943
FT                   Na+/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42753"
FT                   /db_xref="GOA:A0L460"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:A0L460"
FT                   /protein_id="ABK42753.1"
FT                   /translation="MLRKIFLPIIYLLLAYGFWLSPDFKEIAAGVAIFLFGMISMEEGF
FT                   RVFSGGILEKILRHTTNRTWKSLGFGIVSTTIMQSSSLVSVITISFVSAGLLGLQEGIG
FT                   IIFGANLGTTTGAWLVAGLGLKVKISAYAMPMLVFGIIGIFQSTKAGRGLGYILVGLGL
FT                   LFLGIHYMKEGFETFKSAFDLARFAVGGWQGLLLFTGIGILATVVMQSSHATLVLIITA
FT                   LAAGQITYENALALAIGANIGTTITAIIGSLTANAAGKRLAMAHLIFNILTGLLAILLM
FT                   SQLIFMVDKTSALVGIAADNYTLKLAVFHTLFNLLGLMVMLPWLRFLVTFLESRLKDQK
FT                   HALATPHYLHQANRTIPVAFLESIRMEIIHLYDNAVSISIQALNFTPQDFKDPMDACDL
FT                   AKIRRQVVATDMDQYYEQRIKGLYGTIIEFSSTPDFIMSAQMSSRLFDQRIACRRVVEA
FT                   VKDVKHMRKNLVRYADGDNLAIRDEYDKIRGQMLDLFRSLHEIRQEAATQNDALTVLSL
FT                   DTLRVRIEESDVLANDVLDSLIREKRITDTMATSLMNDSAYAYDIAKRLIQVAETVFLP
FT                   FNEERLREAEQAISLSDDELEAVMDHGGKPTQ"
FT   gene            251457..252734
FT                   /locus_tag="Mmc1_0227"
FT   CDS_pept        251457..252734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0227"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: dps:DP2625 similar
FT                   to serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42754"
FT                   /db_xref="GOA:A0L461"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0L461"
FT                   /protein_id="ABK42754.1"
FT                   /translation="MDDTRLPLRPFTTHKLIKGITYPEAVSFRDLVVTGPPGSGKSTLI
FT                   AYLDGWSEEGVVDLTQKGWWKQPVLHMRPREVHFLIPFVGFERAVPVYELKSLDHPDFL
FT                   EIDLFRLVLPPRKQGPLATDFRNRFLFEFLLPDAEVMYQRRQQRAKARSHTVEEDLSLA
FT                   QVRLELSIYQQLAQFMHQEGMRVLVRTEVDAPPMVIDSPQCATQPINKLSAQELLQTLD
FT                   KVQLRQRVFNRSWNERSNRDLMALFVEMVPTILQVEECAIFIRQQDSEALWLVSSNAEE
FT                   KTTARCKSQKSLGCDLVSQVIHTGLHQVFELGEGQQKPAQDGELEMRNALCVPIPHLSR
FT                   AGASGAILVRNTTDGRAFRAEDRNFLERLAQHLQTASETLFLRRQLSNFSELLGQKVET
FT                   TQWLRMIIALLSMLVLAETALLMILH"
FT   gene            253221..253904
FT                   /locus_tag="Mmc1_0228"
FT   CDS_pept        253221..253904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0228"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   cbu:CBU_0015 conserved hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42755"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0L462"
FT                   /protein_id="ABK42755.1"
FT                   /translation="MGTTNPLASLLGRSPFKPMQEHMRKVVLCAQLVPALFDALEQDDR
FT                   ETLNQVKASIFELEHQADALKNDLRAHLPNSLFMPVARRDLLELLEVQDAIADSAQEIA
FT                   GMLTLRVDLVPPAGMCGAFKALAQHCVRTCEKAGEAIEQLDELLETGFGGRESERVQRL
FT                   LGEVGTLESETDKLGIALCQSLFEREKDLNPVITIMLYQMIREIGELADNAEKVGDRLR
FT                   LLIAR"
FT   gene            253939..255207
FT                   /locus_tag="Mmc1_0229"
FT   CDS_pept        253939..255207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0229"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: dps:DP2628
FT                   probable phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42756"
FT                   /db_xref="GOA:A0L463"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0L463"
FT                   /protein_id="ABK42756.1"
FT                   /translation="MEIIQEHGTIFMFLAIIFGLYMCWGIGANDVANAMGTSVGSGAIT
FT                   VKQAILIAAVFEFAGAFIAGGQVTKTIRKGIIDPAPIANNPELLVYGMLAALLAAAIWL
FT                   MIASSKGWPVSTTHTIVGAIVGFAVVGIGPDAVKWQKISTVAASWIVSPIVGGGIAYML
FT                   MISIRKLILNTDNPFQSARKWGPLYVFMVGFITALVTLWKGLKHLKLDFSMAESFFISA
FT                   LIGLIVAYMGKRMIDKVKLDVEADREYHFASVEKVFMPMMVFTACAMAFAHGSNDVANG
FT                   IGPLAAVVSIVQSGGEVAQKASLPVWILVLGGVGIVIGLATMGHKVMQTIGTKITELTP
FT                   TRGYCATLASAVTVVLASKTGMPVSTTQIAVGAVMGVGFARGIGALDMRVIGGIFLSWL
FT                   VTLPAGGLLAAAIFFIIKGIFGS"
FT   gene            complement(255293..256429)
FT                   /locus_tag="Mmc1_0230"
FT   CDS_pept        complement(255293..256429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP2625 similar to serine/threonine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42757"
FT                   /db_xref="GOA:A0L464"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0L464"
FT                   /protein_id="ABK42757.1"
FT                   /translation="MRLQQGQSLLLGRDQPYQQALFEWDATVATRHAELHLTATELHIR
FT                   ELHTDYGLTIAPAQCEPHSTADTLLTNLLQPFSQPLTPLPATAALELLEQVNAQRSQEP
FT                   YHPLNRFGQPGALLELPPHVQPILVGDLHARVENLLTILQWDGLLSGIASGQQALIILG
FT                   DAVHSELDGEMENMESSMLMMDLILRLKSLFPNGVFYLRGNHDSFLASVSKGGVPQGKL
FT                   WQHALLEQRGEAYVAAMQHLYEHLPLVAVGQAFLCCHAAPPRAKVTRSMITDAYAYPGL
FT                   VKELLWNRIRTQYLLHGYSKRDIHRFRKSMGCTPQTPFIVSHNPMDRRQSHWTNACDIP
FT                   LYHIFFSGLTSDIGLFVGVGHEMIPLTLPCQSMVHAHP"
FT   gene            complement(256577..258040)
FT                   /locus_tag="Mmc1_0231"
FT   CDS_pept        complement(256577..258040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42758"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:A0L3K2"
FT                   /protein_id="ABK42758.1"
FT                   /translation="MNQHNREQATVPTPMIDEIKTQSFGVFGVDNAIVDFLQEIGFQAI
FT                   FNRRGWSKRTGKDLPTLIMLLILHPLLKVPSIHLFCRDHFLSVFAVGKDTFYRLLQRQF
FT                   PWRNAHWALIKKLLPQWRTLDLGPGYLVADTTVKEKRGDRIEGVCWHHDHNTGRSVAGF
FT                   EAAHLVWVNKQGTLPLDAALRFSKRPLISNLLHILSYRFDCRSHLGRRYREAAKMSKLD
FT                   QTVDMVARAIQAGIPAQYFLADAWYSSVKFVKKILDLGVVPLIRWKRNNTKFLFQGERL
FT                   TSAELYTRFAKGKIRKAKGSKRFKGTFLDAEHPEIGLIRLFFVRLIDPKTGSKEWAVFL
FT                   TTDRSMGLSNMIEHYANRWGIEVFYKESKQHLGFLNESVRSFEAVIACLHLAAMRHAVL
FT                   SSMVAIKGSQRDQLAHNLAALTYARKLWHTFRAIFNDALGRTSILENHQKNEVIELFEQ
FT                   EVEAWLSKALMLDPLGSQRQILAETNCET"
FT   gene            complement(258503..261853)
FT                   /locus_tag="Mmc1_0232"
FT   CDS_pept        complement(258503..261853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0232"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: dar:Daro_3549 PAS; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; MASE1 domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42759"
FT                   /db_xref="GOA:A0L466"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L466"
FT                   /protein_id="ABK42759.1"
FT                   /translation="MSKLNEILMVAVVYFITARLGQLLAISPGNVTPVWLPSGICLAWV
FT                   LLRGRHLWPGIFLGAFAGNIWAYFDTNTLSAILKSILAGSANGLGDVIAIVGAAWMINT
FT                   ISPATALFNNSKNTTIFLIYGGIIGPFISASIGIFGLLLTGNILPNDAFFSLITWWTGD
FT                   AMGVLFITPVILELYHLKNIQTIRPNRDVILHFVLFLSITTTVFFLSSNQDPSIWIVFL
FT                   APMLVWATLRFSQVILFSELFILSTISIVATATQHGPLLILDDLASTLIHLQVFLGSVA
FT                   LSVFYLNSVNRELRASKHNLELNVIERTKDLQVLNSNLLKEIRSRQHAEDSLKESQKAL
FT                   LEAQNIAQVGNWTWTIETNTLSWTDEIYRIFGLIPQETPPTYQAFLSAIHPEDRLFVQN
FT                   AVNQALEQLNTPYQVEHRIIRPNGDLRTVVELGRVERDQQGTPFRMIGTVQDITARKQT
FT                   EALLLSSEIRFRSLFDSMNEGGALHAMVFNEHGNPIDYRILEVNKAYTEILGITKEQAE
FT                   GRLATEIYGQTSPPYLELYNRVVKTGQSLRFETEYSPMVRNFEISVFSPGENQFATVFT
FT                   DITERKKTLQKLNGALDELEKKSNFLQSLVQNLPDLIWMKDPEGVFLTCNPAFERFVGS
FT                   QEQQIKGKTDYDFVDQKLADFFRMNDLLAIEKGGPVINQEWVTFAADGHKALLETTKTP
FT                   MFDKQGRIIGVLGVAHDITATKQAEQDLIHAKEKAEAAYQAKSEFLATMSHEIRTPMNV
FT                   IIGLSDILMETPIDHEQRDHLLRLQKANKTLLDLVDSILDLSRIEANQISLKQEPLNLA
FT                   LMVEETMSMMSIVADQKGLRLESQVTQATDDYWSLGDESRIRQILVNLIGNAVKFTEKG
FT                   SIWVTLELFTDTLERTLVRLCVKDTGIGIGPEHLETIFDKFTQVDSSYARRYSGTGLGL
FT                   AITRRIIQLMGGKVWVESNPSQGSLFCVELPFIPVQPIALKEDTTLQNDVNRSTNRPLR
FT                   ILLAEDSEDNQMLVQTYLRRTHHELVIVMDGQQAVDAACSKPFDLILMDIQMPIMDGYQ
FT                   ATGIIRDDQHRHNKPHTPILALTAHALDEDVAKSLAAGCDGHLTKPIRKAKFLQCIERY
FT                   QPITFLDES"
FT   gene            complement(262431..262507)
FT                   /locus_tag="Mmc1_R0002"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(262431..262507)
FT                   /locus_tag="Mmc1_R0002"
FT                   /product="tRNA-Arg"
FT   gene            complement(262544..264322)
FT                   /locus_tag="Mmc1_0233"
FT   CDS_pept        complement(262544..264322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0233"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="KEGG: mag:amb1535 response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; cyclic nucleotide-binding; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42760"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0L467"
FT                   /protein_id="ABK42760.1"
FT                   /translation="MAVVAHYAGEHYAEQILFRNIHWEELASVLCTCPVKSMQPGEVLL
FT                   DPKHPNETIYLVIEGRLSIHLKDLETPPIASIGQGSFVGELSIMDEKYPTAFVVVEHPS
FT                   QLLMLSRVHLKQLIDCSSTFVFNLLQVFSHRMRFSTEALIESHFVRTVPDIIYRLDAQG
FT                   HFIYLNESIEKLGYTMQELLSQHFSVLVSVEDLDSVSFDSVVVRHPQATPSSGTGVQPK
FT                   LFDERRSGDRKTTGLELKLCTRDTESTQRSIIHAEVSCTGIQVESLVSGVRDYHGTIGI
FT                   IRDVTERKQFMTQLSEQKAQMEAIFNTIADALLVTDVYGIIQSANHSASEIFGYSQGEL
FT                   LGCSIGMLLEAEQHEDAVVSRWTALAGHRKEVKVRRKGEQIFEAEMSVSQVFLEDRILY
FT                   TGIIRDITERKEAERRITYQANYDALTGIPNRSYFQQLLNQSIQRAAAEGKRLAIIFID
FT                   LDRFKWVNDNLGHGAGDELLRLSSKRAASCLKGRDTVARLGGDEFVAILEHVGDTEQAF
FT                   AVSKRVLESLNRPFMLDGKEVYISGSMGVAIYPQDATQPEELLTRADEAMYCSKRAGRN
FT                   ACHFVTGESFQMEKKY"
FT   gene            complement(264386..265483)
FT                   /locus_tag="Mmc1_0234"
FT   CDS_pept        complement(264386..265483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0234"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein; KEGG:
FT                   pca:Pcar_0322 mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42761"
FT                   /db_xref="GOA:A0L468"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A0L468"
FT                   /protein_id="ABK42761.1"
FT                   /translation="MTLPHLPADLAQRLLAYYDEYGRDLPWRQQQDLYRIWLSEIMLQQ
FT                   TGVKTVMPYYEKFLSHFPSITQLAAASQEQVLAQWQGLGYYRRARMLHQAAQQVVQQHG
FT                   GLFPEEITQVQALPGIGPSTAAAILAIGRNQAHTILDGNVMRVLARLLTLELPVDSTPG
FT                   KQRLWQVARQLTSQQRPGDYAQAIMDLGATLCTRSQPACSRCPWGGACAARQHGSWAEY
FT                   PKKREKKPKPHHYQCMWVLLDTQQRIFLRKRPLEGLLGGLWEPLGEPLLETPPLGNLVQ
FT                   RASHHLTALGIQGQPLLEAQPVDHIFTHFRLTVYPILVVAASGAPILNDANWWPLAQLD
FT                   QRPIATLHRKVNENAVGLVELSLNG"
FT   gene            complement(265489..265998)
FT                   /locus_tag="Mmc1_0235"
FT   CDS_pept        complement(265489..265998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0235"
FT                   /product="heptaprenyl diphosphate synthase component I"
FT                   /note="KEGG: dar:Daro_0068 heptaprenyl diphosphate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42762"
FT                   /db_xref="GOA:A0L469"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="UniProtKB/TrEMBL:A0L469"
FT                   /protein_id="ABK42762.1"
FT                   /translation="MKTSLTPLRRDLLIGYLAVAAVAAHMLEATLPGLGPWFKPGLANV
FT                   FTVVAFFYLDREAAIWVALIRVLGGSLAMGAFLTPSFFLSGAGMLGAIVVMLLPPLPGM
FT                   GAVGLSILMALAHMCAQVAAAHLLFVQHSGLFYLLPWFLLGAWCTGWFNGVLAHGLLHT
FT                   LRQHKV"
FT   gene            complement(265995..266402)
FT                   /locus_tag="Mmc1_0236"
FT   CDS_pept        complement(265995..266402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42763"
FT                   /db_xref="GOA:A0L470"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:A0L470"
FT                   /protein_id="ABK42763.1"
FT                   /translation="MAHPLLTSLSWIRRATTPTDGLIAFSTLGMILYFLVAASSQGTDR
FT                   LEIYKENQLLQSLSLNQTTEIQVAGRLGPVTIEIKPGAARLREFDSPRMIGTRSGWIRG
FT                   GGEMAICLPCGLFIRIPARQTPPHGLDAVAQ"
FT   gene            complement(266384..267391)
FT                   /locus_tag="Mmc1_0237"
FT   CDS_pept        complement(266384..267391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0237"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: pca:Pcar_0035
FT                   membrane-associated lipoprotein involved in thiamine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42764"
FT                   /db_xref="GOA:A0L471"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A0L471"
FT                   /protein_id="ABK42764.1"
FT                   /translation="MSRTWSTLLLLVSLLLSGCSEKVENTTQLRMGTWVSISTLGQHGA
FT                   AVEAAFAEMGRLEKALSSHDPNSPISRINQGSVNQWHPLDDETAQLLERGLIIQKASLN
FT                   RFHMGLYHLSQLWGFMSETPLSQPPALPLREMWRQQATPNLEHAFSLSKQPDTTTLRIN
FT                   NPAFGLDLGAIAKGYAIDRAIAVLRAHGVENAIVNAGGDLRVIGSKFGQPWRIGIQDPT
FT                   DKERVIARSDLQGDRAMVTSGDYERFFIYQGRRYHHILDPMSGEPADYGWRSVSVQAAD
FT                   AETADALSTALFTMDLAQGKRLLEQFPGCQALWVDQQGEHQQSEGFIGQWLTPS"
FT   gene            complement(267388..268134)
FT                   /locus_tag="Mmc1_0238"
FT   CDS_pept        complement(267388..268134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0238"
FT                   /product="16S rRNA m(3)U-1498 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   son:SO0832 conserved hypothetical protein TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42765"
FT                   /db_xref="GOA:A0L472"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0L472"
FT                   /protein_id="ABK42765.1"
FT                   /translation="MSTTPRLYTPQPLCAGQPVTLDREAQRYLLKVLRLGEGDALYLFN
FT                   GEGGAWSAHITQTSGPLQVTPQQFEPEPMAPLNLTLVQGLSRSGPMELVIQKGVELGLQ
FT                   QLIPLQSARSVARAKGEHKLERWQRIAIEAAEQCRRSRLLQFQPVCDWSQLAGSLPEQG
FT                   PRILFWEDHRHHTPSLRQWAATLEQAPTQITLLIGPEGGLSAEEVTHATTNLGFQTCSL
FT                   GPRVLRTETAALAAITALQALLGDMA"
FT   gene            268300..268854
FT                   /locus_tag="Mmc1_0239"
FT   CDS_pept        268300..268854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0239"
FT                   /product="chorismate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /note="PFAM: Chorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42766"
FT                   /db_xref="GOA:A0L473"
FT                   /db_xref="InterPro:IPR002800"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A0L473"
FT                   /protein_id="ABK42766.1"
FT                   /translation="MQTPRFQLLQGWQEATALSRAEVADADLCAALTHTGSLTRFLEGR
FT                   YGHPVDVTVRQQVTAPLAKAPLSALWDKTLALQAHTLLIRDAWVNHAGPMLVYAHSQID
FT                   WDHLDQAERVAIRNGQIPLGGLYLANGAQVNRAHLQISRVTVAGLERVGEAPLWCRRSL
FT                   FTVDGRPNARILELFVPVDHG"
FT   gene            268847..269722
FT                   /locus_tag="Mmc1_0240"
FT   CDS_pept        268847..269722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0240"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: vvy:VV0121
FT                   4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42767"
FT                   /db_xref="GOA:A0L474"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0L474"
FT                   /protein_id="ABK42767.1"
FT                   /translation="MAEHWIERLSWPLLRESLLLMRVHRPIGTYLLMWPALWGVVAAAH
FT                   PAPPNPVLLALFALGAWVMRSAGCVANDLADRNFDPHVARTKQRPLAAGRISVRAAVVL
FT                   LVLLLGVALLLALQLNLLTLKLAVAGALLAVTYPLTKRIVAIPQFYMGAAFGWAAVMAW
FT                   AATAGALAPGAWLLFATTLVWAAGYDTLYGMMDREDDLKIGVKSTAILFGQRDLFWVAI
FT                   LYVLTVLLLLVTGWQLQMQWPYYGTVAGAALHMVWQIQHARSRQAEVLMEAFLSNQWLG
FT                   MLIGVGLWLG"
FT   gene            270077..271006
FT                   /locus_tag="Mmc1_0241"
FT   CDS_pept        270077..271006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0241"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   dar:Daro_0110 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42768"
FT                   /db_xref="GOA:A0L475"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0L475"
FT                   /protein_id="ABK42768.1"
FT                   /translation="MSKAQILLVDDQPINLEILSEYLRDEGYRLCIARDGQEAWELLEK
FT                   NPLNFHALLLDRMMPRMDGMEVLARMKQHDELRMVPVIMQTAKASQEEIVEGLEGGAHY
FT                   YLTKPYRKEMLRAIVRTAVDDYNNYRAIRDRSREAQDKAVDSVLSMRLMDSGQFRFQTI
FT                   KQAQDLAALLSHSCPDPERVVLGLSELLINAVEHGNLGITYEDKSRLLKNRDDWWQEVH
FT                   RRQSLPENCQKWGRIRFTKSEDRLEILIQDEGNGFDWRGFLEFDQARAFDSHGRGIAMA
FT                   KMLSFDRLEYHDPGNTVVVRVNLPPKSE"
FT   gene            271172..273028
FT                   /locus_tag="Mmc1_0242"
FT   CDS_pept        271172..273028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0242"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="TIGRFAM: UbiD family decarboxylases; PFAM:
FT                   Carboxylyase-related protein; KEGG: vpa:VP2997
FT                   3-polyprenyl-4-hydroxybenzoate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42769"
FT                   /db_xref="GOA:A0L476"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A0L476"
FT                   /protein_id="ABK42769.1"
FT                   /translation="MGHDPKHFKDLSSFCDFLESQGELVRIREEVDPHLEMTEISTRLL
FT                   AEQGPAVLYERVSGYAMPVLNNLFGTERRVGLAIGADLHQLEELGELLAYLRQPDPPTG
FT                   GVGGLLGTARKLSSVRHMPTRSKKSAPWQQVVYQGAAVDLTRLPIQGCWPGDVAPLITW
FT                   PVVITRGADQGAVNLGIYRMQLLGKNRLIMRWLKHRGGAQHSRSYRKPMPVAVAIGCDP
FT                   GTILAAVTPVPDTLSEYAFAGLLMEQSVTVVTGQESGLPIPYSAEIVLEGTVDLNDLAD
FT                   EGPYGDHTGYYNEVERFPVFTVQRISMRRNAIYLSTHTGRPPDEPSVLALALNRVFVPL
FT                   LKKQFPEISAFHLPAEACSYRVAVIAINKQYAGHAFRMMAGVWGFLRQFLYTKYLIVVD
FT                   SSVDCHNWDAVMAAVGRHVDARRDLQQLTNTPIDYLDFASPVAGLGGKLGLDATRKSGA
FT                   ELQVVPHPAVWPEAEALQQWAEAAQQRHAGEIVQIHLRAACAMAVVSMHKTAAGQSGTL
FT                   AKQLLAAWHPGAPRQIWLMDEDVDVTLWDDLWWVVSTRSDAGRDLYRDEIHGGFVMDAT
FT                   HKWPGETQREWGRVLRMDQPTIDRVSEKWPRLGLPGTGKPIW"
FT   gene            273114..273668
FT                   /locus_tag="Mmc1_0243"
FT   CDS_pept        273114..273668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0243"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: aba:Acid345_3927
FT                   thioredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42770"
FT                   /db_xref="GOA:A0L477"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0L477"
FT                   /protein_id="ABK42770.1"
FT                   /translation="MRRTLLFTLFVLACIGIALVTLLKEAPPPSTASPEPAASATPSQP
FT                   AWLQHPLTTLGEETLTLGDFKGKLLLVNFWASWCPPCLAEIPELVQAQNDFGDKGFQVV
FT                   GILFQDRADTASLKAFVQRKRINYPVIKDDPGKIQQLSQEMGGVFALPMSLLIDRDGKI
FT                   VKTHTGQLHYRDLENWLKPRL"
FT   sig_peptide     273114..273233
FT                   /locus_tag="Mmc1_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.505 at
FT                   residue 40"
FT   gene            273699..274052
FT                   /locus_tag="Mmc1_0244"
FT   CDS_pept        273699..274052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0244"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   noc:Noc_1056 CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42771"
FT                   /db_xref="GOA:A0L478"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A0L478"
FT                   /protein_id="ABK42771.1"
FT                   /translation="MSTAQGIIVWCSVPDQASANTLSQRLVEQKLAACVHTLPQGRSTY
FT                   RWLGKVEHQSEHLLMIKSHPRCETALIEAICANHPYEVPEIILTRIDAGLPAYMQWLAQ
FT                   SVEQNPLSPEQEP"
FT   gene            274053..274793
FT                   /locus_tag="Mmc1_0245"
FT   CDS_pept        274053..274793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0245"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: rpa:RPA4472 putative c-type cytochrome
FT                   biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42772"
FT                   /db_xref="GOA:A0L479"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A0L479"
FT                   /protein_id="ABK42772.1"
FT                   /translation="MPDVTLLTAFGAGFLSFISPCVLPLVPAYLSYMSGISVDEMKAAG
FT                   AQGNHKVAMHAALHSLAFVLGFSLVFVGLGATASALGQLMFDYMEYLSKIGGVLIVIFG
FT                   LHFMGLFRISFLNFEARFNPDRKPPGMWGAFFIGLAFAFGWTPCVGPILAGILALSAGQ
FT                   DTVHEGIVLLVAYSAGLGLPFILAGLAINRFLVFFKKVRQHMHKVEIVAGGLLVIIGVL
FT                   IFFGNMTVISSLLLQIFPGLGELG"
FT   gene            275258..276753
FT                   /locus_tag="Mmc1_R0003"
FT   rRNA            275258..276753
FT                   /locus_tag="Mmc1_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            276952..279725
FT                   /locus_tag="Mmc1_R0004"
FT   rRNA            276952..279725
FT                   /locus_tag="Mmc1_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            279929..280043
FT                   /locus_tag="Mmc1_R0005"
FT   rRNA            279929..280043
FT                   /locus_tag="Mmc1_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            280268..280702
FT                   /locus_tag="Mmc1_0246"
FT   CDS_pept        280268..280702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0246"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="PFAM: ribosomal protein L13; KEGG: pae:PA4433 50S
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42773"
FT                   /db_xref="GOA:A0L480"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L480"
FT                   /protein_id="ABK42773.1"
FT                   /translation="MKSFVAKPSTIERKWYVIDATDMVVGRLASEVAKRLRGKHKPTYT
FT                   PFMDCGDNIIIVNAEKVRFTGNKRNDKVYYWHSRFPGGLKSITADKELSGNHPERVLEK
FT                   AIKGMLPKNVLGRQMFRKLNVYKGSEHPHTAQQPEELKLG"
FT   gene            280715..281107
FT                   /locus_tag="Mmc1_0247"
FT   CDS_pept        280715..281107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0247"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9; KEGG: rsp:RSP_0021 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42774"
FT                   /db_xref="GOA:A0L481"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L481"
FT                   /protein_id="ABK42774.1"
FT                   /translation="MAQETFNATGKRKESVARVRIVPGSGKVTINQKPMDVYFGRPVLR
FT                   MVVNQPFSVTEMENKFDVLVNVHGGGVSGQAGAIKHGISKALVDYDEALRPALKKAGFL
FT                   TRDARTVERKKYGRHKARKSTQFSKR"
FT   gene            281241..282290
FT                   /locus_tag="Mmc1_0248"
FT   CDS_pept        281241..282290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0248"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: pca:Pcar_1898
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42775"
FT                   /db_xref="GOA:A0L482"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L482"
FT                   /protein_id="ABK42775.1"
FT                   /translation="MGRTLRVAILGATGYTGGELIRLLHRHPGAELSFVSSERFAGQSI
FT                   AKVYTHLQAVGHLICQPMDAKKACEAADFIFCALPHVTSMEVVPELLQRGAKVVDLSAD
FT                   FRLKSAETYAHWYGTQHLAPELLPQAAYGLPELFRESIKGANLVANPGCYPTSVQLPLF
FT                   PLLQEGMIDPALVIADSKSGVSGAGRSPAQGTLFAELSEGFKAYKVEAHRHIPEMEQNL
FT                   ALAAGKEIKIRFTPHLLPQSRGILSTCYLRPTSGVNAQRVRDTLMTRYRDEPFVTVLPH
FT                   GDMPATSDVRGSNACHMGVTEDLRSGWLIIVSVIDNLVKGASGAAVQNFNLMTGWDETT
FT                   ALDSLPMFP"
FT   gene            282439..282696
FT                   /locus_tag="Mmc1_0249"
FT   CDS_pept        282439..282696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0249"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: par:Psyc_0327 putative 4Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42776"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0L483"
FT                   /protein_id="ABK42776.1"
FT                   /translation="MALIINEDCTNCDVCLPECPNEAITDGSDVDSDIYYIHPDLCSEC
FT                   KGSFDEPQCVSVCPVECIEQDPDHVESEEELLAKHEAIHG"
FT   gene            282884..283771
FT                   /locus_tag="Mmc1_0250"
FT   CDS_pept        282884..283771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0250"
FT                   /product="domain of unknown function DUF1732"
FT                   /note="PFAM: YicC N-terminal domain protein; domain of
FT                   unknown function DUF1732; KEGG: mca:MCA3026 conserved
FT                   hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42777"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A0L484"
FT                   /protein_id="ABK42777.1"
FT                   /translation="MPNSMTGIGRSEASVQGMRLAWRLRSVNQRFLEMNLRLPDLFLDA
FT                   EPRFRQRLRGHFARGSVEATLTMQQDGPSQVKMQLDRERLGQILAAEKNMRELDGSHRG
FT                   ELSMDRLLSWPGVLKELPVAWDSQQLEEIWHQADSLLESACEEMTQFRGREGAALAQGI
FT                   LERLHELEQLAQQIEADLPRVREILEKRLHEKLAQIAENPADPARMAQEVGYLLTKVDV
FT                   SEELERLSIHIREMRDTLELSEPVGRRLDFLCQELNRESNTLCSKPQDPTISRIGVDMK
FT                   VAIEKIREQVQNLE"
FT   gene            283786..284409
FT                   /locus_tag="Mmc1_0251"
FT   CDS_pept        283786..284409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0251"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: nar:Saro_1003 guanylate kinase; PFAM:
FT                   guanylate kinase; SMART: guanylate kinase/L-type calcium
FT                   channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42778"
FT                   /db_xref="GOA:A0L485"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L485"
FT                   /protein_id="ABK42778.1"
FT                   /translation="MLQTRGFALIVSAPSGTGKTTLTRHLMATQPNIALSVSTTTRGAR
FT                   PGEEEGTHYFFVDKNRFETRIEQGCFLEWAEVFGNYYGTDRGFVKEHIEAGHVVLLDID
FT                   WQGARQIRDNMDAHDVVSIFIAPPAQDKLEIRLRGRKTDSEEVIQKRMQQAAAEFSHWD
FT                   EFDYVVVNDDLAQAKVELSAVLVAERLRRGRMQATIQPILKTFA"
FT   gene            284490..284855
FT                   /locus_tag="Mmc1_0252"
FT   CDS_pept        284490..284855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0252"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: mlo:mlr7753 RNA polymerase
FT                   omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42779"
FT                   /db_xref="GOA:A0L486"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L486"
FT                   /protein_id="ABK42779.1"
FT                   /translation="MARVTVDDCVQHVSNRFELVILAAKRARQLAKGAEPEVSVDRDKN
FT                   TVVALREIAESKLNMDDLRRMEETVVEEEVVDEVIRFEIADLAVSDDLADGDAANDLQG
FT                   EEDDLGLGLDEAEDLGF"
FT   gene            284969..287230
FT                   /locus_tag="Mmc1_0253"
FT   CDS_pept        284969..287230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0253"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: mag:amb2253 guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase; TIGRFAM: RelA/SpoT family
FT                   protein; PFAM: amino acid-binding ACT domain protein; TGS
FT                   domain protein; RelA/SpoT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42780"
FT                   /db_xref="GOA:A0L487"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0L487"
FT                   /protein_id="ABK42780.1"
FT                   /translation="MQGWDTIYEGVISYHAEADLSPLKRVVDLFEEIQWPAETIDRDSP
FT                   IHPLVIAKTLLKMRMDVASLACALLVHPYSQRRFELDTVKQRFGDDIAFLLEGISRISL
FT                   LSLRTPEKKQKETTIEEPEEGASLEDGPPTPRSVGEMIGEIHHGTILVRDENQAEGFRK
FT                   LVLAMAKDIRVILIRLVLCLHQLRLAMRMGPVASVANLSHEVMEIYAPIAHRLGVYWLK
FT                   NELEDLAFRMQWPGQYDAIRAKVLERRKGGEDVVQKVIAILGDKLVSHHIQGQVFGREK
FT                   HLYSVWSKINRKQITLDDMFDLIAYRIIVPNKEDCYRTLGMIHSEFKPIPGRFKDYVAI
FT                   PKRNGYQSLHTVVFGPFGNRIEIQIRTEKMHQIAESGVAAHWSYKGKGGGGNSTTGYAW
FT                   LKDLLALQESVDDPGQFVENVRFDLFPEEIYVFTPNGEIITLPSKATPVDFAYAVHSQV
FT                   GNSCQGAKINGRIVPLKTPLVTGDTISIITGKNREPNPNWLQFVVTSKAKYWIGRFVKE
FT                   KQRQQSIGLGREILEREGRKVGSSITEKQLRVVLETFRCENIDDLYYNIGISRVSALQV
FT                   VHKLFPGSAPAFTERKNQVARAGVERRGDKLALTGALEGIAVQAARCCSPLPGDVVVGI
FT                   INTGRGITLHRISCNNLKSMEDQPERWVEDINWGGDKLLAHTARIRAMVSNRRGLLTPI
FT                   SQVITEAKANLLDVHVQDRDRDPCMVVLEVEVINHDHLERVLANLRSVPEVRSVDRMNA
FT                   "
FT   gene            287331..287723
FT                   /locus_tag="Mmc1_0254"
FT   CDS_pept        287331..287723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0254"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: sye:Syncc9902_0877 YjgF-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42781"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0L488"
FT                   /protein_id="ABK42781.1"
FT                   /translation="MHQKIAIATPHAPQAIGPYSQAIQQNGWLYISGQIALDPTTGVVV
FT                   GQGDVGAETHRVMQNLAAILEAAGGGFKDVVKCQIFLADMDDFATVNEIYASYLSEPFP
FT                   ARATVQVAKLPKGVKVEIDATAFVGG"
FT   gene            287772..288101
FT                   /locus_tag="Mmc1_0255"
FT   CDS_pept        287772..288101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42782"
FT                   /db_xref="InterPro:IPR021937"
FT                   /db_xref="UniProtKB/TrEMBL:A0L489"
FT                   /protein_id="ABK42782.1"
FT                   /translation="MRPLTLVGLVMALLVGIVPQARAGQGLYCLHGDAGIHCVYASFTA
FT                   CMAAAAGSHGECKLNQNGMLKPVGGAPYCIAEKWRVHCIYPSMESCMVQAMARRAQCVP
FT                   NPNQH"
FT   sig_peptide     287772..287843
FT                   /locus_tag="Mmc1_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.690 at
FT                   residue 24"
FT   gene            288105..289238
FT                   /locus_tag="Mmc1_0256"
FT   CDS_pept        288105..289238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0256"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42783"
FT                   /db_xref="GOA:A0L490"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0L490"
FT                   /protein_id="ABK42783.1"
FT                   /translation="MVTETPPISHRLDRLLTRFVVGVALLLLFGLGVRMMPLFKVKVGE
FT                   VTSLLSDTGLEVSFEVCMPLYGPAPDRDDLRVREAVRGRIMQTMRREASVKDPAYWRVS
FT                   TLDLHGAKGNNRCQVVLAVLTPRPAGLAPVGGRGVDELFEVGRVLRMALHEGSGNVAHL
FT                   DRTTGRWEGIIPELGRGIARQDRAEGEVLFVEMKSVDALLDAVRFGIADVAEGHIAYTE
FT                   ERDEQFYLSNAYLDTGLMLGSFESEDAQKLVEKRNINNGRIKLVVVKQSLAAELARGRF
FT                   PRAVIHYVESVEGIPQKVHWLRERFQNPLNRILFLTDEIIALGWHETVPLALNNTPLLT
FT                   EDHYILATWNAALQAQANHYLQNHPIQESYRIAVRGK"
FT   gene            complement(289295..290020)
FT                   /locus_tag="Mmc1_0257"
FT   CDS_pept        complement(289295..290020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0257"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: det:DET1462 DNA
FT                   repair protein, RadC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42784"
FT                   /db_xref="GOA:A0L491"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A0L491"
FT                   /protein_id="ABK42784.1"
FT                   /translation="MAQENPKKTTKTKLHGGHRDRLRNRFAQEGLDGFEDHQILELALF
FT                   YALPRRDTNPIAHRLMQRFGSLSAVMEADPVDLATVEGMGETAALFITMLPALTRRYQH
FT                   DAATRNKTPLNRADNVRDYLVPLMAGRTEEVFYVLCLDAQCRLLFPALVTEGTIRQAHV
FT                   HPRQVVELVIRHKAAHVILAHNHPSGNPKASQDDILLTSHLMQALNPIDVQVLDHLIIA
FT                   GEKVFSFASAGMMPKQRVR"
FT   gene            290259..291641
FT                   /locus_tag="Mmc1_0258"
FT   CDS_pept        290259..291641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0258"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: sat:SYN_00640 replicative DNA helicase;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase, N-terminal domain protein; DnaB domain
FT                   protein helicase, C-terminal domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42785"
FT                   /db_xref="GOA:A0L492"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0L492"
FT                   /protein_id="ABK42785.1"
FT                   /translation="MEPLNSGSPLGQDPDAPKKRATWSREAEQSVLGAILLDNHVMDSV
FT                   ADALDVDDFYMGAHRKIYQAMLDLLERGEPLDPVVIRQYLERSDELDSVGGPVYLAELL
FT                   NTVPTAANAKAYARMVRDKALLRGLAQTATEVVERCHTSEAPVDQILEEAEQKIFQLGE
FT                   SKDSRRSTYHDMRSIMVPVFEKIELLMEQQKAVTGVATGFIDLDQQLAGCQPSDLIILA
FT                   GRPSMGKTALAMNIAANAALHHREAVGVFSLEMSKEQLAMRMLASEARMDAQAMRIGKI
FT                   ATSDYQKLTNTATLLSEAPIYIDDTPAISITALRAKARRLKRDKGLKLIVVDYLQLMRG
FT                   SSNTDNRVQEISQISQGLKAIAKEMSVPVIALSQLSRSVEQRPDKRPILSDLRESGSIE
FT                   QDADVVMFVFREEYYKREDIDLKGKAEVIIAKQRNGPVGVVKLAFQNQFTRFENFANRQ
FT                   EY"
FT   gene            293060..294250
FT                   /locus_tag="Mmc1_0259"
FT   CDS_pept        293060..294250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0259"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pca:Pcar_2234 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42786"
FT                   /db_xref="GOA:A0L493"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0L493"
FT                   /protein_id="ABK42786.1"
FT                   /translation="MLPPTLAYTTANPMQWTHRPTWLEIDLAALRHNLRQARTATGPQV
FT                   AHFPVIKADGYGIGAIAVAHTLEEEADGFCVALVEEAEQLRTAGINKRIMLFSGLYPGL
FT                   EERAIRARVEPFLSDEINLNALWQAAKCYGPISVHIKIDSGMARLGYHPEHVPSLLDQL
FT                   AHMPELKLAGLVSHMACADDRHSPITNAQLATLSPILEHPLVKQTQAQLSLANSATILG
FT                   HPNAHYQWVRPGIMIYGASPFFPHTNAANEGLQPVVRWVTHIQRIHTLEKGKSLGYGHT
FT                   FTATRPTRIAQLPVGYADGYNRLWSNKGSVLIAGQHCPVVGIVCMDQIAVDISDLQGEV
FT                   KQWDEAVLLGKQHNAEITLENWATELKTIPYEILTRIGPRVPRRYRDGSILSGSFG"
FT   gene            295056..296051
FT                   /locus_tag="Mmc1_0260"
FT   CDS_pept        295056..296051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0260"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: bja:blr5802 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42787"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0L494"
FT                   /protein_id="ABK42787.1"
FT                   /translation="MERRLLRVALVLVAVVTGSVYYTYHKTPGALDPVGTLSIAASKTL
FT                   SPTLVWLAHDKGFFQKAGLEVTLIPAATGKVAGESLLNGQADLAAATEFLALRMVNTQA
FT                   DLRVLGTLAFVHQMKLIALKEKGIRSAVDLKGKKIGVRLGTNGEYFLERLLALNGLDQQ
FT                   AIQRVDLKPQEMAARLAQGEVDGVMIWPPLVQQIEGQLGDRVVSFDGQPEQDYYYVLMG
FT                   LESWLQKNPLKAERVMLALTQAEAWFKANPQEGVAYMAGLFALPPALLEKALADYHLAV
FT                   TLPQSLLTMLEAEARWLSSVGLSRRMDNYLQIMSPGPLKKVAPSMVTITP"
FT   gene            296065..298911
FT                   /locus_tag="Mmc1_0261"
FT   CDS_pept        296065..298911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0261"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; KEGG: sat:SYN_00226 signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42788"
FT                   /db_xref="GOA:A0L495"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L495"
FT                   /protein_id="ABK42788.1"
FT                   /translation="MNIRSIVFLFGFSGSAILAAGIWSFSVSYGEVTALFQRQNIISQI
FT                   TDQGYRLALLTNEVLLQREIRAEQQWLSLYRMLEQFLEKNAAQLTPVQSYVQGIQHSLQ
FT                   NLHQLFERVTEGFKIGPLEGNAYQAQQRLYLLQMSQISIRIAELQTRLGELTNISNDAA
FT                   EKTAGSSYEGVLFQFGLFLFALILYAVLAILFFYTRLLEPLNRLHKGIQRIQQGDVKHR
FT                   PSHRVMDELGALFAAFSHLLDELQIAITYRKNNEEHLRQLLKLNEEASHLSERELCDRG
FT                   LGIVVSLTQSEVGYLHMVHSDQETLTRVTWNHPRMALGHALDDALVFLNQAGVLTDWAA
FT                   REKPIIQNNKPNFQDDQEVSADRFTFFRHLSVPVIEGNNVRMVMGVGNKAEDYNQNDVR
FT                   QLQTVANEVGKFVQRRRSEIALRIASDEALKANRAKSDFLAVMSHEIRTPMNAIMGMTE
FT                   LLEETELTTIQRNYLSICRSSGQNLLQLINDILDISKVEAGRMEVAVAPFHLHRIIHDA
FT                   NQVILFRAQEKGLNQIVYIDPAVPTILLGDQARIRQILINFLGNSVKFTQSGTIATLVT
FT                   TRAHANKEDQLVIHVVDTGIGIEQSEQEAIFKAFHQVDSSNQRQQGGTGLGLAICLKLV
FT                   ALMQGSVSLSSRAGKGSTFTLTLPLTVAPAEQIQSLKVERGLTGYHMVIWHTHPISTLY
FT                   IEEMFKERGAKVRSCNQSMTLANCAIQGDAVLATTDMMIIHYHEEDKTNPLELINTIRS
FT                   EQSLHEIPVLVYGRCYDPALLKQLNQLGVRFLPESLMQDVLCEQIVTELSKRPRSAVTS
FT                   GQGGTLPMHILLVDDSPDNIFLIQAFLKKTSYQISTVYNGKEAVEYVMQADTPPDLILM
FT                   DIQMPIMDGYAATRQIRLLEQQQGQSRIPIIALTAHAMAEEAEKLKAAGCDLHMAKPVS
FT                   KRILLEVLGRYHEKMAYS"
FT   sig_peptide     296065..296157
FT                   /locus_tag="Mmc1_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.410 at
FT                   residue 31"
FT   gene            299087..299884
FT                   /locus_tag="Mmc1_0262"
FT   CDS_pept        299087..299884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0262"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42789"
FT                   /db_xref="GOA:A0L496"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0L496"
FT                   /protein_id="ABK42789.1"
FT                   /translation="MGALFRVDFTGLSSPNIGSLQKIEAIEIMDQSSSWLRIFGLLALM
FT                   LFMFHPPQEGWSKNVAMPTEGGQNVPPVVTVAHGLHTVLLASTSRQDEAVATHLAVQKI
FT                   GLQQVWCRKQPDMRPPQIQVIAGPYSTTTQAQQLRDWVARRTGIQGMLRVTQYPEVVPD
FT                   AQTRLKTCGESGRRLPVNAPSTAAEGDYIVLVGAFGSQQNGTLVLENLLHKNIPARMKM
FT                   VGQGERSRFNIMVGPFKDKWDAEDVVRLIKDETGLTAQYQQIH"
FT   gene            299982..301340
FT                   /locus_tag="Mmc1_0263"
FT   CDS_pept        299982..301340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0263"
FT                   /product="DNA replication and repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: sat:SYN_00982 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42790"
FT                   /db_xref="GOA:A0L497"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0L497"
FT                   /protein_id="ABK42790.1"
FT                   /translation="MAKAKEQFVCTECGAEYSQWQGKCHTCQAWNSLKAFTPAKKGARA
FT                   AHPTLGVAMEPITLDSVAGGEAPRIQIGISELDRVLGGGLVSGAAILIGGDPGIGKSTL
FT                   LMGALAKLSTSLRVLYVSGEESLIQLKLRAERMGVDGANFWVFMENRLEAVEEAVNKQQ
FT                   PDVLVVDSIQTIAGDEIPSAAGTVTQVRECASRMIQWAKRRNMALFLIGHVTKEGQIAG
FT                   PRILEHMVDTVLYFEGERGHSYRILRAVKNRFGAANEIGVFEMRENGLAQVTNPSELFL
FT                   AERVGGAAGSVVYAGLEGTRPVLIEIQSLVTPSPLPQPRRNTVGIDTNRLAMLIAVLEK
FT                   RLGLGLFNHDIFLNVAGGFRINEPSADLAVTLSLYAALRNISLDPGMVVLGEVGLAGEV
FT                   RAVSHATTRLKEAQKLGFTRCILPKKSMKGVPDGLGITLHPVALIEDAIALLA"
FT   gene            301458..302108
FT                   /locus_tag="Mmc1_0264"
FT   CDS_pept        301458..302108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0264"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; KEGG: son:SO3065
FT                   colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42791"
FT                   /db_xref="GOA:A0L498"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A0L498"
FT                   /protein_id="ABK42791.1"
FT                   /translation="MIWFDYLLIFILGSVLLLAANRGFFREVFALIGWVLAFIATTFLS
FT                   GRLAAHLGHYVADAEMVRIMAISLVFISTLMAVWGIGYLLNWAIAPAQLNWQDRILGMS
FT                   FGLVRGMLVILIGFSTVMAFGGPPQGVMKRSVLAQHFAQGAWRLSILQPSDSMLRVQGD
FT                   ERPTRIQTVPVPTWEADERTLEAWLHRPLEAPPAELPAPIMIHKQVEKVTRLF"
FT   gene            302282..303712
FT                   /locus_tag="Mmc1_0265"
FT   CDS_pept        302282..303712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0265"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase; KEGG: pca:Pcar_1326
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42792"
FT                   /db_xref="GOA:A0L499"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0L499"
FT                   /protein_id="ABK42792.1"
FT                   /translation="MFDPTDEHFHDECGVFGVYNHAEAANLTYLGLYALQHRGQESGGI
FT                   VSVQDRIFHTTRGQGLVADVFKQRELDALEGDKAIGHVRYSTTGGSANSRNLQPLVVDT
FT                   ADGGLAIAHNGNLVNGTEMRRMLERRGSIFQSTMDTEVIVHLTALSRENTFSDRLVEAL
FT                   KQVQGAYALVAMDENQIIVVRDPHGLRPLVLGKVGEKGIVVSSETCALNLIEAQFWRDV
FT                   EPGEMVVISPDGIRSYFPFQKQKRSFCVFEYIYFARPDSNLDGINVYNARKAIGAKLAE
FT                   ESPVEADVIIPVPDSGVPSALGFSQASGIPFELGIIRNHYVGRTFIEPQQQIRHFGVKI
FT                   KLNANPHIFKGKRVVLVDDSVVRGTTSRKIVKMVRAAGAREVHVRISSPPTTNPCFYGI
FT                   DTPTRQELLASSHTVSEMCSYITADSLCYISLEGLYSALNAKRVDYCDACFSGEYPIPF
FT                   PNQVGDQQLTLLKESFYK"
FT   gene            304016..304429
FT                   /locus_tag="Mmc1_0266"
FT   CDS_pept        304016..304429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0266"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgB;
FT                   PFAM: flagellar basal body rod protein; KEGG: pca:Pcar_1195
FT                   related to flagellar basal-body rod protein (FlgB)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42793"
FT                   /db_xref="GOA:A0L4A0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A0"
FT                   /protein_id="ABK42793.1"
FT                   /translation="MSGFGLLGNSGAFKANLLDLRQRRQDIIAANIANADTPGYKARRL
FT                   SFEEELAKSTPRDGDLPMARSDPRHLPAQGFLAASGEIQEVETPISKGDMNSVDMEQEM
FT                   ARQTANQLLYNYATQSLNGQITKMKMAIRGEVR"
FT   gene            304526..304951
FT                   /locus_tag="Mmc1_0267"
FT   CDS_pept        304526..304951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0267"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: bba:Bd3406 flagellar
FT                   basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42794"
FT                   /db_xref="GOA:A0L4A1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A1"
FT                   /protein_id="ABK42794.1"
FT                   /translation="MDFLTSFKVTASGLAAQRLRMNIISENVANAQTTRTPEGGPYKRR
FT                   DPVFMSRPFQDYLTREESAGATGVAVDRVNVDHRPPRLQYDPNHPDANADGYVAMPNID
FT                   VMTEMVNMMSASRSYEANVSVLNASKQMALKALEIGR"
FT   gene            304966..305277
FT                   /locus_tag="Mmc1_0268"
FT   CDS_pept        304966..305277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0268"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="TIGRFAM: flagellar hook-basal body complex subunit
FT                   FliE; PFAM: flagellar hook-basal body complex protein FliE;
FT                   KEGG: dar:Daro_0776 flagellar hook-basal body complex
FT                   protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42795"
FT                   /db_xref="GOA:A0L4A2"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A2"
FT                   /protein_id="ABK42795.1"
FT                   /translation="MKIAALPQLPNIAQLSKGMSLSSTKAGGPWESFSTLLSQQIKETQ
FT                   QLEKKARVLGEKAMLGNAGVSLHEAQIAGATAELHMQLLVQTRNKAVEVYKEVMNMPV"
FT   gene            305406..307061
FT                   /locus_tag="Mmc1_0269"
FT   CDS_pept        305406..307061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0269"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring C-terminal domain protein; KEGG: gme:Gmet_3112
FT                   flagellar FliF M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42796"
FT                   /db_xref="GOA:A0L4A3"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A3"
FT                   /protein_id="ABK42796.1"
FT                   /translation="MAETPNDAEGGASAEEPSLGGLFGSLPLTGRNGVIIAAMASVFIL
FT                   AAIIWFATRPSMKVLYSGLPDLESARIVEQLGKLGVPYELGSGGTTIRIPEDKVYDVRL
FT                   EMAKAGLPKSTDGVGFEIFDNQSLMGMTDFVQRMNYQRALQGELARSVESIAAVEKARV
FT                   HLVLPKKSMFAAEERTATASVVMELTHALNKTQIDGITHMVASAVEGLSQDQVTLLDQK
FT                   GNLIAGGKTEDLDGRMPTDDALALQSMKEKKIEERVQSLLDRVLGPDKSIIRITAELDL
FT                   DKKQRQEESYDPDGQVPLSTNTVTESSRGMFGTGGVPGVIPNDPNQTAVAGGTGSQQTR
FT                   DVEREQVNFLVPKKVTTVQEAVGDIRRLSVAVMIDGTYEAVKDKDGNIDPEKPAVYTPR
FT                   STEEMEQLKRIIMQTVGFDAKRGDSIEVTNTAFEPLPPPLDVKSPWLSREFQLEMAKYG
FT                   AIALLAFLLVFFVMRPLVTKLLIPEEEQDDRLPGTVADLERQLLAEGVGTIPVDSPIRM
FT                   KIPDRSLQLAQQMIADNLEEAREIIRSWMAQDSY"
FT   gene            307363..308373
FT                   /locus_tag="Mmc1_0270"
FT   CDS_pept        307363..308373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0270"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="PFAM: flagellar motor switch protein FliG; KEGG:
FT                   gsu:GSU0411 flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42797"
FT                   /db_xref="GOA:A0L4A4"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A4"
FT                   /protein_id="ABK42797.1"
FT                   /translation="MKLTGKEKAAVFILSLPDDDAKKIMEGMSEDEIREISRTIARLGQ
FT                   MDEETVKAVREEFLSLFENQSFNVRGGMQKVKDLIFKVLGKEKGRHLLKELQQGPKNTP
FT                   WEILNEMEPTLVATFLANEHPQSIALIISQLNAEQASFIIDYLAPEVQQEVIYRMAKLG
FT                   NLPPGALEDIEESLLAELEAMGASRGLYTSEGGGGVKKVAELLNLMPRDTSDKLLAFLD
FT                   EEDNPLAEDVRKEMFLFEDLLLMDDKSFQTLLREVSNDELLTALKGTDDRLKEKFFTNM
FT                   SERAAEMLREDLEMMGPVKVSDVEQAQQAILKVARQLEADGAIVIMGKGSDDVVL"
FT   gene            308532..310106
FT                   /locus_tag="Mmc1_0271"
FT   CDS_pept        308532..310106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC11394 flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42798"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A5"
FT                   /protein_id="ABK42798.1"
FT                   /translation="MSQKTHLYRDRSGLTVEGGFAALLKHEPDPMRGAFVGYLPNGKLP
FT                   SLKVKEPEPIIDEVEAETRRDEALERELYQRVFAAAEQAGMEAGLRKMEEEMAARVPRL
FT                   EGIIRDLDGLPQRVFAASEQFMVESCILLLQELLAHEVSVNVESLKARIHRLMREVATR
FT                   DRMGIHLNPKDVELLGASASFEGLEIIGDPMVPQGTARLESNFGGIEDDISDRLAHMQN
FT                   GIRAFLEERLEKPELYDAAVGAGEIALDEEEEVEQLDDLQEPDANDTTGATLAAMEAGG
FT                   SDDTPEEVHEMTSLGEEVAEDLSTLIDESEAQEANAALDLLGGDITEENEGDEEDDDAC
FT                   IIGPGELSGMPKARPQQAAAELDELDEAAWDEEALTSGTTGATLAAMEAGAHGSKTPAE
FT                   AAALTQMGEGVEEDLSALLDDDVGDDEPDVLADVDEVADEEEEYGTGATLAALEAGALG
FT                   SATPAEAAALTQIGEDVEQDLAALLDADEQDAMDDIAQMLADQGSDEDQDALFEGLLDE
FT                   EDKEFQP"
FT   gene            310103..311452
FT                   /locus_tag="Mmc1_0272"
FT   CDS_pept        310103..311452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0272"
FT                   /product="type III secretion system ATPase, FliI/YscN"
FT                   /EC_number="7.2.2.1"
FT                   /note="KEGG: pca:Pcar_1189 probable flagellum-specific ATP
FT                   synthase (FliI); TIGRFAM: ATPase, FliI/YscN family;
FT                   flagellar protein export ATPase FliI; PFAM: H+-transporting
FT                   two-sector ATPase, alpha/beta subunit, central region;
FT                   H+-transporting two-sector ATPase, alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42799"
FT                   /db_xref="GOA:A0L4A6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A6"
FT                   /protein_id="ABK42799.1"
FT                   /translation="MISMAQTPTEEHPLRLPWGAYAQVAQEDLGFHRLGWVKKVVGLLI
FT                   EGNGPAVSIGQMCDVVRENGEVVKAEVVGFRDKSVLLMPLGSIKGIFPGSRIISQGRAE
FT                   QVPVGPQLLGRVIGPMGEALDGHALPHLDDHVPLHAAPINPMLRRKIEEPLDLGVRAVN
FT                   SLLTVGRGQRLGIFAGTGVGKSTLLGMMARYTAADINVIALIGERGREVVEFIEDELGP
FT                   EGMARSIVIVATSDQPPLLRLRAAYMATAIAEFFRAQQKDVLLLMDSITRFAMAQREVG
FT                   LATGEPPTSRGYPPSTFMLLPRLLERGGRDQGRGSITSIYTVLMEGDDIQDPIVDAVRG
FT                   ILDGHIVLSRDLAAANHYPAIDVNGSLSRLMEGLSEKAHKRAAGQLREILATYVKAEDM
FT                   INIGAYVAGSNPRIDRAIRFIEPIRTFLKQSVEEPSTLEESIAQLESLFA"
FT   gene            311698..312003
FT                   /locus_tag="Mmc1_0273"
FT   CDS_pept        311698..312003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hit:NTHI1094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42800"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A7"
FT                   /protein_id="ABK42800.1"
FT                   /translation="MKKATIIGLFIGIGISLLAQIAVAGPPMLFGADGRYLGTLSNNRY
FT                   DPNSVSNPYGRYGSRYSPDSINNPFGRYGSRYSSESVNNPFASNPPKIFSPYGGLR"
FT   sig_peptide     311698..311793
FT                   /locus_tag="Mmc1_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.662 at
FT                   residue 32"
FT   gene            312216..312671
FT                   /locus_tag="Mmc1_0274"
FT   CDS_pept        312216..312671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2753 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42801"
FT                   /db_xref="GOA:A0L4A8"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A8"
FT                   /protein_id="ABK42801.1"
FT                   /translation="MSRIPIHYKVTLFYALFGVLWIFVSDRVLEFLVSDAQLMGIIQTF
FT                   KGWIYVVLTSAMLFVIIRMDHLAIEKKEREKAQLYQATMSAVHHILHNFLNKMMLYRLG
FT                   VEEQQPVNPELQALYERVIEETQHEIYLLQTAKQFTAEEVRATVQPK"
FT   gene            complement(312740..313471)
FT                   /locus_tag="Mmc1_0275"
FT   CDS_pept        complement(312740..313471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0275"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: sde:Sde_2152 ATPase FliI/YscN"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42802"
FT                   /db_xref="GOA:A0L4A9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4A9"
FT                   /protein_id="ABK42802.1"
FT                   /translation="MLLENRIALVTGAGSGIGKAIAEGYAAAGATVLLLGRTQKKLENV
FT                   YDAITQAGGKATIVPMDLETGLGAIPELVKNTYERYGRLDILVNNAALLGTLSPLANYR
FT                   PQEWEQVMRVNVTAPFFLMREFIPLLTQSDDASIINLSSGVGHQGRAFWGAYAASKAAL
FT                   INLSETLAQELEKSPIRVNTVNPGATATTMRAKAFPGEDPTTLPSAQAILPVFLYLASQ
FT                   QSKDVRGEHLNAREWMDWKAV"
FT   gene            313530..314450
FT                   /locus_tag="Mmc1_0276"
FT   CDS_pept        313530..314450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0276"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: gsu:GSU2000 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42803"
FT                   /db_xref="GOA:A0L4B0"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4B0"
FT                   /protein_id="ABK42803.1"
FT                   /translation="MGPTASGKTGLALHLAEHFPLEIVNADSVQVYRGMDIGSAKPTLQ
FT                   ERQAIVHHLIDVTTPDDPFSAGRFRTAALEVIEDCHRRGVIPALVGGTGFYFRAVEQGI
FT                   AEIPEVDAQIVAELNRRVCDEVGLACCYAQLQQVDPPWAARVEPGDRQRIVRGLSVYLA
FT                   SGQPLSYWQQLSCQQAPEGPALRICKLAIEWPREQLYARINQRFEQMLKEGFMEEVQGL
FT                   LSRGYHGDLPAMRAVGYRALIGYLQGAYDLARAVELGQRDSRRYAKRQITWLKAEPGLQ
FT                   WLAPEGAKQAALDEVRAFLQFFKKK"
FT   gene            314696..314953
FT                   /locus_tag="Mmc1_0277"
FT   CDS_pept        314696..314953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0277"
FT                   /product="RNA-binding protein Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein, core; KEGG: lpp:lpp0009 host factor-I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42804"
FT                   /db_xref="GOA:A0L4B1"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4B1"
FT                   /protein_id="ABK42804.1"
FT                   /translation="MGNSHAGHNVQDPFLNTLRREKVPVTVFLVNGIKLQGMITSFDNY
FT                   CLLLKNSVTQLVFKHAISTVMPSRNIHMGDERDDAKESKE"
FT   gene            315020..316318
FT                   /locus_tag="Mmc1_0278"
FT   CDS_pept        315020..316318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0278"
FT                   /product="GTP-binding protein, HSR1-related protein"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   mag:amb2373 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42805"
FT                   /db_xref="GOA:A0L4B2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4B2"
FT                   /protein_id="ABK42805.1"
FT                   /translation="MLETHQAPDRAILLQALEPKVTRDACQRLLDELVHLSTTAGLEVH
FT                   ATQLLSLQKAVPATYFGSGQVEELARRIEEDEIDVAVVNHALTPIQQRNLEKKLNAKVV
FT                   DRTGLILEIFAARARTREGIMQVELASLMYQQSRLVRSWTHLERQRGGVGLRGGPGERQ
FT                   IEVDRRLIRERIHKLKKQLEEVERTRALQRQPRQDIPLFTVALVGYTNAGKSTLFNLLT
FT                   RAGVLAEDKLFATLDPTMRAVDLPDGGRILLSDTVGFIRQLPHQLVAAFKATLEEVMSA
FT                   DMLLHVVDLSDPEWERYVESVNGVLQELEVQHTRTLTVYNKIDRLESRGILERELARGD
FT                   TIGVSAQTGEGVEPLLSELRRAVGRAMLRYEVILPVSDGRWLAKFHAEASVVEVREGED
FT                   FTTLIVELAPAVLGRLQGEVEREGVEVQFRPVD"
FT   gene            complement(318313..319587)
FT                   /locus_tag="Mmc1_0279"
FT   CDS_pept        complement(318313..319587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0279"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: cvi:CV0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42806"
FT                   /db_xref="GOA:A0L4B3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4B3"
FT                   /protein_id="ABK42806.1"
FT                   /translation="MKKKVSVSQLEPGMYVSDFNNGWNEDARSGKDPNGLPQQMMLKSD
FT                   ADVRRVLADSTIREVYIDTERGRDVEGAKSQAEIEAELAAQMMELGEEGNAVKLPNPDV
FT                   KKQPMEQELEHAHEVKQKARRLVGDMLDDVRLGKTITVGPVKELMKDMVESMFSNKDAM
FT                   LSLSMIKAKDEYTFMHSVNVGVFLVAFAQSMEMTPEELVAVGVGAMLHDIGKMKTPQEV
FT                   LNKPGKLDDEEFLQMKMHVVHSEKILAAAPGISELSVQIAGRHHERWDGSGYPRQLKGH
FT                   AIGQMGQMSAIVDVYDAITSDRCYHKGNSPHQALKRMMEWSKFHFNPDLFQKFVQCVGI
FT                   YPMGTLVRLHNGYLGVVLETNTESLLHPVVRVLIDSKAKKKLKPVTLNLIERKADKNWA
FT                   VEGVEDARKWGVDPKKHMPKPELFQ"
FT   gene            320040..320384
FT                   /locus_tag="Mmc1_0280"
FT   CDS_pept        320040..320384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42807"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4B4"
FT                   /protein_id="ABK42807.1"
FT                   /translation="MPEFTGMRCPICNGRPAHIYVCVSCGEVRCGQNSCTGSEDGHAGW
FT                   AGSGTLCRHCGQGRYRIMSFHSSEFLDFVREYTFRKRNKDSAIATFNKAASIEDELLLR
FT                   LKRPTPTARR"
FT   gene            complement(320472..321011)
FT                   /locus_tag="Mmc1_0281"
FT   CDS_pept        complement(320472..321011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN2111 hypothetical exported 24-amino acid
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42808"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4B5"
FT                   /protein_id="ABK42808.1"
FT                   /translation="MLLSFLSKRQRHGLVALLLGLLLTGCGPTEFSDLEMRGGRAYLKN
FT                   SAVPYTGPVVAFFPSDEEGGERQIYMEGGFANGLRDGTWTTYRTNGGKIEDKYVLGRRN
FT                   GTIKRFDARGKVRSEESYFNGRRHGGAVYYNEDGGVARNLYYQEGNLRAYPSPARRTMI
FT                   EDKMKEGPDSDLLDIK"
FT   sig_peptide     complement(320913..321011)
FT                   /locus_tag="Mmc1_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.786 at
FT                   residue 33"
FT   gene            complement(321021..321242)
FT                   /locus_tag="Mmc1_0282"
FT   CDS_pept        complement(321021..321242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0282"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   cch:Cag_0147 rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42809"
FT                   /db_xref="GOA:A0L4B6"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4B6"
FT                   /protein_id="ABK42809.1"
FT                   /translation="MGVWCCMSCEYEYDEEVGSTATGIVAGTDFDTLPKDWRCPVCGLS
FT                   KEHFQSEDMLRGESPIELADADDEEIEF"
FT   gene            321914..322363
FT                   /locus_tag="Mmc1_0283"
FT   CDS_pept        321914..322363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42810"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4B7"
FT                   /protein_id="ABK42810.1"
FT                   /translation="MKSTQPQANFGFNICHFESQSDINSDIYDTMLEIRRDDLFEIGTV
FT                   RAWCFPPRGAPTSVHRAWDMAVNMLSDEDADRLAARFYKGTNLMGFPLPGLTTDAGTSN
FT                   HGSYRAWTRQLMAELSRTGHARADFDEQHALLELFLWALTACDAP"
FT   gene            322581..323186
FT                   /locus_tag="Mmc1_0284"
FT   CDS_pept        322581..323186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42811"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4B8"
FT                   /protein_id="ABK42811.1"
FT                   /translation="MLHITSTAHRPQGPTQTKVGTSGGPMDHASGFDTALEEASRKVDP
FT                   PSTVDPVATMAAAVIPPRGLQNRVLSGYDPAKGIVTPEALRQTLSREEMEAFGQLLNAP
FT                   PSKEKVGDHPLPPNLEKRWMEAINGLSTDLRAALTKLLHGESKDGSHLQTAAEKGLPLE
FT                   GLSNHLLTALEADRESIPPATYRAWRLRIDDLQGRVAS"
FT   gene            323330..323605
FT                   /locus_tag="Mmc1_0285"
FT   CDS_pept        323330..323605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42812"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4B9"
FT                   /protein_id="ABK42812.1"
FT                   /translation="MNDISTMVKLQTAAQQPKPAAPTKSGGHGVEPSPILNPSPAKDVV
FT                   TLQRSEPVVKAIDAMVNEVMDALINHEVDLSALTHNLSKQSSKLVQ"
FT   gene            complement(323709..324059)
FT                   /locus_tag="Mmc1_0286"
FT   CDS_pept        complement(323709..324059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0286"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: sde:Sde_0900 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42813"
FT                   /db_xref="GOA:A0L4C0"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C0"
FT                   /protein_id="ABK42813.1"
FT                   /translation="MSVTIYHNPRCSKSRQTLQILQDKGIEPTVVEYLKTPLDKAALQN
FT                   LLAQLGCSPREILRKGEEAYKENHLHDPNLTDDQLLNVLVAHPKLMERPVVVHGERAVL
FT                   GRPPESVLALFP"
FT   gene            complement(324075..324497)
FT                   /locus_tag="Mmc1_0287"
FT   CDS_pept        complement(324075..324497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_2552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42814"
FT                   /db_xref="GOA:A0L4C1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C1"
FT                   /protein_id="ABK42814.1"
FT                   /translation="MGMGLITLFLLALLAATLLPFSSELMLGSMAATGEWSLWHLWLAA
FT                   TAGNVLGALVNWYLGGWLMKWQHHRWFPVSPQALSTAKQRYDRFGVWSLLLAWVPVIGD
FT                   PLTLVAGLFRTPLYLFIPLVSLGKGGRYGVLLYLLA"
FT   sig_peptide     complement(324402..324497)
FT                   /locus_tag="Mmc1_0287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 32"
FT   gene            324717..327485
FT                   /locus_tag="Mmc1_0288"
FT   CDS_pept        324717..327485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0288"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: WD-40 repeat protein; protein of unknown
FT                   function DUF323; KEGG: dps:DP2422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42815"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C2"
FT                   /protein_id="ABK42815.1"
FT                   /translation="MHTIIRFMLLPMLMLVGLECHAALPYAHGTAPPEGVENQGVSTYQ
FT                   APEATKAVQRNLDPRALLAPPQREAVFSPDGNRLAETAQGGGIQVRTVGLEDQAVRLTG
FT                   HRNGVTAMAFSPASQRLLTAGGDLLVKLWDLDNSQLIYTLAGHAAPVRDAAFSSDGRFI
FT                   LTASDDGTVRLWDTESGRMLGGHQRRTRLLTFTPDRRYALSVDTDEPRLMRRWEVVTGK
FT                   TVGYYQGHNKAITRMAYAPGGLRMATADAGGGIILWEAQNQTPISILEGHTAPISELVF
FT                   SQDGTMLLSADRVQSWILWDARTGQPLQSVQAPPGNILAATLHGGPPAKPLFLGERGML
FT                   RVWDSLGGGGAYSLLNPPTHDPMLPNQGVSLGMPPGTAGPHVPGTWMHQNAAIAAPSVG
FT                   GEAPAFSGSGHGYGAPAPGMPGGPALNGAGAVTTPASPPVEVQPGTALPGMHSAPPQDS
FT                   GQNRGGATMAPPMAQPAQSFSMPSGMLPNQGSTPHGLMPAAPPAVQGKRADQSSVYRPV
FT                   ALDATPVMQGQVIPGPGHPTGGAGGRGVAIPERNKALGQVLTAPPIPGAVLAARPQVTP
FT                   KHKTAIAIPAPEPVVTKKAETLPKKAPVWVKPARPPAAPVNLVATVNPETVPTQDTNSV
FT                   VDADTGITFVEVPGGCFSMGGNDKNMTPAERPAHEVCLTPFWMSRFEVTQGQWAAVMKK
FT                   NPSFFKLGPNYPVEQVSWEDAQSFVQKINRKVGQPYYQLPTEAQWEYACRSGGKDEEYC
FT                   GGDDLSAVGWHQGNGGLSTHAVGLRRPNGLGLFDMSGNVLEWTLDGFQENYYTKSPRNN
FT                   PSGPKVANHRAARGGSWRTPPLDEARATMRHDLSPKLRHASLGFRVIRTTPPRPAHTVV
FT                   RRTDERRAAAITVEQLNIAQAQQPNMINGIPRFVTPQAGSMDPPPVILPTP"
FT   gene            327824..329053
FT                   /locus_tag="Mmc1_0289"
FT   CDS_pept        327824..329053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV3267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42816"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C3"
FT                   /protein_id="ABK42816.1"
FT                   /translation="MADHPCNCFETLFKGPYTPITTLDALHTYLQAAVTLEFATIPAYT
FT                   TALYSMQDTSSGAYQLTRSVAFEEMFHVYQAANLLVAVGGVPRFTEAYTPKYPTFIPNA
FT                   NQRTTPYIGLNRASVAVYETVFMGIETPAPYEAPPQDQQIQTIGQFYKAIELGLIYLET
FT                   QAQQQGESIFKNTPGYGQHLNYYLGKGGGQIIEVTNLDDAKLAILQIVQQGEGAVTPDH
FT                   ALVQTSPWGAYNHYGVRVDGNYGPIAGTPMELSHYFKFKRVVDGVDPLPSTYPVVGVAS
FT                   LSNYSNPTAIATANLFNQYYSHLLVALENAFKGGAEARKTYLQQAMPIMNIALPNLARV
FT                   LMSTPIWADQASSSVGPNALPTWSWVATTPQATVTATQRLADQNENEAEAQLLQHCTTA
FT                   LDGFCRMAQA"
FT   gene            329100..330926
FT                   /locus_tag="Mmc1_0290"
FT   CDS_pept        329100..330926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV3268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42817"
FT                   /db_xref="GOA:A0L4C4"
FT                   /db_xref="InterPro:IPR033797"
FT                   /db_xref="InterPro:IPR041168"
FT                   /db_xref="InterPro:IPR041173"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C4"
FT                   /protein_id="ABK42817.1"
FT                   /translation="MSHPTFNATTQITVYPAIGIARVGDSQGFYIGPETACAMPTDLTG
FT                   QTVDQNGLRDAEQKMKRQAARFSLYATDDQGQVFEVTPATPGVKRIEWTVHLANKKSIW
FT                   YEFQTNPGELGYAPNHPLRNADITDPAQRQGMMIDPGPRQVVAQPNQQQIFFASFDDSQ
FT                   SEIPHSFPPAHTKPYAITTLGDLSFDAKGNLLVVGGHGRSGCQMSKDNCQITAYANNDG
FT                   WFDDTSDGPVDAQITLEDGQVIEAKGAWVIAGPPAYAPEVANMVTLYDTIFDTAVCKLG
FT                   ARPDIFAQGMWKKGADGYKPSFVDEILPLIKRGDGYPWVVAIPPKPHRLQYDVLGDPDP
FT                   GYDPMRQRILNYLRAPGDENVLIDPSRGGTMMPYLAGDGCIGTTNETKSRYMRLTDTQY
FT                   FMLEQWANGYFRTESAPVNHPGEAISRGVLENCVGGPFSPGIEMTWVSRLPQIYAEPLR
FT                   IRKKPQITFPLSLDWDPLVGLEPGDVTKFMAIPWQADFNLCSSQPIQGRTLWWWPAQRP
FT                   LNVYTPLKEEIDFSQPLQQLVEGKQIKQVAWVGEDYNMNGGSYLTFPTYMQMVEHWKEL
FT                   GFIINVSRDPEQPLLVEVARTLPRAGLDSTDS"
FT   gene            330926..332011
FT                   /locus_tag="Mmc1_0291"
FT   CDS_pept        330926..332011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0291"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; tryptophan
FT                   halogenase; KEGG: cvi:CV3269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42818"
FT                   /db_xref="GOA:A0L4C5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C5"
FT                   /protein_id="ABK42818.1"
FT                   /translation="MERVLILGAGPAGVATALTLRQRGVAQITLLHRPLPHSRYQTGES
FT                   ASPDVAPLLRQLELPQLLEQGQHWVCRGIRWRWGGAELAENDYMMQGRGHGWHLNRHRF
FT                   DEQLRQAAEHRGIDLHVANLTRLEPIAQGGYRVTLSEPGGGAQRHDYRVLVDASGRGAH
FT                   LAGKLGVRWQPQDRLTAYLRLGTLAKESWLKHLSYVEATPHGWWFVAGIPGDQAVVVFL
FT                   TDVEIGRQQGLVQGSVFDGLLAQSLWGGQGVSGLEARVRPYAAHVGWLPQVVGRDWVAV
FT                   GDAALGLDPLSASGINGALADGIAAGHALADHLQGDAGALTRHGLALQESQRLFVQERQ
FT                   IHYGRERRWCEHPFWQRRHLA"
FT   gene            complement(332469..333011)
FT                   /locus_tag="Mmc1_0292"
FT   CDS_pept        complement(332469..333011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42819"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C6"
FT                   /protein_id="ABK42819.1"
FT                   /translation="MNGLKFLVLMVAVGLLSGCAMVTPQRTTGPSKVATQGWAEYTQSR
FT                   AAFDEVEPFLTTVEQLQALGFDPLGEQGVLHLKVHEIEPLLREGWEVAGGLPQGVQECQ
FT                   AAGEGCYAYLLQAQVRKQDLGVAEDAPFRALFLVKRVPAVKEDLVVYKMWDTKPHAQLL
FT                   RGRTLDGWKKLMQLARM"
FT   sig_peptide     complement(332922..333011)
FT                   /locus_tag="Mmc1_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.486 at
FT                   residue 30"
FT   gene            333465..335834
FT                   /locus_tag="Mmc1_0293"
FT   CDS_pept        333465..335834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0293"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   bur:Bcep18194_A3340 TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42820"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C7"
FT                   /protein_id="ABK42820.1"
FT                   /translation="MTVQNPSSVPAFTQAMHHLQQGQTAQAMVLFQDVPAGDPGFVTAQ
FT                   LNLGIHAHYQQQWQEAEQYYKGVLALAPQHPQCQQQLFILYKTLQREQPAQQLMQHLLA
FT                   ATHGDPLLWQQWAETLAHYGEVNGALSCWAHAYRLQPDNPQPLRAMAQRLEQQGRIQEA
FT                   TEQLQQLAQMLPEDLDLLLHLVGLLKQIGKHTAAEAYLRQRLVEHPQSQPLRFALANLL
FT                   MDQGNLAEAETLFRQNLPDHLLSQLNLGVIYGRQGRYTEALHLFRHANAVTPNHLFTGY
FT                   NLAVLCLQIGQLDEAQALLEQAIAHHPQQVALRNTLGQVYARQLKFTQAIQCFHAALQQ
FT                   QPQCESYLQLGTLYRNSAQLAEAKQCNDQAVLLDPENLEARTHQLFLAHYLPDAHQAQM
FT                   LAQARAFGQLVAGRAKPFAHAVPASPPKPLRVGLVSPDLRGHPVGYFLESIVHAMDGQR
FT                   IMLCAYNSGPPGDALTQRLQSRMAHWRDIEFMSDAQVAQLIRQDGIDILVDLAGHTAKN
FT                   RLALFAWKPAPIQVTWLGYSATTGVSQIDYIMGDPYTLRAHEAAHYVEKMWQLPHSHLC
FT                   FTPPDLELEVNALPALQQGFVTFGCFNKLTKINDEVLSCWAEILQRLPSSRLYLKQGIY
FT                   ANAEVAQQLYARFQALGIGAERLILEGGSDREGYFRCYHRVDMALDPFPFPGGTTSVEG
FT                   LWMGVPLVTLQGNRFMAHQGESILQHAGLAHWIAQDRHAYVEKVIAFAKDLPALAQLRH
FT                   GLRQQVLASPLFDAPLMATDLMQAWEQMWQIYQNGR"
FT   gene            complement(335845..336171)
FT                   /locus_tag="Mmc1_0294"
FT   CDS_pept        complement(335845..336171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42821"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4C8"
FT                   /protein_id="ABK42821.1"
FT                   /translation="MASIMLVCSDLLNRVQLESSWKAAGLAMVNASQGESPHIIVLDLS
FT                   PEQALHQIAPLKASHPDAQLVAFGPHLQGERLLAAKQQGADLVVARSSVVERVIKLAQA
FT                   HAQA"
FT   gene            complement(336285..337940)
FT                   /locus_tag="Mmc1_0295"
FT   CDS_pept        complement(336285..337940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0295"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: mag:amb0203 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42822"
FT                   /db_xref="GOA:A0L4C9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4C9"
FT                   /protein_id="ABK42822.1"
FT                   /translation="MAAKEVKFGEAARAKMLNGVNILANAVKVTLGPKGRNVVLDKSWG
FT                   APRMTKDGVSVAKEIELEDKFENMGAQMVREVSSKTADVAGDGTTTATVLAQAIIREGM
FT                   KAVAAGMNPMDLKRGIDLAVEAVVVGLKGISREVANSQEIAQVGAISANSDKVVGDMIA
FT                   EAMDKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFVTNADKMLVQMENPLILL
FT                   VEKKISNLQQILQILEGAVQSSRPLMIIAEDVEGEALATLVVNKLRGGLKVCAVKAPGF
FT                   GDRRKAMMEDIATLTGGVLVSEDVGVKLENVTMDMLGMAKSIVVTKEDTTIIDGAGDHE
FT                   AIKARVNQIRAQIEETSSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDA
FT                   LHATRAAVEEGIVPGGGVALLRAREASLTNLQGANHDQQVGINIVTRALEEPLRIIASN
FT                   AGAEGSVVVNRVVETKETNFGFNAATGVYEDLVASGVIDPAKVVRHALQAAASVAGLMI
FT                   TTEAMVAELPKDEPAMPGGDMGGMGGMGGMGGMM"
FT   gene            complement(338016..338309)
FT                   /locus_tag="Mmc1_0296"
FT   CDS_pept        complement(338016..338309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0296"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: atc:AGR_C_1221 10 KD
FT                   chaperonin (protein CPN10) (protein GROES)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42823"
FT                   /db_xref="GOA:A0L4D0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D0"
FT                   /protein_id="ABK42823.1"
FT                   /translation="MSINFRPLHDRVVVKRTESDAKTAGGIIIPDTAKEKPVQGEVLAV
FT                   GSGVVNDAGNVRPLEVKVGDKVLFSKYGGTEVRIDGEELLIMRESDIVGILG"
FT   gene            complement(338740..339885)
FT                   /locus_tag="Mmc1_0297"
FT   CDS_pept        complement(338740..339885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0297"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tcx:Tcr_1381 sulfide-quinone
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42824"
FT                   /db_xref="GOA:A0L4D1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D1"
FT                   /protein_id="ABK42824.1"
FT                   /translation="MHARMHVTIIGTGFASIAAIKQLRKLDALKKLQITVIAPKPCFVH
FT                   LPSMIWIPSGLRRAEDVTVDLTNFFKHMQVNYIPATVAQITHKGRTVITTQGEHIPNDG
FT                   LIIASGGTYLQKAPGIEYTLNPCTGLTASERVRDRLQKMPGGTIAFGFAGNPNEPTAVR
FT                   GGPMFEFLFGIHTQLKREKRRQDFKLIFFNPMLEPGKRLGPKAVKGMLNAMQQRGIETH
FT                   LGHKIKAFGPDFVRTEGGEFAADMTLFIPGMRGLPLYEQSDLQLSPGGFIQGDQYCRAE
FT                   GVMRTYVAGDAANLPGPDWKAKQGYGAGMQATAAASNLYDELLGRPIGATYRNELLCVV
FT                   DTLDRGMFVQRSPKLNLILPPMRSMHYIKQFMEWKNIAPLR"
FT   gene            complement(340981..343680)
FT                   /locus_tag="Mmc1_0298"
FT   CDS_pept        complement(340981..343680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0298"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: sat:SYN_00226
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42825"
FT                   /db_xref="GOA:A0L4D2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D2"
FT                   /protein_id="ABK42825.1"
FT                   /translation="MDYGSVTFRHLFLIISIIIALLDAAFVWLNYTADKRVLWQNLSRR
FT                   ANNHRDVFNHTLISTAGHMQQISTLLANTPEVRSRFLQGRLAVDREGGGAGGVQAARIR
FT                   KELYNFLKPGWQAVQNSYEIRQLHFHLAPGDISFLRVHKPDKFGDDLSAIRHTIVHSNR
FT                   FREPTQGFESGRVYAGIRGVVPVIMAAGEDKPEMLVGSVESGTSFVELLQNLKGQMGAD
FT                   YAVLLTTEYARNTLWPKVYQKMVTEGPTNTHYVTEATTSNSLAELFKDDALFSDQEGMC
FT                   RLQVVPLGGQPVALTCFDLLDFRNMQDPQSKPVGKVVVWSQAGAEMLAFNAKFRDNILF
FT                   AISTYLAVELLVFILLRMGTGQFRREVLERTVALHKNNRQLALAKREAEEANAAKSRFL
FT                   ATMSHEIRTPMNAIVGMADLLKDTPLDREQARFVATFQRAGDQLMDLLNDILDLSKVQS
FT                   GQIHIEVVETDIRTLLDDLSAMMVAKARVKQVDLLFNPHPNLPARVGVDPLRLRQVMIN
FT                   LLGNAIKFTANGEVELRAYFTSSSEVPYGLGFEISDTGIGIDETRLKAIFEAFTQADLS
FT                   VTRQFGGTGLGLTISRHLVALMGGDIQVESTIGQGSRFWFEIPIDEPVQRQPLSILEPR
FT                   PVLYLNGMSPNHAEVLRHQLLHHCEEIRYSHGEGELGAQLMEAAPGSVVWLESGHDPTG
FT                   AFRLLESLRGQYGKRGFHWIVAGWESVEKCLEQANFLGSHYIQKPHSMGQVLQLLMDVL
FT                   GMQRVVLAPRVDMDLQTPITILLAEDSPDNVLLVERFLKKTAYRLDVVGNGREALESVK
FT                   KHHYDLILMDIQMPEMDGLSATRTLRSWEREQGTPRTPVLALTAHAFREDREASIEAGC
FT                   DGHLTKPFKKDELLKTIQRHALPHMQRS"
FT   gene            complement(343683..344162)
FT                   /locus_tag="Mmc1_0299"
FT   CDS_pept        complement(343683..344162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42826"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D3"
FT                   /protein_id="ABK42826.1"
FT                   /translation="MVAVLLVLGGLLFVPVGNPDLPPQGLWLRAQHRLLPGLYWQRRLL
FT                   AAQQRLEQAQLVLDGAKADYRQVVRGRRQQIEQARRLAQQEQRNPVTAHRAVVVASRAR
FT                   IHDLRKQLQGAQAQLRRQQRQLETIQLLKLQEMGLYTAVPAVESAGLKPVGAESR"
FT   gene            complement(344509..345882)
FT                   /locus_tag="Mmc1_0300"
FT   CDS_pept        complement(344509..345882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0300"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: sat:SYN_01466 sigma-54 dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42827"
FT                   /db_xref="GOA:A0L4D4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D4"
FT                   /protein_id="ABK42827.1"
FT                   /translation="MKDQTEIILLGRSDSALNSLAMQLKSLQCQPVLIADVTKAKTYLR
FT                   SHQAGLVMIAMEGVDEPLDLLKELTFLFRGLPLLAIATRGSVHEAKQTIDAGAADYLLL
FT                   PVDNEVLSAQIKRYNNQFFDPELGRGRRLVTADPAMLKLLGQVRRVSNSNATVLIQGES
FT                   GTGKELMARYVHQVSDRANGPFVAINCAALPENLLESELFGHIKGAFTGATSDRKGKFL
FT                   QANGGTIFLDEISEMTLNLQAKLLRVLQEKEVDPVGGKHPIALDVRVIASTNRDLKEYA
FT                   ADGLFREDLYYRLNVFPVFITPLRQRPKDVVLLADLFRQRFIKELGRNDIPFDAAAMDA
FT                   LVRYRWPGNIRELENVVQRALLIAEDDAVSSHDLMIEVSGSAAPSPSMTRDADEMGMAL
FT                   DGDHIHMPVGTTVREMEEILIRRTLDEVDGNRTRAAEILGISIRTLRNKLNEYAGRIP"
FT   gene            complement(345888..348623)
FT                   /locus_tag="Mmc1_0301"
FT   CDS_pept        complement(345888..348623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0301"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42828"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D5"
FT                   /protein_id="ABK42828.1"
FT                   /translation="MNAQPNKRTKPWAVPGLLLLVMVLFIPVRGWAFSTELQHEPSPSG
FT                   KGDTLSFELPSNDQLPSWELIRPKVLRLKVPNLLALPHTRIDPKTTRYIRNIVVEEIAG
FT                   ELGLYITLELKVPLLTFRHQVTEAKRRHPSRYILYIEPTPMPNPQDVTRIRGARILPGA
FT                   EGTLVVIDHVGSAEIKDQNIDHAQHAIRLQWQGAAMDKFWIAPQPAGLVTAIHTYTFSN
FT                   DLLEMEIAFHPRTGSVELHQNPKSGTLIIELRTQNMKDVKRKQDIDTILTNRLQAVAEG
FT                   LPLPLNRITPIFKPSSEVVKLADQEVTEEYFMNNALAAEKDHQYGKARGYLDAILRTFP
FT                   QTQNRELLAFYKVDLGKKMQWEKAGWLLEELTGVLNTYPNHYRYPEYRLLQLQLMNGAH
FT                   QSERALAAMNDPNLPMNDARVVLEQARAEKGMGHDVEALERLYYLLEKMPDANVRERAG
FT                   AYFELVDLETQRNHLEKAVKILEEIPDPEMTFLANDPDRYIQLATAYYNHNDFPKALDL
FT                   YIRILDAYPDTPAVTPWAMLRAAMCYRFMNKEDEAKRLLDRLGLIYPNSGAQLWGRIFR
FT                   VEMDGKRDVKERLQELDEIIASNPRGKAIFEAYFAKSQLQGDSGDHESSLKTLNYLLTM
FT                   LDIGFERNRANLLRRRYLQAGMEQALTQRQPEYAMSLAETYGEDWRRFNLFVVPRTQLS
FT                   EALMRLGQYREAQPLLAVNDDVESKRLHKLADDLANGIYPKVDQDRSLVNEREARVRVA
FT                   EAERRREKEDWVAILDLLNRLPIKGLSEGERDERLRLLAKAESERGRFPQAVQNLEDLL
FT                   FNRPMGDGKDYYWYATVQQAWRGDEKALPVYRKVADEAEKVQFKALALMRIGDILQKQR
FT                   NLTEAKQAFEKAAELDPQASWAPMARENAKQLELVQEMAP"
FT   sig_peptide     complement(348525..348623)
FT                   /locus_tag="Mmc1_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(348623..349684)
FT                   /locus_tag="Mmc1_0302"
FT   CDS_pept        complement(348623..349684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0302"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase;
FT                   KEGG: bba:Bd3432 response regulator of hydrogenase 3
FT                   activity (sensor HydH)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42829"
FT                   /db_xref="GOA:A0L4D6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D6"
FT                   /protein_id="ABK42829.1"
FT                   /translation="MNGIIGSAPAMRKLFKLIERVAAADSTVLIHGESGTGKELICRAI
FT                   HNTSPRHNGPLIAVNCGAIPEDLLESELFGHAKGSFTGAVRDRPGKFVTANNGTIFLDE
FT                   IGDMSPKLQVKMLRVLQERIVEPVGALRSVEVNVRVIAATHKNLSKEVEEGRFREDLFY
FT                   RLNVVPIQVPPLRDRIEDVSSLVEHFMEKCAARSNCPPVKIGAQVMSIFQRYSWKGNVR
FT                   ELENLMERLIVLADDEVTLDDLPENMLDTSNHTEPRAQEERIPVQAFRVAYNDDDEDEG
FT                   DGEMVLDDRESVTDFNHQVEQYENQLILNALNRTGWNKNKAAQLLKLNRTTLVEKIKKK
FT                   GLEDDKQSEQRSG"
FT   gene            350214..351236
FT                   /locus_tag="Mmc1_0303"
FT   CDS_pept        350214..351236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0303"
FT                   /product="[LSU ribosomal protein L3P]-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="KEGG: tbd:Tbd_1270 modification methylase HemK;
FT                   TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42830"
FT                   /db_xref="GOA:A0L4D7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D7"
FT                   /protein_id="ABK42830.1"
FT                   /translation="MSGKYKNRANQTDGTKKRTDKGRPGAPQRGGQKNPPARTVTDPAH
FT                   SVDGWLRRSTARLKQAKLSYDNGLQEPQWEAEYLLAHAMGMDLEQLERHKTQQVGPDQA
FT                   AYMEALLQQRIEQRKPVNYITGEAWFAGHRFVVDERVLIPRSRIENVLDDPDGLLGLME
FT                   GARPLKRMLDLCTGSGCLAITAALHYPWLQVDAVDLSADALAVAAENVKRHRVTERVRL
FT                   VRSNLFEKLTGACYDLILTNPPYVPTRIYAGLAAEYHREPKMALEAGGDGLDLVIPILQ
FT                   QAAEYLEPGGILLCEVGDDTQEIMEQRWPDLPVYWLQFHFEASGVFAVTREQLLDWDGL
FT                   "
FT   gene            351233..352627
FT                   /locus_tag="Mmc1_0304"
FT   CDS_pept        351233..352627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0304"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: dar:Daro_3868 GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42831"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D8"
FT                   /protein_id="ABK42831.1"
FT                   /translation="MIFRKKKKSLSEEPVKVQYALDFLEEKHEDRDGARRVLRDWVFQE
FT                   AMGPDPLKDPAVRLLVSALVNGFKPAYLGDAEMQGRVDRVVEDLKQGKHKKESEPLLEE
FT                   LRALIAGLGKLSTRQSDRMHLAIRWLPDILQAVHTLTRGEAWAEEQSLMLIEQSGVLPP
FT                   GYWERLGSFCSEIREAGVSSFERWEESRKALVDLIAEIADRMRVMRKDASGATGRLDET
FT                   LSRIRTTTRLGDLESLRGALVTEAEALRSQTQSLATSLSESQAQLDLTRKQLQQVQDDL
FT                   KKAKEESLTDPLTQVANRRALFQSLTRETARTRRYGEPLSLIIIDLDHFKKINDTYGHP
FT                   VGDRVLKEVAGHARALLRDSDTLARYGGEEFVALLPETTLPQAMEKAEQIRLSVAAMRF
FT                   KLKGESLSISASLGVAQLDDGASQDANNEAFVHRADQALYRAKSGGRNCVIQADPTPAS
FT                   DSQATS"
FT   gene            352637..353521
FT                   /locus_tag="Mmc1_0305"
FT   CDS_pept        352637..353521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0305"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   aba:Acid345_1745 squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42832"
FT                   /db_xref="GOA:A0L4D9"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017827"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4D9"
FT                   /protein_id="ABK42832.1"
FT                   /translation="MSWFTGPTIPYHLLQDFDYCQRVVRANSENFPVGSLLAPARLRPH
FT                   IHAVYAYARMADDFADSSEGSPKEKLQKLDDWQRRLEAAQRGEADHPVFRALAYTMQQM
FT                   QLPIDPLRDLLMAFRMDITCKHYDTTQELLEYCRYSANPVGRIVLRLAGYRDETLMGYA
FT                   DAICTALQLTNHWQDLGEDPWNGRPLYLPREEMARFGVKEADILQRRFSAAAAELMMHL
FT                   IAQTRALYLQGEPLLTKVSWPLNLELGATWAGGMAVLERIEQLGGNTLRERPSLDKRAK
FT                   MGCLLRGLGRVCR"
FT   gene            353518..354384
FT                   /locus_tag="Mmc1_0306"
FT   CDS_pept        353518..354384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0306"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   dar:Daro_2706 squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42833"
FT                   /db_xref="GOA:A0L4E0"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017828"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E0"
FT                   /protein_id="ABK42833.1"
FT                   /translation="MTPDLYCQARVKRSGSSFYWPMRLLPAHKRRGLFALYAFCREVDD
FT                   IVDRQLDPRAAHMKLAWWHEEIVEVFTGQPRHPVARALHALKDQYGWQMAPFIEILQGM
FT                   EMDLQPRNYENWQELEGYCHKVSVAVGLAALPVFGVTGERAQQFAHHLGMALQLTNILR
FT                   DLFEDGQMGRVYLPQTVLQAHGVQHQGILDGEWQPALVAALQEVDARIESHFAQARELV
FT                   QGEHFAQLTAARSMGAVYHARLRRIRAAGYRVDQQPAQLSKSYKLWLCLRCWLASRVGW
FT                   LRAYDAL"
FT   gene            354371..355717
FT                   /locus_tag="Mmc1_0307"
FT   CDS_pept        354371..355717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0307"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: bxe:Bxe_B0011
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42834"
FT                   /db_xref="GOA:A0L4E1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR017830"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E1"
FT                   /protein_id="ABK42834.1"
FT                   /translation="MMPFEWEGPLDLVIIGGGLAGLACASEALRQGRRPLLVEAAPRLG
FT                   GRVASHWDRRWGCVLDNGPHLLVGAYKETLAWLAQLGVQEGLQRGTAYHFYTPQHGHHK
FT                   LSLGPGWAAWRLGRGLAQLPGLSGGELWSLRGLLPALWREHVRGAAHALTVTQWLQRAG
FT                   SPPQLFERLWEPLCLATLNEGPGSADAHLFAGVLSRLFLWNSADAQPLYPTQDLSSLLV
FT                   EPARRWIEQRGGVIRTGLRLQGLEQSQQQITALILHSATEGVTWHLPAGLPVVLAIPHW
FT                   SLASLLPQWAQQQGWTEWPAAPIVAVHLRYDGAVKQPAPMVGMPGSVSQWLCQWPMAAG
FT                   EGRISAAISAAYREVSWQSQRLIDAVHQDVVAQQPQLAGMQPQGRVIKTQRATFASWPG
FT                   VNRWRPNGRCTPWHNMYLAGDWTATGLPATIEGAVQSGRQAAQAIFTPR"
FT   gene            355731..356639
FT                   /locus_tag="Mmc1_0308"
FT   CDS_pept        355731..356639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0308"
FT                   /product="DNA uptake lipoprotein-like protein"
FT                   /note="KEGG: rru:Rru_A0941 competence lipoprotein ComL,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42835"
FT                   /db_xref="GOA:A0L4E2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E2"
FT                   /protein_id="ABK42835.1"
FT                   /translation="MRDGEKRTMKRLCMMVMLVLLLSGCSSTEEKDVQPDLAPEVMYRM
FT                   AVNHVQKKNYKSAATIFTDLDQKHPFSPWAVRAQLNLIFATYKQDEFDEAVGHAKRFIR
FT                   LHPRHPEVSYAFYMIGLAHYRQIKDPYRDQARTKEAATAFHEVINRFGESDYAWEAQKM
FT                   LDFCRNRMAQQEIVVGRYYFDRGEYIAAMKRFNEIVDNPEFRDSLQTEEALFSMVLSAL
FT                   KLGLEQEAKNYAVVLGHNYKDGRLYAVAKDILNGKGGISRSDLQSMRPEIVEDSIVAQF
FT                   LEGMQPGLPGMFGEGARGNGL"
FT   sig_peptide     355731..355817
FT                   /locus_tag="Mmc1_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.787 at
FT                   residue 29"
FT   gene            356719..357849
FT                   /locus_tag="Mmc1_0309"
FT   CDS_pept        356719..357849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0309"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: noc:Noc_1992 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42836"
FT                   /db_xref="GOA:A0L4E3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E3"
FT                   /protein_id="ABK42836.1"
FT                   /translation="MDRYISKGRIGLTWLALAWLTSAAAVGYGQEVTQPEQPPEAVLSP
FT                   PEAPLFGAQVTPGLGQVVTVKPVAALLVEQQEQAAASVVALREAWVAAQVSAPILELHA
FT                   ETGDRVAWGAVLARQDTWSQGLEHARAKAALGVLESQLLLAKQQLEQVEKLGEQEATGE
FT                   ALMGRRRGEKQVLEARIVEAKSAVEQAVKQVEKGVIHAPFSGVVLDRKAQLGGWSDVGS
FT                   PLFQLVDPVRVMLEATIPAASIKSMKMAKRWYFVHASGQVEVKLENILPRQEETTQTLR
FT                   VRFRFDRDKPLPGSSGQLVWQDEQRWIEPDLLVERNNKLGLFIVDDQQVAHFVALPHAQ
FT                   AGQRAQLLSLFTPDMPIVIMGRDQLQDGQQVVVSQE"
FT   sig_peptide     356719..356877
FT                   /locus_tag="Mmc1_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.391 at
FT                   residue 53"
FT   gene            complement(357893..360877)
FT                   /locus_tag="Mmc1_0310"
FT   CDS_pept        complement(357893..360877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0310"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; Hemerythrin HHE cation
FT                   binding domain protein; KEGG: dps:DP2258 similar to
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42837"
FT                   /db_xref="GOA:A0L4E4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E4"
FT                   /protein_id="ABK42837.1"
FT                   /translation="MCPVKPFLTYRIQHKYGRIAVWLEQSTFQPARFALVTVYHFVILR
FT                   IKLYHAQFACLLANAIGDRQPGRGTGLNPDPILWESITVNIKKTLVLTNGLLAATIALI
FT                   LGIILWTTAEQQSDSVTINMAGRQRMLSQKIAKEFGLYLANPNQTEKSLLLTSVWAFDT
FT                   TLHALLTGGQAPTKLDRNTPALVQIGHPNDEILTKLKAVQALWQPLAQQFKALESNPTD
FT                   LNGLAKLVTTQNMPLLKEMNSAVTMMQNQAEGKVSRIINTALFGALLGLVIFALALYQT
FT                   RLLSQRLKRAFGTLEHISRGSLDHQLSADDPTHEVDQIAEKINIIVNQLSTSTQLVILQ
FT                   SDSVAACANELLKLRDMLNDDSEMTSKAMAAASEKLSELEQAIVSIQDKIGDATHSIEN
FT                   IADSSTYLSSGITTMASAAEQASQNVSTMAAAAEEMTSNLSAVNSSIQNVNQATGKIGG
FT                   SLDEMISTLEDVRQRCVVASHKSQQANQHIHSTLKVMNELSNSANEIDRFVDLINNIAE
FT                   QTNMLALNASIEAAGAGESGKGFAVVANEVKELAHQTSEVTTLISGQIRIIQDHSKNAQ
FT                   QATEGVSEIVTAINQANDEITYAVDDQNHAIHEISSSFNAVVQASQEVTRNVDELYQAA
FT                   NEVSRAALDAASGTNEIALSANASADSAQKVSENAQMVHQLVQAIFTETSTTIAAAEVT
FT                   EKSIQTASQRATYISGTVHNFVILIDVLQAAMEALRAAQAVYKTGHKSFDVRTIKEGHL
FT                   AWLRELEQAVHGRSVLDAKEAANYRGCDFGLWYYGDGQQRYGNEALFVELGTVHQKVHE
FT                   AAFEVVNLVQSGSVEQAYKSMDRFKQLRKELFILLDGIYFSGLTINDQKMIDWEDALDV
FT                   GVKVLNADHLKLMNYINDLHAAMRDGKGKDKLATILAGLIEFTHTHFAREEGLMKKHGY
FT                   DRYAQQKEEHVNLIAQLGEKKKQFDEGSATVALDLLAFLQNWLIDHIKGEDMRYKTFFQ
FT                   SKGEL"
FT   gene            complement(360992..362356)
FT                   /locus_tag="Mmc1_0311"
FT   CDS_pept        complement(360992..362356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0311"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; KEGG: pfl:PFL_4014 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42838"
FT                   /db_xref="GOA:A0L4E5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E5"
FT                   /protein_id="ABK42838.1"
FT                   /translation="MSRSLYARISIPLVLILLLVMGLQWLVVHLALHGLVKEYVASRLD
FT                   HDADNLLAQLSITAQGVHLAPERLDPIFYKPWSGHYFQIEVGGQTLRSRSLWDKALVLE
FT                   KVPPGGRLLRQQRGPDQAPLLVLIRGYSKQGQSVNMALAEDFQAATQIVTTLRLFYGGL
FT                   SLAALLLLLFLVRHHLRRALMPLESAEAQLHALEHGTLQRLDPTAMPLELHPFVHQINS
FT                   LLAILMNRLQRSRQAAGDLAHAIKTPLALLNQLANDAPFTQHPNLQHALRTQITTIAHL
FT                   SERTLGLARLSGGQGHGVWLDLAHELNGLLEVMRQLHRDRGLTYHVEPLEPLKIHMDRE
FT                   DLLTLLGNLLDNASRHARHQIHFGAQTSAQVLQLWVADDGPGIPPQARERLLQRGIHGD
FT                   QPQHGHGLGLAICQQIVLDYQGTLTLNQDPQLLGLQVMLELPAQLAHLAPSTPTT"
FT   gene            complement(362353..363018)
FT                   /locus_tag="Mmc1_0312"
FT   CDS_pept        complement(362353..363018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0312"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4487 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42839"
FT                   /db_xref="GOA:A0L4E6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E6"
FT                   /protein_id="ABK42839.1"
FT                   /translation="MRILVVEDHASLAAGLKKDLGAAGFVVDWAANAEEGAFMGREEPY
FT                   DAVILDLGLPDDSGLNVLRGWRAAGVDVPVIILTAWDAWHQRVDGLQAGGDDYLGKPFH
FT                   MEELIARLNALIRRRHGVVRPALTLEGIHLDETDQQLSLANGELHTLTHTEFRLLRYLM
FT                   LHPDQLLSKSQLTEHIYAYDEDRDSNVIEVYIKRLRRLLGQQRIETRRGQGYRLRSKP"
FT   gene            complement(363021..363338)
FT                   /locus_tag="Mmc1_0313"
FT   CDS_pept        complement(363021..363338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0313"
FT                   /product="membrane protein"
FT                   /note="KEGG: mag:amb0190 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42840"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E7"
FT                   /protein_id="ABK42840.1"
FT                   /translation="MTNRLNRPIVPLLLLPLLMASPAYAGDDVDHEQAYALVQQGRILP
FT                   LAEILARHPQLAQVRLLEVELEQKHGRYLYELSFVTPSGQVLEWKLDAQSGTRLTQPRH
FT                   H"
FT   sig_peptide     complement(363261..363338)
FT                   /locus_tag="Mmc1_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(363331..363909)
FT                   /locus_tag="Mmc1_0314"
FT   CDS_pept        complement(363331..363909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO4485 diheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42841"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E8"
FT                   /protein_id="ABK42841.1"
FT                   /translation="MLNKRFIVGGLLFVTLLGGGVMLGVKTVLSDDFRRGYQEHAHEKY
FT                   EQDKEHKKNHPDRHGAALNPTYVKACGSCHFAFQPRWLTGATWQHMLDGLENHFDENAQ
FT                   LDPATTQQLRDYLSQHGAKGNRSLDPASMRITDTRFFRHAHDEIPAKLVKDNPKVGSWS
FT                   RCDLCHSDAQQGKFDEDRARIPGAEHRDD"
FT   sig_peptide     complement(363817..363909)
FT                   /locus_tag="Mmc1_0314"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.801 at
FT                   residue 31"
FT   gene            complement(363925..364296)
FT                   /locus_tag="Mmc1_0315"
FT   CDS_pept        complement(363925..364296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2021 mono-heme class I cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42842"
FT                   /db_xref="GOA:A0L4E9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4E9"
FT                   /protein_id="ABK42842.1"
FT                   /translation="MICLPHSLRYAPLLLGLLWSNGTLAAEPAANLLAGQQLWSQPGIT
FT                   KNQLQRRCATCHGTNLTQPGQHILTGKPLAPMAASVSPDRYQDMEKVTLWLNRNCQWTF
FT                   GQLCTPQQQAQLLAYLKSL"
FT   sig_peptide     complement(364216..364296)
FT                   /locus_tag="Mmc1_0315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.397 at
FT                   residue 27"
FT   gene            complement(364293..364868)
FT                   /locus_tag="Mmc1_0316"
FT   CDS_pept        complement(364293..364868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0316"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: son:SO4483 cytochrome
FT                   b, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42843"
FT                   /db_xref="GOA:A0L4F0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F0"
FT                   /protein_id="ABK42843.1"
FT                   /translation="MQTENQTLPVWDLWIRLFHASLILLVLTALLSEDEWLKIHVVAGF
FT                   GLCGLLLFRLIWGFIGSQHARFRDFIYPPKQVIAYLRTLYQGNPPHHLGHNPAGGMMVL
FT                   LLLITLTLLGLSGLLTLGASQETGLLHNMAAALPPSTVKPIESLHEGLGELLWALIALH
FT                   LGGVLLGMWQHKENLIKSMIHGNKQARS"
FT   gene            365328..371249
FT                   /locus_tag="Mmc1_0317"
FT   CDS_pept        365328..371249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0317"
FT                   /product="superfamily I DNA and RNA helicase and helicase
FT                   subunit"
FT                   /note="KEGG: hch:HCH_03218 superfamily I DNA and RNA
FT                   helicase and helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42844"
FT                   /db_xref="GOA:A0L4F1"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR021754"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR026851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F1"
FT                   /protein_id="ABK42844.1"
FT                   /translation="MDTLILHVSVQEKINFATQQNAVPILRELSIENIGQESVANLRLT
FT                   LTSNPVFLVRKTWHLDQLEPGLRLTVSDRDIRLDAGLLMSLHESLRGDLRVELYQDDLL
FT                   LVEKNIEVELLARHQWGGSQFMPEMLAAFIEPNDTFIAEILRSASSLLQKNGLESGLDG
FT                   YQKDSSVRVGEVVSAIWSAIAALGITYAEPPASFEQNGQKIRLPSIIKQTGLATCLDLA
FT                   LLFASAMEQAGLNSLIIITQDHAFPGVWLKPQTFPTVLIKTALDIRKRFDLQELLVFES
FT                   TFATSRTNPVPFHKAVKKGRAQLEEHGQFYMAIDVQRARMYQIRPLYWEDQCASKDQLN
FT                   VEQVSSMGVDLLEFSDQGVIPEQESLKPTTASGRLELWQKKLLDLSLRNKLLNFKLNGS
FT                   SALVLICPDPGLLEDKLAQKMKLSIESLPEMGSSNNGRDAQLHTQRTGGGLIEEFVTKA
FT                   LEKNQLYVQEEKEALDKRLTSLFRRSKADLDEGGANTLYLALGFLIWWRSNDPNKKYYA
FT                   PLILIPVTLERKSIQSGVRMVLHEDEPRFNTTLLQMLRQDFRLEIPGLEGELPTDTHGV
FT                   DVHGIWHKVRHHVRDVEGFEVVEEVALSNFSFAKYLMWKDLVDRTEQLKENRVVRHLLE
FT                   TPQQSYASDISFREPRNLDNEVKPQDLLTPLPADSSQQTAVMASGEGKDFIVIGPPGTG
FT                   KSQTIANMIAHNLGLGRTVLFVSEKAAALNVVYRRLKEQGLGEFCLELHSNKARKLEVL
FT                   NQFDQAWRSKSSFSQVEWQREANRLKETRDGLNRYVQAMHQPSRHGMTPYQAIGKIALG
FT                   DTVVQLELSFAHADIHDHADYVALTELCHKMDLYSKDLGSVVAHELAFVTHDDWTPQWV
FT                   KDLLASAHLLKEQADRFQQSIKDLYLLFGYPDHSITILEPLLALIGTMQDLYEQDASFL
FT                   FEPNTTQIVQQLDVGMRCVQEFTDEQDQLSCCYQLEGLLALDIDALTKQWQESQQAWWL
FT                   RGWFIKRRVNKALKYMGGAVGQPQPHRDLPRIKQMKKKYQQLQELDAVNTCVRHWRGLE
FT                   SDLAVIQRLVKGGQQVKARIQEIAPTPTEFVTLQTVVQRWLIESNTLLAPNGTLLTLSA
FT                   RVKEQRQQLMETYNRVISLTGGEVDEFLPLGVLFGRAQTYAATLIQNESKLNTWCRWQA
FT                   VRKEACAQGLRPLVEAMEKGLCKTGKAEQVFEINYARWWIHLVFAKEPDLRQFSAVEHE
FT                   DKIRIFRMLDERFSELTREYICAKQGANIPDQSGVTQSSEYGVLKRELHKKIRHKPVRQ
FT                   LFREIPNVVKQLTPCLLMSPLSIAQYLPTEKENFDLVIFDEASQITVWDAIGSLARGKQ
FT                   VVIAGDPKQLPPTSFFGRREAEDEGDDTGDVTDLESILDEMMGCSIPQIHLNWHYRSAH
FT                   ESLIAFSNQRYYMNKLITFPSAVTVDRALRLVTVEGYYDRGGARHNRAEAEAIVTEVVR
FT                   RLNDPNFAGAGKSIGVVTFNSEQQRLIEDLLDRARRDDPALEPYFADEQLEPVIVKNLE
FT                   SVQGDERDLILFSVTYGPDRAGHMTMNFGPLNKQGGERRLNVAITRARSELIVFSTLKP
FT                   EQMDLSRTQANGVVDLKDFLRYADRGKMALDEVSHGSIGGYDSPFEEAVSEALTRKGWR
FT                   VHSQIGVSAFRIDLGIVHPQREGHYFVGVECDGATYHSSATARDRDKVREAILERLGWR
FT                   LVRVWSLDWWVNPKDTLEKLDQRIQAILAEVDIQIAREEEIRKTAEEAFYQAKQAATAA
FT                   LFEENGAKLKAESATIGELSQTSTTDAKVLQVRSMQADKEDRSYYRIATFEKLNLKLNP
FT                   DLFYEYSYTPTVRMMVEHILEIESPIREDLLIRRIAQAHGFKRSGRLIVERVMQIVEET
FT                   AEVTHEEGVGNFLWKRGVDLSSWSEIRYPQQGEREARRPDEIAIQELMTLAKEHQGEGA
FT                   LIDTMARSLGVFRLNERNRTRLQLAAQMATKSAPVEPAVL"
FT   gene            complement(371461..371931)
FT                   /locus_tag="Mmc1_0318"
FT   CDS_pept        complement(371461..371931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0318"
FT                   /product="transposase IS66"
FT                   /note="KEGG: mta:Moth_2336 transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42845"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F2"
FT                   /protein_id="ABK42845.1"
FT                   /translation="MEKDLREEEATPERRYKVRQERSRPIIDELKTWLEDNRAGVLPKS
FT                   KLGEAMGYLTNQWSSLIRYLDDGRLEIDNNRAENAIRPFVIGRKNWLFSNSVRGAKASA
FT                   NLYSLIETAKANGWEPFVYLTKVFEGLATAQTVDEFDLLLPWNLKSAAEPAG"
FT   gene            372074..372415
FT                   /locus_tag="Mmc1_0319"
FT   CDS_pept        372074..372415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42846"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F3"
FT                   /protein_id="ABK42846.1"
FT                   /translation="MEDKSIEASVLSEKQRYWLDHLRSCRSEVGTIKEYAEVHKLSLPS
FT                   LYFWKRKLTQMGFLEESGSGKRRFQRLELSSKSSAGVCRIQFPNGMTVEWSGNGGESLL
FT                   SVLRSVAAL"
FT   gene            372415..372774
FT                   /locus_tag="Mmc1_0320"
FT   CDS_pept        372415..372774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0320"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: rme:Rmet_1275
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42847"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F4"
FT                   /protein_id="ABK42847.1"
FT                   /translation="MMRPSPDISVVHLCLEPVDFRKGINGLAALVEAELELNPFDEALF
FT                   VFRNRSLDKVKILYWERNGFCLWQKRLEKDRFHWLRQGGAAEIQITGRQLNWLLDGYNL
FT                   AAMKGHNKLHFSSIV"
FT   gene            372810..374390
FT                   /locus_tag="Mmc1_0321"
FT   CDS_pept        372810..374390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0321"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: ppu:PP3985 ISPpu13,
FT                   transposase Orf2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42848"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F5"
FT                   /protein_id="ABK42848.1"
FT                   /translation="MKTLPKTLPDDPAALREIILSLQAENVLLQDKSKRMEHEAQLLRE
FT                   KLNILIAKRFGRSSEKSDPRQLGLFDEAEVTAAEEPEEDAEEIQVPAHSRKVKSKGRKP
FT                   LPEWLPRVDIIHELPESALVCGLDGHHLVEIGRETSEQLDIIPAKVQVLRHIQIKYGCP
FT                   HCKQGVKTAPTPKRPIPKALATAALLAHVAVSKYADGLPLYRQGAILTRAGIDVCRTTL
FT                   ANWMIQCGQLVQPLINLMRDKMLDYDILQMDETTIQVLKEKDKVAASNSYMWVQRGGPP
FT                   GSPVILFDYDPTRGAEVPKRLLAGYKGWLQTDGYAGYLGVGAQEDVILMGCFAHARRQF
FT                   DEAIKALGKSKKGKIGKAGQALSLIRKLYAVEKDLREEEATPERRYKVRQERSRPIIDE
FT                   LKTWLEDNRAGVLPKSKLGEAMGYLTNQWSSLIRYLDDGRLEIDNNRAENAIRPFVIGR
FT                   KNWLFSNSVRGAKASANLYSLIETAKANGWEPFVYLTKVFEGLATAQTVDEFDLLLPWN
FT                   LKSAAEPAG"
FT   gene            complement(374290..375474)
FT                   /locus_tag="Mmc1_0322"
FT   CDS_pept        complement(374290..375474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0322"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: ppu:PP3985 ISPpu13,
FT                   transposase Orf2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42849"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F6"
FT                   /protein_id="ABK42849.1"
FT                   /translation="MKTLPKTLPDDPAALREIILSLQAENVLLQDKSKRMEHEAQLLRE
FT                   KLNILIAKRFGRSSEKSDPRQLGLFDEAEVTAAEEPEEDAEEIQVPAHSRKVKSKGRKP
FT                   LPEWLPRVDIIHELPESALVCGLDGHHLVEIGRETSEQLDIIPAKVQVLRHIQIKYGCP
FT                   HCKQGVKTAPTPKRPIPKALATAALLAHVAVSKYADGLPLYRQGAILTRAGIDVCRTTL
FT                   ANWMIQCGQLVQPLINLMRDKMLDYDILQMDETTIQVLKEKDKVAASNSYMWVQRGGPP
FT                   GSPVILFDYDPTRGAEVPKRLLAGYKGWLQTDGYAGYLGVGAQEDVILMGCFAHARRQF
FT                   DEAIKALGKSKKGVSAHLSPSTTLPVQQQISNSTGATSRTHPRFALWRGPQRPL"
FT   gene            complement(375510..375869)
FT                   /locus_tag="Mmc1_0323"
FT   CDS_pept        complement(375510..375869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0323"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: rme:Rmet_1275
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42850"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F4"
FT                   /protein_id="ABK42850.1"
FT                   /translation="MMRPSPDISVVHLCLEPVDFRKGINGLAALVEAELELNPFDEALF
FT                   VFRNRSLDKVKILYWERNGFCLWQKRLEKDRFHWLRQGGAAEIQITGRQLNWLLDGYNL
FT                   AAMKGHNKLHFSSIV"
FT   gene            complement(375869..376210)
FT                   /locus_tag="Mmc1_0324"
FT   CDS_pept        complement(375869..376210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42851"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F3"
FT                   /protein_id="ABK42851.1"
FT                   /translation="MEDKSIEASVLSEKQRYWLDHLRSCRSEVGTIKEYAEVHKLSLPS
FT                   LYFWKRKLTQMGFLEESGSGKRRFQRLELSSKSSAGVCRIQFPNGMTVEWSGNGGESLL
FT                   SVLRSVAAL"
FT   gene            376296..376529
FT                   /pseudo
FT                   /locus_tag="Mmc1_0325"
FT   gene            complement(376826..378067)
FT                   /locus_tag="Mmc1_0326"
FT   CDS_pept        complement(376826..378067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42852"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F9"
FT                   /protein_id="ABK42852.1"
FT                   /translation="MARDNFTQKQLDNIKSQLAKTLGDQSSTALENLDNRFTAREEEVI
FT                   IEANPDVMDDHSATGGFKPGAKIDVDEVIAEGKLGPMLGTLGPLVKIEEKKADLRRMVE
FT                   AIINHPEIKAFNLVEALTRVRKNSEMVGLLVDQVVARKGINPLIDSLKVSGINKPAMQK
FT                   LAAGIAEMGTINHLLRAIASCPKNQEEVEITLTMEVIGKGALEQMLEAIKLIDPMSPGA
FT                   VVLATGVANVKNLPVEPCVRALTAVKDNEGGAQILAKRLVEMVEVPALVSLLEKYVSET
FT                   TPAAHVVVTQLIHKVMIQPSRNKELIKATKAVRGDSMPAQMLATAIVKFCDKDDWERTF
FT                   LRVAGHNSKVILACAYGKQGGMFGTIRKLGKAGYDMSKNAAEANKLMKEAWDRCTEVAR
FT                   DVLQVELGKSSDDE"
FT   gene            378341..378982
FT                   /locus_tag="Mmc1_0327"
FT   CDS_pept        378341..378982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0327"
FT                   /product="3'-5' exonuclease"
FT                   /note="PFAM: 3'-5' exonuclease; KEGG: rbe:RBE_0748
FT                   ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42853"
FT                   /db_xref="GOA:A0L4G0"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G0"
FT                   /protein_id="ABK42853.1"
FT                   /translation="MGTAPLTIHTFIDDLDEAQFQRYMKSPFLAVDTETMGLDINRDRL
FT                   CVVQMCDVTGEVSVVQIRNYQAPRLKALMEAPEVEKIFHFARFDLATMKRWLDIEIKPV
FT                   FCTKIASKLVRTYTGSHGLKDVSQELLGVVMDKQQQSSDWGAEQLTPEQLQYAASDVIH
FT                   LVEIRARLVEMLAREGRLQLADEIMRFLPTRVALDLLGWNNHDIFSHASI"
FT   gene            378995..379738
FT                   /locus_tag="Mmc1_0328"
FT   CDS_pept        378995..379738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0328"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rsp:RSP_1075 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42854"
FT                   /db_xref="GOA:A0L4G1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G1"
FT                   /protein_id="ABK42854.1"
FT                   /translation="MDTTGCRALVTGAGRRIGAAIALALGEAGMDVAVHYSGSAQGAEQ
FT                   SCAALAKMGRRACAFQADLSDWAQAEALLPRVVAQMGPVRVLVNSAAIFERSDLVDQSQ
FT                   AQWRRHMAINLEAPMLLMQHFARQWQSDQPPDGAGRIVNILDRRVLAPPPGHLAYNAAK
FT                   GALWSLTRVAARELAPHITVNGVGPGPILPAAGEPLEQFAKVIAATPMQRSGTPQEVAD
FT                   AVLYFIQNGFVTGQMICIDGGEHLL"
FT   gene            379735..380115
FT                   /locus_tag="Mmc1_0329"
FT   CDS_pept        379735..380115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0329"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   mca:MCA2988 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42855"
FT                   /db_xref="GOA:A0L4G2"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G2"
FT                   /protein_id="ABK42855.1"
FT                   /translation="MTMHNQPPLDRIHIKDLLLRCIIGILEWERTTLQDVVINCTLHVD
FT                   LRSAGLSDDIADTVNYKALNKNIIQLVEGSAFFLVEAMAEAIAELCLQDRRVKQCEVTV
FT                   EKPGALRFARSVGVTVVRGQHG"
FT   gene            380144..380692
FT                   /locus_tag="Mmc1_0330"
FT   CDS_pept        380144..380692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0330"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK;
FT                   KEGG: cyb:CYB_2920
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42856"
FT                   /db_xref="GOA:A0L4G3"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G3"
FT                   /protein_id="ABK42856.1"
FT                   /translation="MVPCDGPVLVAFGASLNPLYHLELGLRRLHALLGIVAISDVYQSR
FT                   PVNGAVGDPPFLNGAVRLEQAPEPWALRALLRQIEAEQGRERGDNPNAPRTLDLDIALM
FT                   GSQIMDEPLLRIPDPHWLARPFVALPMAQLAAAWRHPEHPYSLAQLAARFDPLPVGMHK
FT                   DLEATRRLRQILPPFPNTV"
FT   gene            380721..383252
FT                   /locus_tag="Mmc1_0331"
FT   CDS_pept        380721..383252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0331"
FT                   /product="amino acid-binding domain sensor hybrid histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: extracellular
FT                   solute-binding protein, family 3; response regulator
FT                   receiver; ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: mag:amb1110 signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42857"
FT                   /db_xref="GOA:A0L4G4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G4"
FT                   /protein_id="ABK42857.1"
FT                   /translation="MGYDAKLPWGWAPLLVCLVVLAWPAQLLANRVPDPIIVGVYQNKP
FT                   MIFLDEKGEVQGLYKDILGIIAERHGWQLEYRYGKWSALLEQLQRGEIDLLGAIAYSDE
FT                   RALSMDFGKQSFFVNWGQVYTREERKVASFLDLQGKRVGVLKGDIYGHRLAELVKKFGV
FT                   SIEIVGYDSYSYVLHGIKQGEVDAGVVNRLTGGAEQQRFGLYGTPILFNPVEVTVAVPK
FT                   GKNMALLSAIEHDLVVMKADKDSAFHKAFDRWLGIASKPEMPSWYRTGFWIIMVLMLLG
FT                   VGWNLSLQRRVVLQAKRLEQEVAERQDAEQGLQHAHQELEQRVDERTQALEVSELRFRT
FT                   LFHAALVPLFRSSLDGGRVLLANLALVELFGYSSVEEMVTLHDPLKSYADPLMREHFID
FT                   ILVRDGRVECLDVELVRPDSSRFYAEISAIHYPEGGYLEGAIIDITHRKRTEHALIQAK
FT                   QSAERANRAKSEFLATLSHEIRTPLNGMIGLLTALQASRLDAKQQEQVGLISRSSNLLL
FT                   DLLNDILDFSKIEAGELVLEQIPFSPLQLVEDVCACLSERAQGKGVGLRLETHGWIPPG
FT                   LKGDAVRIRQIMLNLTNNAIKFTQQGEVVLHLWGLEQQPVPLPSWVSMRFGVVDSGVGI
FT                   AAKDMGRIFDPFCQADRVLDRRYKGTGLGLSICKRLVEAMGGEIWAESQEGQGSSFRFT
FT                   LTLALVEHLPGQAMGRELVHEVLPMRILLVEDDPVNQMVAVELLESAGHKVEVADNGAS
FT                   GLVKAQECSYDLVLMDIRMPGMDGITATRMLRAFEQAEGRERVPVLGLTADTLKETLLA
FT                   CREAGMDDVLTKPVRVNVLTDRVARLGFENP"
FT   gene            complement(383425..384834)
FT                   /locus_tag="Mmc1_0332"
FT   CDS_pept        complement(383425..384834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0332"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: gox:GOX0044
FT                   phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42858"
FT                   /db_xref="GOA:A0L4G5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G5"
FT                   /protein_id="ABK42858.1"
FT                   /translation="MTFAPSHMFREYDVRGIAHSELSEEVVKHWGALFAERIRDAYKGK
FT                   KFMPHVVVGRDGRLSSPALANALMAGLAEAGARVSDVGLLPTPGLYYASHALHADGAIM
FT                   VTGSHNPAEYNGMKMMLGGLSFFGQDIQDLAQRLMLGERPMPRMGGSVSRVELRRDYIN
FT                   RLVADYRPGRPLKVVLDCGNGAAGAVAKELLQALPGIEGEVLFAEVDGTFPNHHPDPTV
FT                   PANLEDLKNRVLAWGADLGIAFDGDGDRIGAIDGDGRVIWGDRLMILFAREILAEHPGA
FT                   SILGDVKCSQQLFDAVAEAGGKPIMWKTGHSLVKSKMRQSGALLAGEMSGHLFFADRYY
FT                   GYDDALYAAVRLISLLAAEPTSLAARLSSLPKVYATPELRIECADSRKFRVMDRIKRQV
FT                   LDGGLGEVSDLDGVRVKQPGGWWLVRVSNTQPALVARVEADSLERLQEMATALAKMLEG
FT                   ENVVFPEWQLV"
FT   gene            complement(384839..386155)
FT                   /locus_tag="Mmc1_0333"
FT   CDS_pept        complement(384839..386155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0333"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   rru:Rru_A2116 UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42859"
FT                   /db_xref="GOA:A0L4G6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G6"
FT                   /protein_id="ABK42859.1"
FT                   /translation="MRITMIGTGYVGLVSGACFSEFGVDVTCVDKDVSKIERLNKGEIP
FT                   IFEPGLDQLVVRNKDAGRLHFTTDTNTAVANSDVVFIAVGTPERRGDGAADLRYVFDAA
FT                   RDVARAMQGFTVVVTKSTVPVGTGARVAEIIRETKPDADFAMASNPEFLREGSAIEDFM
FT                   RPDRVVVGVDSDRPVALLKELYRPLYLIETPILFTNIATAELTKYAGNAFLATKIMFIN
FT                   QIANLCEKVGADVHDVAKGMGLDRRIGRKFLHPGPGYGGSCFPKDTAALANTARDHNTP
FT                   MTIVENVIEANKWQKQRMITKIRDAMQGKLRGKTIGVLGLTFKPNTDDMRDSSSLTILP
FT                   ALAGDGARIQAFDPEGMHEAKRMMPELHYCDDAYSACQGADAVVILTEWNQFRNLDLDR
FT                   IKAGMQTDSEGLYPFFDLRNIYVPADMRAQGFAYVGVGR"
FT   gene            complement(386473..387144)
FT                   /locus_tag="Mmc1_0334"
FT   CDS_pept        complement(386473..387144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0334"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: mca:MCA1151
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42860"
FT                   /db_xref="GOA:A0L4G7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G7"
FT                   /protein_id="ABK42860.1"
FT                   /translation="MASLTAMSTSKPAPASHWIQYGCGLDAPAGWLNFDASPTLRLQRL
FT                   ALIGALFQYRTPFPPTVRYGDIVRGLPVADACAEGLYCSHVLEHLSADDVATALRHSYQ
FT                   ILRPGGTFRLVLPDLAHMVRGYLQATDAMACQQFMRDSGVLINKRSHGLKSFLITWFGN
FT                   STHLSLWDYAGMAHMLEQAGFMEIRPARCGDSGLTQFNQVENPNRWENALGIACRRPTH
FT                   R"
FT   gene            complement(387132..388013)
FT                   /locus_tag="Mmc1_0335"
FT   CDS_pept        complement(387132..388013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0335"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   dps:DPPB68 probable UTP-glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42861"
FT                   /db_xref="GOA:A0L4G8"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G8"
FT                   /protein_id="ABK42861.1"
FT                   /translation="MMKVRKAVFPVAGLGTRFLPATKVVPKEMLSVVDTPLIQYAVEEA
FT                   WDAGIEEVILITGRGKSLLMDQFDHMYELEDTLRRQGKEVLLSVSHEPIPFPGTVVATR
FT                   QQDPLGLGHAVWCARYLVGDEPFAVILPDDLVHAQKPVLKQMVERFEELQSSIVAVMEV
FT                   APDQTNKYGILDSEPEQNGVWRIKGLVEKPDPSVSPSNLAIIGRYILTPEIFCLLESIP
FT                   RGAGGEIQLTDAMAALLKHQSIYGMRFEGTRFDCGDKAGFQMASLALSMERPELKDQML
FT                   AFIQENLPKWQA"
FT   gene            complement(388146..388535)
FT                   /locus_tag="Mmc1_0336"
FT   CDS_pept        complement(388146..388535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0336"
FT                   /product="conserved hypothetical protein-transmembrane
FT                   region and signal peptide prediction"
FT                   /note="KEGG: rba:RB11276 hypothetical protein-transmembrane
FT                   region and signal peptide prediction"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42862"
FT                   /db_xref="GOA:A0L4G9"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4G9"
FT                   /protein_id="ABK42862.1"
FT                   /translation="MANKVGMRSLLAGAALALGLMSGSAVASEMQEMTFKEDVYPIITY
FT                   RCLECHVQGGPGMVYSGLDLQSYEGLMRGTKHGPVVVAGKPMLSNLLVLVSGKAGIRMP
FT                   HNRRRLTKCEIDIISKWIQQGAKNN"
FT   sig_peptide     complement(388452..388535)
FT                   /locus_tag="Mmc1_0336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.756 at
FT                   residue 28"
FT   gene            389056..390300
FT                   /locus_tag="Mmc1_0337"
FT   CDS_pept        389056..390300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0337"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: pca:Pcar_2240 tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42863"
FT                   /db_xref="GOA:A0L4H0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H0"
FT                   /protein_id="ABK42863.1"
FT                   /translation="MSKGYFGAFGGAYIPEILHETFAQLTLAYETARADEAFWRHYIEL
FT                   MRNYSGRPTPLTFAENLSLAHGKRRIYIKREDLNQTGAHKANNVMGQGLLVRRMGKTRV
FT                   IAETGAGQHGVATATMAARLGLACTIYMGAKDVARQRPNVFWMEQLGATVIPVTSGSQT
FT                   LKDAVNEAMRDWVGSMDNTHYVLGTACGAHPFPEMVSWFQSVIGQEARVQILEQEGRLP
FT                   DHVYACVGGGSNAMGIFQGFLEDPQVELIGVEAGGLGLAGHNHASRIASGKSTVGIAQG
FT                   YKTCFLQDEDGQMRDTHSVAAGLDYVGVSPILADLHQQGRVRFEAATDVEVVEALKRMV
FT                   KSEGIIPALESSHAVAGALRELPQLKEDAVVIINLSGRGDKDIFTIAEALGDAKWKTYI
FT                   QERAAIYAAEQGERS"
FT   gene            390297..391076
FT                   /locus_tag="Mmc1_0338"
FT   CDS_pept        390297..391076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0338"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: pca:Pcar_2241 related to tryptophan synthase,
FT                   alpha subunit; TIGRFAM: tryptophan synthase, alpha subunit;
FT                   PFAM: tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42864"
FT                   /db_xref="GOA:A0L4H1"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H1"
FT                   /protein_id="ABK42864.1"
FT                   /translation="MSRKSALEGHIKDKLQQQDILLMSHIVLGYPSLQANREVIRAMVA
FT                   GGVDLMELQIPFSEPIADGPTIARANQAALDGGFKVREGLAFIREVVAAFNIPFLIMTY
FT                   TNILMAYGVERFIDEVADIGVKGLIIPDLPLEQAQAAIEQCRAKGMDWIGLMTPTSVDE
FT                   RLGKIGAAADGFVYCVARRGVTGSKTSFDEHVGAFMHRCRQATPVPLAVGFGVRSAEDV
FT                   DYLKGKAEIAVVGSAALDLFDQAGAAALEPFFRGLRG"
FT   gene            complement(391210..392286)
FT                   /locus_tag="Mmc1_0339"
FT   CDS_pept        complement(391210..392286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42865"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H2"
FT                   /protein_id="ABK42865.1"
FT                   /translation="MVKGNKIFMLVGVLWMLGIPPVQAQRPDHSSELIFKDDFERTELS
FT                   GDDQQWYMTRMSGVGCGRVNPASRPVQEQGQAILQPPVQIRDGQLLLSEASSGAPVQAY
FT                   RVINRPVRRIGFEFTPLNVMGGMDDRAWVGARIQFMDRNNGLLGELWYYFYNRHYERPS
FT                   NTSTRYAVAVKGAFDGVKRRLSIEVEELIRRYLKGVDPDQIARTLVIFELGAGWCGSEV
FT                   AGTFDNVEVFAGRSEEYTLTQQEVLAIGRSVMPSFLRDHAYFPENWIRRVRAKYQAKRV
FT                   DRWLDAIERHMQAHPTGFVPLVERMTGVSDNQIPQTAFAVRVMVDNRKLPGLDDPVQGP
FT                   MTRIEEGEPTTIDLNAER"
FT   sig_peptide     complement(392212..392286)
FT                   /locus_tag="Mmc1_0339"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(392443..393855)
FT                   /locus_tag="Mmc1_0340"
FT   CDS_pept        complement(392443..393855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0340"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; SMART: AAA ATPase; KEGG: vpa:VP2099 LuxO
FT                   repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42866"
FT                   /db_xref="GOA:A0L4H3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H3"
FT                   /protein_id="ABK42866.1"
FT                   /translation="MMKARDLHSLLLVEDSPSMAMVYQEYIKGEPQWQVSHCKEGHAAL
FT                   VYLHQHTPDLVLLDLQLPDMHGLEILKAIHEQQLPTQVVIITAHGSVDTAVEATRLGAF
FT                   DYLEKPFSANRLLVTMGNALRQKNLSLEVQAYRDSFDRDHYHGFIGASPTMQALYQTIE
FT                   SAAPSSATIFITGESGTGKEVCAEAIHKASTRRNRPFIPVNCAAIPKDLMESELFGHVK
FT                   GSFTGALSDRQGAAQRAHHGTLFLDEIGELPLDLQSKLLRFLQTGQVQKVGAQKGEVVD
FT                   VRILCATNRDPWEEVQEGRFREDLYYRLNVIPLHLPPLRKRDQDVLLLAHHLLQQYSRE
FT                   EKKGFTRFSGEAEQLILGHRWPGNVRELQNVIRHAVVLNDGTLLEAAMLPPPVGGSMGR
FT                   HMTVPPQNKMLLQEGATDDEILPLWVEEKRIIERALKQCGDNIPQAAARLQINPSTIYR
FT                   KKQLWKSREEEA"
FT   gene            394483..396081
FT                   /locus_tag="Mmc1_0341"
FT   CDS_pept        394483..396081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0341"
FT                   /product="phosphatidylethanolamine:Kdo2-lipid A
FT                   phosphoethanolamine transferase"
FT                   /note="PFAM: sulfatase; protein of unknown function
FT                   DUF1705; KEGG: pcr:Pcryo_1245 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42867"
FT                   /db_xref="GOA:A0L4H4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H4"
FT                   /protein_id="ABK42867.1"
FT                   /translation="MPNLQISRPYLILLVALFICLTGNYTFFSGVLQVYPWQQHAGFFV
FT                   SLVVAYSAFLVLLFSLLSLLFGQRSVAIFMLILSAFIGYFSDNFGVIIDRDMLQNTLET
FT                   NLSEASDLMSLGLMVRVLLLGLLPALLVGRLSLPRLGWLRGLSQTGKTMGVALLVMVAA
FT                   LAPFNAQYFSAGREHKSLRYHANPAYPIYSVGHYIKKKYQAGKPPYTTVTTYARQAADD
FT                   TSRELVIMVVGEAVRADHFSLNGYARQTNPTLAKEPRVVNFSQVSSCGTATAISVPCMF
FT                   SFHGRSTYKGSTAPYTENVLDVLAKAGVHVLWLDNNSSSKGVADRVAYQDFRTSANNPI
FT                   CDAVECRDIGMLKNLQRYIDDHKQGDILIVLHQMGNHGPAYFKRYPPEFEKFKPACQTI
FT                   ELAQCTKQEISNAYDNAILYTDFFLGKVIELLKSNTPNFETLMVYMSDHGESLGENGIY
FT                   LHGLPYFMAPASQTHVPAVIWNGPNSDLDHQELLANKDKPNSHDGLAPLLLKVFEVDAD
FT                   LQGDLVHAPFGSAQP"
FT   gene            396405..397034
FT                   /locus_tag="Mmc1_0342"
FT   CDS_pept        396405..397034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42868"
FT                   /db_xref="GOA:A0L4H5"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H5"
FT                   /protein_id="ABK42868.1"
FT                   /translation="MAAKGWRYPFFWMRTMFRFRLIRPMLQGGHPPEYAARASGIGLAI
FT                   AMTPTVGVQIAAVMALWAWIKARKPDWDFNPMVAIAWTMVTNVVTLPPIYFMFVVTGRL
FT                   MMGHWDGLSGYDEYTARIAQVLAPDAGWLESIWIQLHELFTTFGLPLLLGCLPWALICG
FT                   WAGYFFTLRLVRKYQALREKRRIKNYVGLYKESHPYTSSNHAGPQK"
FT   gene            complement(397061..397525)
FT                   /locus_tag="Mmc1_0343"
FT   CDS_pept        complement(397061..397525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvu:DVU1136 host-nuclease inhibitor protein
FT                   Gam, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42869"
FT                   /db_xref="GOA:A0L4H6"
FT                   /db_xref="InterPro:IPR009951"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H6"
FT                   /protein_id="ABK42869.1"
FT                   /translation="MQKTVASLDDANAALAQIANLLAQQSELASKRDQAVEQLQQRYQE
FT                   PLAKIAEQLNQLQQQLTQFAQVTPELFIKKRTLSLPQGQIGKRRQSRIIPTASQTETEI
FT                   CDAIEAQGWHEALRLQRQLNRAALRSWSAQRLAQVGLQRCVNEQVWVEPK"
FT   gene            397822..398307
FT                   /locus_tag="Mmc1_0344"
FT   CDS_pept        397822..398307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0344"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42870"
FT                   /db_xref="GOA:A0L4H7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H7"
FT                   /protein_id="ABK42870.1"
FT                   /translation="MVGQKEKRQMDRGLIERLRKAAERAGGPDAIALKVDVSRRTWGNY
FT                   LQGATEPTASTIKDIAKVSGLDPAWILTGVGPMERRSGDSYLDSLDEDLLFSVIYEVEH
FT                   FLLGEGITIGNAKDKVQLIKAVYELVQREQAHQPDKPTTAGNVIQLPHVQALMRLAG"
FT   gene            398658..399041
FT                   /locus_tag="Mmc1_0345"
FT   CDS_pept        398658..399041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42871"
FT                   /db_xref="GOA:A0L4H8"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H8"
FT                   /protein_id="ABK42871.1"
FT                   /translation="MSHSANQAEQTIQKLLSKHRSASKTDALPVKRVEDGWNSRQKKGL
FT                   IGTLCGLILLLGSGWFWYMHQPISPYQELLLKALIKEYAVQQSIGHQKVWVDLKRRWGF
FT                   YRVQDIDRQQFHEMTQYLSQPIR"
FT   gene            complement(399227..400585)
FT                   /locus_tag="Mmc1_0346"
FT   CDS_pept        complement(399227..400585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0346"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: tbd:Tbd_1773 tryptophan synthase beta
FT                   chain-like protein; TIGRFAM: pyridoxal-phosphate dependent
FT                   TrpB-like enzyme; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42872"
FT                   /db_xref="GOA:A0L4H9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4H9"
FT                   /protein_id="ABK42872.1"
FT                   /translation="MQTKILLDESEMPTQWYNVTADMPNRPPPPLGPDGKPVTPEMMGM
FT                   IFPPDILQQEMSTERWIDIPDEVRQILSLWRPSPLYRAHRLEQALATPAKIYYKYEGVS
FT                   PAGSHKPNSAVPQAYYNKKAGIKRLTTETGAGQWGSSIAFAGQMFGLEVEVYMVKVSYH
FT                   QKPFRRSMMETWGAQVFASPSDRTASGRKILAQDPDSPGSLGIAISEAVELAMQDPHTN
FT                   YSLGSVLNHVCLHQTIIGLEAKKQFAKAGDYPDVVIGCCGGGSNFAGTAFPFLADKAAG
FT                   KALRLLAMEPSSCPTLTRGHFAYDYGDVAGLTPMMMQYTLGHDFTPPGIHAGGLRYHGD
FT                   SSQLSQLVHDKIIEARSVNQLDTFRAGVTFAQAEGIIPAPESNHAIRGAIEEALRCKEE
FT                   GKQETIFFTLSGHGHFDMTSYDRFFAGELEDYPYPQSAIEAALKHLPDPTKMG"
FT   gene            400801..401589
FT                   /locus_tag="Mmc1_0347"
FT   CDS_pept        400801..401589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0347"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: pae:PA1166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42873"
FT                   /db_xref="GOA:A0L4I0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I0"
FT                   /protein_id="ABK42873.1"
FT                   /translation="MRTYAKWMGVALALLWSVPAWAVVQEQEVPYKDGDTGLAGYLVWD
FT                   DAFSGKRPGVLVVHEWWGLNSYAKSRARQLARMGYIAFAADMYGEGHVTEHAKEAKGWM
FT                   QQVTANVEGWRRRADLALEQLKAAPQVDTTRLAAVGYCFGGGTVMQMAYGGSDLLGVAS
FT                   FHGPLPPAEKKDYAKIKAKIFVAHGDADTFVPLERLEAFRIGLNEAGADWQLLRYGGAV
FT                   HSFTNPAADGSWMPTVKYDAKADHRSWAAFTHFLDELFWP"
FT   sig_peptide     400801..400869
FT                   /locus_tag="Mmc1_0347"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.764 at
FT                   residue 23"
FT   gene            complement(401760..402374)
FT                   /locus_tag="Mmc1_0348"
FT   CDS_pept        complement(401760..402374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0348"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   reu:Reut_A2357 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42874"
FT                   /db_xref="GOA:A0L4I1"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I1"
FT                   /protein_id="ABK42874.1"
FT                   /translation="MTRPMKPLFILALLGLLCAVPPPAAADIYAFIDADGVIHLSNRAN
FT                   DPRYRRLMRINSQGRRLALPQYASVPSRGGDAKRYEQTIHNIAKRFDLDAGLVKAVIQA
FT                   ESGFDPNVVSHKGAVGLMQLMPQTARIYGVSDRTDPHENILAGSQHLRYLLDKYKNNIK
FT                   LTLAAYNAGEGAVERYGNRIPPFRETQNYVRKVLAFYREFR"
FT   sig_peptide     complement(402294..402374)
FT                   /locus_tag="Mmc1_0348"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 27"
FT   gene            complement(402539..403135)
FT                   /locus_tag="Mmc1_0349"
FT   CDS_pept        complement(402539..403135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0349"
FT                   /product="peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: par:Psyc_0693 peptidyl-prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42875"
FT                   /db_xref="GOA:A0L4I2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I2"
FT                   /protein_id="ABK42875.1"
FT                   /translation="MFFTRFFQPSAWWMTLGLLLVVTSPTMAGAQGKGANPVIVKLSTS
FT                   MGDIKLQLDAEKAPISTENFLSYVKKGHYDGTIFHRVIPGFMVQGGGMDANMKEKSTDA
FT                   PIKNEADNGLVNKRGSVAMARTQVVDSATSQFFINVNNNDFLNHGGRDFGYAVFGEVIE
FT                   GMDVVDQITAQPTGNKGYHQDVPTTPITINSATQE"
FT   sig_peptide     complement(403043..403135)
FT                   /locus_tag="Mmc1_0349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 31"
FT   gene            403543..404445
FT                   /locus_tag="Mmc1_0350"
FT   CDS_pept        403543..404445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0350"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: bfs:BF2669
FT                   putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42876"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I3"
FT                   /protein_id="ABK42876.1"
FT                   /translation="MKFAAIDIGSNAVRLFIAHVYETGQAMPIVRKDDLYRVPLRLGAD
FT                   AFVRGEITPETEQQFVVVMQAFRKLIDFFQPLDMLACATSALRTARNGHEVVMRVSREA
FT                   NINIEIIEGQREAELIALNRADGSFDQDHFLFIDVGGGSTELTLLAKGRQVEATSFPIG
FT                   TVRIKENLVDSEIWSEMKRWIKVKAAPYPHLTAIGSGGNINKLVRMGGDKQAKQMQRDE
FT                   ISKLLKTLRGMTNEQRMRELGMRPDRADVIVPAGEIFLSTMKWAKIKKIIVPQFGLSDG
FT                   MVHYLYRRHVEGQGGRIIS"
FT   gene            complement(404673..405140)
FT                   /locus_tag="Mmc1_0351"
FT   CDS_pept        complement(404673..405140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0351"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: dps:DP0122
FT                   similar to 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42877"
FT                   /db_xref="GOA:A0L4I4"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="InterPro:IPR016364"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I4"
FT                   /protein_id="ABK42877.1"
FT                   /translation="MKSGSGTFKWMVISVAALFLLSGCAAPQNKAQGGAMVGALGGGLA
FT                   GSLMGNSKHKERNALIGAALGGLLGYSIGNEMDKADLLKLNNAYESTPSYQTTDWVNPD
FT                   SGRKYEVTPKPAARTAGRVCRDAEIKVWIDGRPETAIQRACRNPDGTWQMI"
FT   sig_peptide     complement(405039..405140)
FT                   /locus_tag="Mmc1_0351"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.745 at
FT                   residue 34"
FT   gene            405437..406546
FT                   /locus_tag="Mmc1_0352"
FT   CDS_pept        405437..406546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0352"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: sth:STH1636
FT                   putative GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42878"
FT                   /db_xref="GOA:A0L4I5"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I5"
FT                   /protein_id="ABK42878.1"
FT                   /translation="MDSVDDMTVEQIMERYDERRALYDDFRNRQVTLLTEFLKENGPNV
FT                   FSITGRVKERESLRRKVTRPGSKYTRMEEVQDLVGIRIVTFFEEEVEQVAEVIRKEFKI
FT                   NEAHILDRGEALDPERWGYRSRYYNVGLLDNRLKLIEYKRFVGCTAEIQVRSLLQHAWA
FT                   EIETRMGYTSRDTFPKERRRQFSRIAGMLELADQEFNETHRFLKPYRQRMLEQSNKGHD
FT                   NPVPSDMRRDPIGNDSLTRFIQENALVREMDARLAAIINVSLEDNGDFIDEVATHLSYL
FT                   NLGTITALENELRIQRKTILGIAKQIFDRQGDKEFSALWRGISIYMLGYTLSAVAEKSE
FT                   HLLHGLDRTEIGPLLARSPFEDDSDLAPW"
FT   gene            406650..407189
FT                   /locus_tag="Mmc1_0353"
FT   CDS_pept        406650..407189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42879"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I6"
FT                   /protein_id="ABK42879.1"
FT                   /translation="MIAKQKNRKIGWLVALLVFTPLLAQADIYSCRDAQGIITLRNSPC
FT                   EKNEAVNSRTFTEPAVVHRREPKLRKRSPEERGEPPTYGSADAQLKAKQAVKKQMVQQL
FT                   HDVGEQVMQEPEVLRSMLKFNADPHVRALLSDPFMVKALKEGDSRYLQNSYDYRMLLKS
FT                   YPDAVPALKNLATNGQ"
FT   sig_peptide     406650..406730
FT                   /locus_tag="Mmc1_0353"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            complement(407300..407629)
FT                   /locus_tag="Mmc1_0354"
FT   CDS_pept        complement(407300..407629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0354"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: mfa:Mfla_0245 glutaredoxin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42880"
FT                   /db_xref="GOA:A0L4I7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I7"
FT                   /protein_id="ABK42880.1"
FT                   /translation="MSDIQATIQEHVNSHAVVLYMKGNPSFPQCGFSGAAAKMLAACDL
FT                   SNDDFLAVDVLMNPDIREGIKAFANWPTIPQLYIKGQFVGGADIMREMYQSGDLKTQLD
FT                   AALGR"
FT   gene            complement(407661..407903)
FT                   /locus_tag="Mmc1_0355"
FT   CDS_pept        complement(407661..407903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0355"
FT                   /product="transcriptional regulator, BolA protein family"
FT                   /note="PFAM: BolA family protein; KEGG: nmu:Nmul_A2742
FT                   BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42881"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I8"
FT                   /protein_id="ABK42881.1"
FT                   /translation="MEVENVKALIEAGLSCDYIHVDGDGRHFEATIVSPEFCADAGMVQ
FT                   QHQRVYRVLGEHMKEAIHALSLKTYTPEKWAQQKR"
FT   gene            complement(408250..409083)
FT                   /locus_tag="Mmc1_0356"
FT   CDS_pept        complement(408250..409083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0356"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: mag:amb4089 cytochrome
FT                   b/c1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42882"
FT                   /db_xref="GOA:A0L4I9"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4I9"
FT                   /protein_id="ABK42882.1"
FT                   /translation="MNLKKALALSALVLGLAVAPQMATASGNAVELPNEEWSHLGPFGK
FT                   FDKAQIKRGIQVATEVCMGCHSIKYLKFDQLRQFGITEDEVNNMAGNYNATKLDKMLTG
FT                   LAPEDAKESYGTVPPDLSLMTKARKGYENYLYGILTGYLTDDEAAKVSEASEDGNVTDE
FT                   EAKHLAEVLHMDPHNLEAVRKAVTRINGGDNFNKYFAGHFFAMPKPMGANQVEYADGTK
FT                   ATLEQQAKDVTAFLAWASEPNLEKRKATGKYVILYLLLLTGMLYAVKRRIWSRIH"
FT   sig_peptide     complement(409006..409083)
FT                   /locus_tag="Mmc1_0356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.906 at
FT                   residue 26"
FT   gene            complement(409103..410308)
FT                   /locus_tag="Mmc1_0357"
FT   CDS_pept        complement(409103..410308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0357"
FT                   /product="Cytochrome b/b6, N-terminal domain"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; Cytochrome
FT                   b/b6, C-terminal domain; KEGG: mag:amb4089 cytochrome b/c1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42883"
FT                   /db_xref="GOA:A0L4J0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4J0"
FT                   /protein_id="ABK42883.1"
FT                   /translation="MFKSLMGWVDERLPISEFMRTQAVEYPTPKNLNYWWNFGSLALLV
FT                   LIIQLATGIFLVMHYKPDALLAFDSVEHIMRDVNWGWLLRYMHANGATFFFVVIYIHIL
FT                   RGMYYGSYRAPREILWWIGVIIFFLLMGTGFIGYVLVWGQMSYWGAVVITKLITAIPLI
FT                   GEGLVVWVWGGFSVGDPTLNRFFSLHYLLPFVLVGLVVLHIWALHAVHSNNPDGIDLEE
FT                   KDTIPFHPYFTIKDFFGYGVALTIYCYFVFFAPNAFLEPDNYIPANPMQTPPHIVPEWY
FT                   FLPFYAILRSIDFLGPYSKLAGVVAMVAAIAILFVLPFLDRSPVRSFRYRGISKGLFWI
FT                   FVVDCFVLGWVGFSPADRMVFGLPIVYIGRTATAVYFGYFFLLWLVTALNIEKPKPVPK
FT                   SL"
FT   gene            complement(410344..410880)
FT                   /locus_tag="Mmc1_0358"
FT   CDS_pept        complement(410344..410880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0358"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /note="TIGRFAM: ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit; PFAM: Rieske [2Fe-2S] domain protein;
FT                   KEGG: rru:Rru_A0364 ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42884"
FT                   /db_xref="GOA:A0L4J1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4J1"
FT                   /protein_id="ABK42884.1"
FT                   /translation="MSTVNEHDENRRDFLIMATGAVGAVGVAGAAWPFIDSWSPSADVL
FT                   SLATTEVSVAAIAEGQMITTMWQGKPVFILHRNAEQIERAKTDDKATDLVDPQADADRV
FT                   KKDEWLIVLAICTHLGCVPQPIGTGDFGGFLCPCHGSHYDTSGRIRKGPAPRNLEVPYY
FT                   EFKDDETVIIGKAMG"
FT   gene            411082..411606
FT                   /locus_tag="Mmc1_0359"
FT   CDS_pept        411082..411606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0359"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mta:Moth_1880 RNA methyltransferase TrmH, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42885"
FT                   /db_xref="GOA:A0L4J2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4J2"
FT                   /protein_id="ABK42885.1"
FT                   /translation="MNQIFQQPDASAPAPTLPDTLLHVVLYRPEIPPNTGNIQRICAAT
FT                   GAMLHLVGPIAFRLDNAALKRAGMDYRQWVDVQRYDDWAHCLRMQPLGVRWIPISTKAT
FT                   QGYHTMRYQAGDRLLFGSEGSGLPAEIHQALGHNAVRVPMLPRARSLNLANTVAVVLYE
FT                   ALRQLNYPEMA"
FT   gene            411709..413160
FT                   /locus_tag="Mmc1_0360"
FT   CDS_pept        411709..413160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0360"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: atc:AGR_L_2256 phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42886"
FT                   /db_xref="GOA:A0L4J3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4J3"
FT                   /protein_id="ABK42886.1"
FT                   /translation="MVQNRAIFCFLSTIKSEETMTSESQPQVTQTRKFFGTDGIRGMAN
FT                   IHPMTPDLVLKLGRAAGHVFRVGDKRHTVIIGKDTRLSGYMFESALLAGLTSMGIHCLQ
FT                   VGPLPTPAIAFLTRALRADAGIMISASHNPFHDNGIKFFGPNGMKLPDELELEIERVLL
FT                   SDEDLPMPTPHHLGRAHRIDDALGRYIEFAKTSFPKDLRLDGLRVVVDCAHGAAYKVAP
FT                   AVLWELGAEVVTLGNHPNGTNINDGVGSLYPQEMVKRVQEVRADVGIAFDGDADRVVIC
FT                   DERGEILDGDVILAMSALEMKRKGVLRGDGVVATVMSNLGLERALAAEGLTLARTKVGD
FT                   RYVLEHMLAHGFNLGGEQSGHLIFLDHNTTGDGLISALSVLALMTTQAQPLSKLANVMQ
FT                   RVPQVLQNVTIARGSDPMDDSRVVAAIAEAEAQLGTRGRILVRKSGTEPKVRVMVEGDD
FT                   TAHITALASGVCEAIKRASNGFGEG"
FT   gene            413297..414304
FT                   /locus_tag="Mmc1_0361"
FT   CDS_pept        413297..414304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42887"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4J4"
FT                   /protein_id="ABK42887.1"
FT                   /translation="MVWYQNDPTFTQFVDALCDHADPVEVARGHNFRHDERIDKARAAE
FT                   YLAHMGKAPVGHQSCAAQHASYCAQYVRDAITPATFLPSNRAALLGPFDDGVMLIRVER
FT                   LDKLLALISESNGESADDAFARLRQAMEDYQQRKDNEAERALKGWIARWNEKRDARPAF
FT                   VTIGDEMASYLRRDDWVVALRDQLGLAHFSGAPGKPIYLALMAYPVQDVKTQAAKYTQL
FT                   SSPFVAPTVLDADMWEYFFPAPVDRRATTLSYGRAMSLQPLASEEQLQVEMLHTRVDYQ
FT                   LAHVRQLGQLETPRPEHPVEELRNAHLDGVRMVTERYDWGEEIRVKERLDEPTA"
FT   gene            414288..416702
FT                   /locus_tag="Mmc1_0362"
FT   CDS_pept        414288..416702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0362"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   mba:Mbar_A2526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42888"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4J5"
FT                   /protein_id="ABK42888.1"
FT                   /translation="MNPRLEEWLNSFMAAPLESWQHYVTGARRIPGSERLDPADSLKQL
FT                   YVELPDNHAAFALLDKTLTQWLPRFVEWDSPTRQQFGLSRYVYWIAEIMVAATMLPLPQ
FT                   LRQHLMDNFFTYRGRLTPLQLAPSRDALAEFLRVMAGSREFASNVPNFWMGLCQKAGYS
FT                   IPEYYLHIGIRGLRNCPKPINEQAPLWVGGLVAWLPNASSKEQFINTFYMIKVLYPSTP
FT                   SRWEKLIQPIIATLESREKVPTDRIAWLRALVREGKQSPDRSQSRPKPSALYAPHKTPY
FT                   RDELQPLLKTIEDDRQAWPQVEKPLHKLLERHQHYYAQTAESYFFVRAVNFTIQKLLKC
FT                   PPAYPFAQRWIEQVLEIDPWDPANWNLQGRLLVAMGKRERAEWVFWESTRRFPDNSLNY
FT                   TELGQLLLKQPGREDEAEQILREAMALDSNNIPPRTELGRLYMQQGKLEEAEQVLREVI
FT                   GLDSNDIHVRTELGRLYMQQGKLEEAEQVLQEAMALDSNNIPPRTELGRLYMQQGKLKE
FT                   AEQVLQEAMALDSNNIPPRTELGRLYMQQGKREEARWVLEQVLDIESEDHVARGLLSRL
FT                   ERGEQPAARDLSQPKQSHGSVQRVAAPPQVQESDPVALVGVLVRADFRLRISEDHIPVL
FT                   KKQGQQDLQGMLKQHAGMAVVSFYASRHGLTEEPLEGESLNRWAMQLDRLLLAEGVSVE
FT                   ARQEGLQEVARHLSGRLVKDWLKAAAGEAEAWQRLRQAVLGEAKDAGMPDDQFVKGQIG
FT                   QIFKAPALQHDSPPPPWAEQRPGLQNLAARLVEANTDLFLHKVKDGEEVAA"
FT   gene            416837..418783
FT                   /locus_tag="Mmc1_0363"
FT   CDS_pept        416837..418783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0363"
FT                   /product="Ser-tRNA(Thr) hydrolase / threonyl-tRNA
FT                   synthetase"
FT                   /EC_number="3.1.1.-"
FT                   /EC_number="6.1.1.3"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); TGS domain protein;
FT                   Anticodon-binding domain protein; Threonyl/alanyl tRNA
FT                   synthetase, SAD; KEGG: noc:Noc_1140 threonyl-tRNA
FT                   synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42889"
FT                   /db_xref="GOA:A0L4J6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4J6"
FT                   /protein_id="ABK42889.1"
FT                   /translation="MVEIILPDGSSRSYDQETLTCGQIAASIGKGLAKAAIAGVVNGQK
FT                   VDLDAPVPHGAQVAIITEDSPEGLEIIRHSASHLMAQAVKTLFPQAQVTIGPAIENGFY
FT                   YDFDYERPFTPDDLTAIENCMRKLAKRNEKVERRVMPRDEAVAYFQAMGELYKAEIIGA
FT                   IPAGEDVSLYSQGEFTDLCRGPHVPSTGKLKAFKVMKAGGAYWRGDSRNKMLQRIYGTA
FT                   WATEADLKAYLTQMEEAEKRDHRRIGKDLDLFSVQEDAGGGLVFWHPRGSRIRRVIEDF
FT                   WKDRHVEAGYEFLYTPHIANRQLWNTSGHTDFYSDSMFSPMEVDEQAYQIRPMNCPFHI
FT                   LIYKDRRHSYRELPFRWGELGTVYRYEMSGALHGLFRVRGFTQDDAHIFCTEQQIEEEI
FT                   QRILDLTLDILRTYGFSDFEINLSTRPEKSVGSAAIWDKATEALRRAIVSRDLSYVVDE
FT                   GGGAFYGPKIDVKITDSIGRKWQCSTVQLDFNLPERFDMGYIGEDGESHRPIMIHRALM
FT                   GSLERFFGILVEHYAGWFPMWLAPVQAVVCSITDAQHAYAETVLAALKKAGLRVEIDLR
FT                   NEKVGYKIREHTLKRVPYLLVVGDKEREEGTVNVRLRSGKSLGSLPIQDVVERLVEEAA
FT                   SRALSASEDQEEA"
FT   gene            418910..419458
FT                   /locus_tag="Mmc1_0364"
FT   CDS_pept        418910..419458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0364"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3; KEGG: rru:Rru_A3488 initiation factor
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42890"
FT                   /db_xref="GOA:A0L4J7"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4J7"
FT                   /protein_id="ABK42890.1"
FT                   /translation="MRFDRSLPQNQDSTRINEAIRVPEVRLIDEEGEQVGVVSRNDALY
FT                   RAQNVGLDLVEVAPEAKPPVCKIMDYTKYKYQKAVRERIARKNQVRIDTKEVKFRPGTD
FT                   THDYEVKLRSIRKFLEGGNKVKCTMRFRGREMAHQDLGLVMLKKVESEVLDLGKVEQEP
FT                   KLLGRQITMMLAPNALVKK"
FT   gene            419701..419898
FT                   /locus_tag="Mmc1_0365"
FT   CDS_pept        419701..419898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0365"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="PFAM: ribosomal protein L35; KEGG: dps:DP1426
FT                   probable 50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42891"
FT                   /db_xref="GOA:A0L4J8"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4J8"
FT                   /protein_id="ABK42891.1"
FT                   /translation="MPKLKTHRGAAKRFKVTGSGKIRRNKAFKSHILTKKSAKRKRGFR
FT                   AGDLVHERDVAGVRKMLPYL"
FT   gene            420008..420361
FT                   /locus_tag="Mmc1_0366"
FT   CDS_pept        420008..420361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0366"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG: mlo:mll5057
FT                   50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42892"
FT                   /db_xref="GOA:A0L4J9"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4J9"
FT                   /protein_id="ABK42892.1"
FT                   /translation="MPRVKRGVTSQARHKKVLKAAKGYTGRNNSCFRIAKQKVEKGLQY
FT                   AYRDRKNLKREMRRLWIARINAATRLHGMSYSQFMNGLNKAGIELDRKVLSELAISEPE
FT                   SFGTLVEQAKAAL"
FT   gene            421259..422305
FT                   /locus_tag="Mmc1_0367"
FT   CDS_pept        421259..422305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0367"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="KEGG: psp:PSPPH_2139 phenylalanyl-tRNA synthetase,
FT                   alpha subunit; TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase, class IIc;
FT                   aminoacyl tRNA synthetase, class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42893"
FT                   /db_xref="GOA:A0L4K0"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4K0"
FT                   /protein_id="ABK42893.1"
FT                   /translation="MTMRNALQQLEQEAISAISSSENLKDLEDVRIRFMGKKGSITQQY
FT                   GLMKTCPPEDKKELGQWLNQLKEAYNQSFEAQLEKLKKDELHARLLSERLDISLPGRHT
FT                   HTGGIHPVTRAIEEIAQVFAGMGFEVASGPEIESDWHNFGALNIPDDHPAREMHDTFYI
FT                   ADDPNGGRRVLRTHTSPVQIRVMENRQPPLRVIAPGKVYRCDSDVTHTPMFHQVEGFMV
FT                   DKGVHFGQLKGLLESFLQTFFEQKLPVRFRPSFFPFTEPSAEVDMACLFCNGKGCRICK
FT                   GTGWLEVLGCGMIHPEVMKNVGMDSEIYAGFAFGMGVERLGMLKYGINDLRTFFENDVR
FT                   FLSRHAVY"
FT   gene            422398..424788
FT                   /locus_tag="Mmc1_0368"
FT   CDS_pept        422398..424788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0368"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: pca:Pcar_1423 phenylalanyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42894"
FT                   /db_xref="GOA:A0L4K1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4K1"
FT                   /protein_id="ABK42894.1"
FT                   /translation="MKFTEKWLREQINTQLDSEQISKTLTMAGLEVDAMERLGKGLDKV
FT                   QVGFLEAVQPHPDADRLTCCQVRVGETRLNIVCGATNHKQGDKVAVARDGAELPNGLKI
FT                   KKGQLRGQPSEGMLCSLTELGMAESSEGIIILPSDAPEGATMADYFQRNDICFELGITP
FT                   NRGDCLGVRGIARDLAAVTGESLIPLQSAVQVAANVPTVAVEIADGEGCPRYAGRVVEG
FT                   VKVGPSPDWLRNRLESVGLRSINNIVDITNYVMLELNQPMHAFDLAQLAAPIVVRRANP
FT                   DERLTTLDYVERQLTEQMTLICDQQRPLAVAGVMGGLNSGVTDATTSIFLESAYFNPVR
FT                   TARTGRRLNLVTDSRHRFERGTDPMAIELALDRATQLVLELCGGQAGAITLTDAGTWSR
FT                   NPPVAFRHTRANALTGMCLTQAEQARYLQAIGCVEVAKPAQSATVEGAVWYLPPTHRHD
FT                   LLREEDLVEEVVRLFGYDKVPTELPSGAVATHQDSPERQLAKRLRKALTGLGYLEAVNY
FT                   AFVAPEVQARFDADLHPIMLTNPLSEEQSCMRTSLIAGLVEAVRRNLSRGNDGLRLFEM
FT                   GHIFKLDAQGQVQEEEHVSMVLAGRGTPRIWHTPQRVWDFFDLKGDFQTVVSRLQGAEP
FT                   RYLPGGPAFLHPGRKAEIHLRGRVAGWMGELHPSLREAMGIDQPVLMLELRSDALTQVN
FT                   KKEAANVSRYPAVTRDFAFVVDRDTPAATILESARSVAKQLVREVELFDLYTGEHVPQD
FT                   KKSIAFGLVLQADDRTLDEGEINQVMAQVTAKLEKQFNAVLRA"
FT   gene            complement(424942..426558)
FT                   /locus_tag="Mmc1_0369"
FT   CDS_pept        complement(424942..426558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0369"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   mta:Moth_1893 phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42895"
FT                   /db_xref="GOA:A0L4K2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4K2"
FT                   /protein_id="ABK42895.1"
FT                   /translation="MSSTLTYKERVAAVTKQLAERGISNPGVVNLDLPTPKLYEQIIAR
FT                   GEGQIAHGGSVVVETGIYTGRSAKDKFIVEEPTSQADVDWGTVNRPVSQENYEKVRGRL
FT                   MAFLQGRELFVQDVRVGADPQFQRRVRVVNIKAWQNLFARNLFITPETMENEVVPPDFT
FT                   VIACPDFKADPELDGTRSEAFIYMNIAQREIIIGGTAYAGEMKKSIFSIMNYLLPKQAV
FT                   FPMHCSANIGTQDDVAIFFGLSGTGKTTLSTDPKRRMIGDDEHGWSDKGVFNFEGGCYA
FT                   KTIRLNAVAEPVIHNCTQTFGTVLENVVMDEESRTLDLDDDRKTENTRAAYPLSSVGNI
FT                   KADGMGGHPSHVILLTADAFGVLPPVSRLTSEQAMYHFISGYTAKLAGTERGVKEPQAT
FT                   FSSCFGGPFMVHHPTVYAEMLGKRLSETGAKCWLVNTGWTAGPYGEGHRMPIRETRAII
FT                   DSILANELNDVATHEDPVFGLAVPTAIDGVETVRLTPRDTWKDGAAFDAKAKDLARQFN
FT                   ENFANFADRVSDAIKGAGPKV"
FT   gene            complement(427075..428205)
FT                   /locus_tag="Mmc1_0370"
FT   CDS_pept        complement(427075..428205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0370"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM; peptidase M23B;
FT                   KEGG: rru:Rru_A1767 peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42896"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4K3"
FT                   /protein_id="ABK42896.1"
FT                   /translation="MDRLTIKHRLTGLMTLLLLGGCMPLDTLNLSTTPTDTPVRVARGP
FT                   ALGWQPTTTPNHVEPSNAPTYQVQAGDSLWSIAMSHQVDVFDLARWNGVDDPDKVVAGQ
FT                   LLYVRSPSMPVPNGKPDVMDEGNSSGDTPLRTVHLPQPSVVAQPDPMGVAQSGGFLKQH
FT                   SFILPTGRTAPLPLPALATPLAAVGSTATPTDKATPAPKSRDLTTQPATRQIVVQIRGD
FT                   EEKPGIIQQPATLSSATAAANLQRMKGKPAPQQWNWPVQGTVVASFGRRGAKINPGIDI
FT                   AAEKGTPVLAPAAGVVAYVGGHDSFGNLIIVNHGGDYKTLYAHNDVNLVERGQEIRPGQ
FT                   MIARVGNTGVRVRSPRLHFEIRRPIKPLNPLNYLSK"
FT   sig_peptide     complement(428107..428205)
FT                   /locus_tag="Mmc1_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.270 at
FT                   residue 33"
FT   gene            complement(428193..428771)
FT                   /locus_tag="Mmc1_0371"
FT   CDS_pept        complement(428193..428771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42897"
FT                   /db_xref="GOA:A0L4K4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4K4"
FT                   /protein_id="ABK42897.1"
FT                   /translation="MRGLYDWTMHWAMHPKAVVALFLVAVAESSFFPIPPDLLLMAMAL
FT                   AEPMRSLLYAAVCTAGSVLGGALGYLIGYLAWDWIGAPILTFYGKMEAYDQLAGLFDAH
FT                   GAWVVAIAGFSPLPYKLFTITAGALHANFALFMVMSLLSRGARFFLVAALLRWGGEPLR
FT                   KLVERHLDLLTVAVVVVIVAIVVVMKWIV"
FT   gene            complement(428780..429466)
FT                   /locus_tag="Mmc1_0372"
FT   CDS_pept        complement(428780..429466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0372"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: gme:Gmet_1420
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   TIGRFAM: protein-L-isoaspartate O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42898"
FT                   /db_xref="GOA:A0L4K5"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4K5"
FT                   /protein_id="ABK42898.1"
FT                   /translation="MVAVSLKMSQPAAPPPPMGERARTRMLLALQSRGIHDPRVLEVMG
FT                   ALPRHDFVDEALAGHAYGDATLPIGEGQTLSQPYTVARMSQALELGYGMHVLEIGTGSG
FT                   YQTAVLAALCRRVYTVERIPSLALLARERLERMGITNVRYRVGDGTLGWPEPRPFERII
FT                   VTAGAPATPERLKRQLEIGGRMIIPEGGKLNQQLICIQRTGPESWQRDVLEACRFVPLV
FT                   GQQGWE"
FT   gene            complement(429448..430197)
FT                   /locus_tag="Mmc1_0373"
FT   CDS_pept        complement(429448..430197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0373"
FT                   /product="3'-nucleotidase"
FT                   /EC_number="3.1.3.6"
FT                   /note="KEGG: noc:Noc_0789 acid phosphatase; TIGRFAM:
FT                   stationary-phase survival protein SurE; PFAM: Survival
FT                   protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42899"
FT                   /db_xref="GOA:A0L4K6"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4K6"
FT                   /protein_id="ABK42899.1"
FT                   /translation="MLILLTNDDGIASPGLQALKDALKERHDVVTLAPVKDMSGTAHAI
FT                   SRGEDIKLTRIAEYEVAINGTPTDCVMAGLRMVLRRPPDLLVSGINMGANVAEDLSYSA
FT                   TAGAAWEGALSGIPSMAVSLCGSAAPWHFESAIKVTHMVIRQWLENPLPPGTFLNVNVP
FT                   NVPEYELKNPKPTRQGLRFNWPPPPVTAAGNPAFWDPTIPTPREEEFQLATDEEALRDG
FT                   FTSVTALHCLFRHPHATERLKAWSLFR"
FT   gene            complement(430516..431466)
FT                   /locus_tag="Mmc1_0374"
FT   CDS_pept        complement(430516..431466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_04666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42900"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4K7"
FT                   /protein_id="ABK42900.1"
FT                   /translation="MARNIRILALLLAAQMGLALVLLGSGPSLQAVNPNTPLLNLGEGE
FT                   LDELLIEGDDHSQLLLKKQDGLWRLPDHHNYPAEQGDVTALLSQLKSLSHGTPMATSDA
FT                   ALERFKVADTHFNRRITLKRQQQVVAVLYLGSGQGARNSAAHVEGQPGIFNVAIALHQV
FT                   PQTAKAWQDKTLLQIPAGEIMQIATHGLTLQRQPVDKEDKAAKPSWQATGLQAGETVNS
FT                   TAVESLSTKLATLRIEELLGVTDQPAYGLDKPVWQATLTRQGQPPLIYQLGHQSEPNSY
FT                   TLKRSDRPEYFKLPTYLAESLIEAGKRDSLLNKAP"
FT   sig_peptide     complement(431371..431466)
FT                   /locus_tag="Mmc1_0374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(431469..434363)
FT                   /locus_tag="Mmc1_0375"
FT   CDS_pept        complement(431469..434363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0375"
FT                   /product="ABC transporter, inner membrane protein"
FT                   /note="KEGG: noc:Noc_2141 ABC transporter, inner membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42901"
FT                   /db_xref="GOA:A0L4K8"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4K8"
FT                   /protein_id="ABK42901.1"
FT                   /translation="MDKIMRIAQKEFQSFFASPAAFLFLGAFLAATLFIVFWVETFFAR
FT                   NIADLRPMFQWMPLLLIFLVAALTMRSWSEERRSGTLETLLTSPVNPLHLIAGKFAAAL
FT                   ALVVVGLALTLPLTLTVALLGPLDWGPVLGGYIATLFLAAAYVSIGLFMSARTDNPIVA
FT                   LILTTAVCGLFYFIGSPTLTNLFGHEVSHFLALLGSGSRFDAITRGVVDLRDLYYYLSL
FT                   VGVFLTLNLFTLERLKWAGNPISQRHKQWGWLTALLVANFVAGNLWLGSIGWLRQDMTA
FT                   GKLYSLSEATQQQLQQLQEPLQIRGYFSAKTHPLLAPLVPQIRDLLKEYAQLSKGRVEV
FT                   AFIDPQRSPALEEEAASRYGIRPVPFQMASRHQASVVNAYFDLVVAYGDQFQKLSYTDL
FT                   IEIKSGASRELEVMLKNPEYAITQSIRKVQHAYQSGGNPFEGLAHPVTFTGYLSQPLPA
FT                   GVEKLQGALQSALDELTAQGKEKFKVQFKDPGQDPALAKQLKQDYGFKPQIASLLDPQP
FT                   FWFYMVLTGNDSDGIPVPLPEELTKEGLKRTIEAAVQRMAPGFLKNITLTTATPAPAGM
FT                   MGRAPTPGKGYTLLQEALGESLKVTSNDLQSGQVPAQTDLLMVMGPDKLNEKQLFAMDQ
FT                   FLMQGGTVVLATSPFDVDLQGSLSVANKHDAGLTEWLASHGITLQEKMVLDAQKASLPV
FT                   PVTRYIGPMAVEEIQQFPYPHFPDLRGASLNPKSPITAGLGQLTINWASPIVVDAEPNK
FT                   TRQVIPLLHSSKQSWSSDALNILPDYQAYPDQGFPKPDSQEPQLLAVALEGRFDSFFKD
FT                   KASPLLHEQEAPSAHAPEEKAQQTDPEPTKPQFGGVLEHSSPEARLILIASNGFASDEV
FT                   LSLASQGAGTLYNKPIELLQNSIDWALQDAALMQIRGRMQFARTLLPMSDGSRMVIEYF
FT                   NYGLVLLGLLGIWLWRRAVRLRQLRRHQAILAEV"
FT   gene            complement(434356..435375)
FT                   /locus_tag="Mmc1_0376"
FT   CDS_pept        complement(434356..435375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0376"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: noc:Noc_2142 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42902"
FT                   /db_xref="GOA:A0L4K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4K9"
FT                   /protein_id="ABK42902.1"
FT                   /translation="MAPDRPFKANLIRKPDPLGSQPKTSLGDCMIEVSQLSRVYGDYTA
FT                   VEACSFAIQRGEVVGLLGHNGAGKTTIMKMLTGFLEPTSGTILIDGLALNREANTVQGR
FT                   IGYLPENCPVWPEMTVMAYLEYHADLRGIADIDKPRAIARAIRRTALQEKALAPIATLS
FT                   RGYRQRVGVAQAILHDPDIIILDEPTNGLDPTQIRQMRDLIRELAKEATVILSTHILQE
FT                   VQAVCERVLILKQGKLVVDATLATLQSGGRLRLTTAKTAQATLASQLESAQIESLPSTD
FT                   GLYHYALNVPAQQTPQIAQAVVEGGLGLHGLHFEKQNLESLFAQINQQPQTHGEVGHG"
FT   gene            complement(435499..436518)
FT                   /locus_tag="Mmc1_0377"
FT   CDS_pept        complement(435499..436518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0377"
FT                   /product="protein of unknown function DUF59"
FT                   /note="KEGG: ade:Adeh_1674 protein of unknown function
FT                   DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42903"
FT                   /db_xref="GOA:A0L4L0"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L0"
FT                   /protein_id="ABK42903.1"
FT                   /translation="MAQRAAIVALFDQLQEPKLKWNINTLNLLQEVTLHEQHLRVVVHL
FT                   ITGDRQQRIAFEEQARQAIQAIHTGSLELIVAQAQVGTEGIQGVKRIILVASGKGGVGK
FT                   STVAVNLAVGLNLLGHKVGLMDADIYGPSVPTMLGCHDKPQVLPHEYLLPLQRHGIRFI
FT                   STGSLVDPGKALDWRGPLVSGTLLQFITKTCWGELDYLIIDMPPGTGDAQLTIASKLKT
FT                   HGVVLVTTPQEVAWGDVRRAIELFQKQQAPILGIVENMNHQVCTACGHQSHPLIHSQLP
FT                   LPPGIVSLAQLPLAHEISQAGDAGVPLLLQESSSPAKAALLALAQRVAQCTAPTQEPA"
FT   gene            complement(436525..436785)
FT                   /locus_tag="Mmc1_0378"
FT   CDS_pept        complement(436525..436785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42904"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L1"
FT                   /protein_id="ABK42904.1"
FT                   /translation="MSAEQGFIDYVKTTQPKMWELIRKTADESGLIVVDEANDAITATN
FT                   RLLWCNPVLHDCLATLVDQWCGKQTTPAESFRALLNPPSKD"
FT   gene            437165..437530
FT                   /locus_tag="Mmc1_0379"
FT   CDS_pept        437165..437530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42905"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L2"
FT                   /protein_id="ABK42905.1"
FT                   /translation="MAEVREGSVWVLCACEYLHGDRYAQFERLREDLHNSRQVELVVFN
FT                   VGMMKTLNSEQLGKLIQISNQDKYEVCLTNVSEQNYALMKLIGLERFVKIYDKPQAEAL
FT                   AKEHRILSAFDCLYGDG"
FT   gene            complement(437927..438982)
FT                   /locus_tag="Mmc1_0380"
FT   CDS_pept        complement(437927..438982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0380"
FT                   /product="GTPase EngC"
FT                   /note="PFAM: GTPase EngC; KEGG: vvy:VVA0067 predicted
FT                   GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42906"
FT                   /db_xref="GOA:A0L4L3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L3"
FT                   /protein_id="ABK42906.1"
FT                   /translation="MSNALSTLSNVPLRPFFQQQLSMEEQHATHVVRVIARHGDTLTLL
FT                   GNDGQSSLKLPGKWRLQPPEEQPIVGDWLVMDQQNQPLRWLERLSHLSRKAAGSGQQTQ
FT                   HMAANIDTLFVVSSCNRDFNPSRLERYLALAFAGNVQPVVLLTKADLVDEPEPFCRQVE
FT                   SLHRGVVAIALDARHPDLHHQLGPWIGPGESVAFLGSSGVGKSTLINALLDQKSMATQA
FT                   ARADDDRGRHTTTARAMFHMKSGAWLLDTPGMRELRLGESNQGLQTLFSDIEALAQACQ
FT                   YRDCDHERTSGCAVLAAVASDTLDARRVRNYLKLQREQTYLTETVWQQRDRHRQFARLV
FT                   NRVKIDKFGKR"
FT   gene            439323..439637
FT                   /locus_tag="Mmc1_0381"
FT   CDS_pept        439323..439637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42907"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L4"
FT                   /protein_id="ABK42907.1"
FT                   /translation="MQQRIKKAFQDAINNKNSKNGYPISLYEIKLTFCVSMVRNLDEPK
FT                   WLNQIAGRPSYGFPDSPNIYALWVYHDRHMFIKACSGNLVPEGLSTMGGMTIYGKHVEL
FT                   "
FT   gene            439872..440087
FT                   /locus_tag="Mmc1_0382"
FT   CDS_pept        439872..440087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0382"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42908"
FT                   /db_xref="GOA:A0L4L5"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L5"
FT                   /protein_id="ABK42908.1"
FT                   /translation="MLGFKERNNTVNEIVNGRRAISAEVAVKLEFVFKMPAKLWKGLQD
FT                   DYDIGMARLKVKEEHLTLRVAEKQHA"
FT   gene            complement(440145..442025)
FT                   /locus_tag="Mmc1_0383"
FT   CDS_pept        complement(440145..442025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0383"
FT                   /product="propionyl-CoA synthetase"
FT                   /EC_number="6.2.1.17"
FT                   /note="TIGRFAM: propionate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: bbr:BB3728 propionate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42909"
FT                   /db_xref="GOA:A0L4L6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L6"
FT                   /protein_id="ABK42909.1"
FT                   /translation="MENREKYEAFYKRSIEDRDGFWKEQAKLIHWDKPFKTVLEYQKPP
FT                   FANWFPDGTTNLCYNAVDRHLAERADQTAIIWVSTEVEQEKTITYQELYQQVNEYAALL
FT                   KDLGVGKGDRVLVYLPMIAEVIPVMLSCVRIGAIHSVVFGGFASTALASRIDDAAPKLI
FT                   ITVDAGIRGGKVVPYKPLLQESLNQISVTRPKVLLINRNLDPNLKMEKGDLDFTTELAK
FT                   HKDAVVEPEWLPSSHPSYILYTSGTTGKAKGVQRDTGGHAVAMRASMKHIYGVEPGQVM
FT                   FAGSDVGWVVGHSYIVYAPLLTGATTVVYEGLPIRPDPGVWWSLVEKYKVNCLFTSPTA
FT                   IRLLKKSGEEWIWKYDLSSLESMFLAGEPLDRETHRWVTSALKHAPVVDNYWQTETGWP
FT                   ILTNFKGMGLMETKFGSPCRPAYGFDVVLIDDLTQQPAEPNTKGSLMIRPPLPPGCLST
FT                   VWGDDERFVQTYFSRMREPIYATFDSAVYDDDGYYYIMGRDDDVINVAGHRLGTREIEE
FT                   ALCSHPAVAEAASIGIKDELRGQAISCFVVLTTGAEPPSEADLKNHVASQLGPVARPHF
FT                   VRVVTALPKTRSGKVLRRAIVAINEGRDPGDLPTIEDASALDKIKEACKN"
FT   gene            complement(443775..444176)
FT                   /locus_tag="Mmc1_0384"
FT   CDS_pept        complement(443775..444176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0384"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: jan:Jann_3164
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42910"
FT                   /db_xref="GOA:A0L4L7"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L7"
FT                   /protein_id="ABK42910.1"
FT                   /translation="MIGRLNHVAIAVADLDAAERQYGDLLGGILSAREDLPEHGVTTVF
FT                   VRLSNTNIELLHPLGMDSPIAKFLEKSPSGGLHHVCYEVEDIRAAMERLVAGGARVLGR
FT                   EPKIGAHGKPVIFLHPKDFSGTLVELEQA"
FT   gene            complement(444190..446148)
FT                   /locus_tag="Mmc1_0385"
FT   CDS_pept        complement(444190..446148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0385"
FT                   /product="biotin carboxylase / biotin carboxyl carrier
FT                   protein"
FT                   /EC_number="6.3.4.14"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; RimK
FT                   domain protein ATP-grasp; KEGG: sil:SPO1101 propionyl-CoA
FT                   carboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42911"
FT                   /db_xref="GOA:A0L4L8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L8"
FT                   /protein_id="ABK42911.1"
FT                   /translation="MQKILIANRGEIACRVIKTARRMGIQTVAVYSDADREALHVRMAD
FT                   EAYYIGPSPSNQSYLVMDKLLEVIKQCGADGVHPGYGFLSENSTFCRRLQEMGVIFIGP
FT                   NPTAIDAMGDKISSKKLAQAANVNTIPGHMGIIENADEAVRIAAEIGYPVMLKASAGGG
FT                   GKGMRIAHNDAEAAEGWQSATNEGLSYFGDGRVFIEKFIENPRHIEIQVLCDGHGNGVY
FT                   LNERECSIQRRNQKVIEEAPSPFVDADMRRAMGEQALALAQAVDYVSAGTIEFVVGADK
FT                   GFYFLEMNTRLQVEHPVTEFITGLDLVEQMIRVARGERLSITQDQVLLKGWSMESRVYA
FT                   ENPYRNFLPSVGRLVRYEPPLESAHVRVDTGVFAGGEVTLFYDPMIAKLITWGQDRGEA
FT                   IEHMREALDSYLIEGPGHNIDFLNAVLRHPRFVSGNISTAFIAEEYPEGFEGAPLSGMD
FT                   RQLFAVAAAYIEQQAQALLMDLGVEKSWVVSVDEEVLPLIFREVEGGDEVEFGDGSRFG
FT                   VSGVVRPGAKKVTLTIAGQVCTFGVVRGEEGYHLTRGGRQVGVYVRTPRQHQLAQRMPV
FT                   KVAPDTSKMLITPMPGLVLKIIVEVGDCVSAGDPVCVLEAMKMENIMRVERDGVVGAIF
FT                   AKPGQAVESDSIIMTFE"
FT   gene            complement(446161..447705)
FT                   /locus_tag="Mmc1_0386"
FT   CDS_pept        complement(446161..447705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0386"
FT                   /product="propionyl-CoA carboxylase carboxyltransferase
FT                   subunit"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: rfr:Rfer_2803
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42912"
FT                   /db_xref="GOA:A0L4L9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4L9"
FT                   /protein_id="ABK42912.1"
FT                   /translation="MQEIIEKLDHLRNQARLGGGQARIDSQHARGKLTARERIDVLLDE
FT                   GSFEELDMFVTHNCIDFGMADKRIAGDGVVTGHGTIFGRAVFVFSQDFTVFGGSLSEAN
FT                   ATKICKIMDMALKVGAPVIGLNDSGGARIHEGVSSLAGYAEVFQRNVMASGVIPQISAI
FT                   MGPCAGGAVYSPALTDFIAMVKDTSYMFVTGPDVVKTVTHEEVTAEDLGGAVTHATRSG
FT                   VADFAFDNDMSMLKQLRRLMSFLPSNNTEKPPLVETHDPANRPDMTLDHLVPMDATKPY
FT                   DMKELIEKVVDNNDFMEVQAGYAKNIIIGFGRMEGSTVGIVANQPLVLAGCLDINSAIK
FT                   AARFVRFCDCFNIPIVTFVDVPGFLPGTQQELGGIIKHGAKLLFAYAECTVPKITVITR
FT                   KAYGGAYDVMASKHLRGDLNYAWPNAEIAVMGPKGASEIIFRNEIKEADDPAAKLQEKT
FT                   DEYTNKFANPFIAASKGFIDDVIMPHNTRYRVIRGLRLMKDKDLQNPWKKHANMPL"
FT   gene            complement(449300..450298)
FT                   /locus_tag="Mmc1_0387"
FT   CDS_pept        complement(449300..450298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0387"
FT                   /product="methylmalonyl-CoA mutase metallochaperone MeaB"
FT                   /note="TIGRFAM: LAO/AO transport system ATPase; PFAM: ArgK
FT                   protein; KEGG: eba:ebA3741 arginine/ornithine transport
FT                   system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42913"
FT                   /db_xref="GOA:A0L4M0"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M0"
FT                   /protein_id="ABK42913.1"
FT                   /translation="MRHTGQEYIAGVLAGNRRMVAKAITLVESSRAEDRLLAREVLAGL
FT                   MPHTGGALRVGISGPPGAGKSTFIEVFGLYLIEQGLRVGVLAVDPSSRRSGGSILGDKT
FT                   RMARLTGSRQAFIRPSPAGESLGGVARCTRESQLILEAAGYEIILIETVGVGQSETLVA
FT                   GMVDLFVLMALPNAGDELQGMKRGIMELADLVLVNKSDGAFVDAAQRTAGGIESALRLL
FT                   HGGSVGWDPEVMTISAAEGRGLAEVWSLFSRFREGMTASGALAYKRQEQARAWMWDLVR
FT                   DGLTQRFMAHVQVKDILQGLELRVVAGEVTAVVAAELLLDRFTDGGGADGL"
FT   gene            complement(450310..452454)
FT                   /locus_tag="Mmc1_0388"
FT   CDS_pept        complement(450310..452454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0388"
FT                   /product="methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: dar:Daro_4006 methylmalonyl-CoA mutase,
FT                   N-terminal:methylmalonyl-CoA mutase, C-terminal; TIGRFAM:
FT                   methylmalonyl-CoA mutase, large subunit; PFAM:
FT                   methylmalonyl-CoA mutase; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42914"
FT                   /db_xref="GOA:A0L4M1"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M1"
FT                   /protein_id="ABK42914.1"
FT                   /translation="MAHSKPTLADWQALATKSLKGKPLESLHWHSAEGIEVKSLYTSAD
FT                   LTAHGWESDTMPGMAPYTRGPYPTMYASRPWTIRQYAGFSTAEASNAFYKRALAGGGQG
FT                   ISVAFDLATHRGYDSDHPRVVGDVGKAGVAIDSVEDMKILFDGIPLDKVSVSMTMNGAV
FT                   LPILAGYVVAAREQGVTEDQLSGTIQNDILKEFMVRNTYIYPPEPSMRIIGDIIVYASE
FT                   HMPKFNTISISGYHIQEAGADAALELAYTLADGKAYVETAISRGLTVDAFAPRLSFFFG
FT                   IGMNFFMEVAKLRAARLLWTRIMEGFKPSDPRSSMLRTHCQTSGWSLTSQDPYNNVVRT
FT                   TVEAMAAVFGGTQSLHTNALDEAMALPTDFSARIARNTQLILQEECHITHVVDPWAGSY
FT                   MMESLTRALAEKAWAIFEEVEAKGGMVKAIAAGLPSRRIEASAAERQARIDKGLDVIVG
FT                   VNRYRPPQEDPVDVLVVDNDAVRTSQVARLQWVKANRDNAQVAEILARMTAAAASGEGN
FT                   LLALAIEATAARATGGEITSALEQVYGRFQDKAQATTGVYGKVWEEDETWKALRRDIEA
FT                   FAQEEGRRPRLLVVKMGQDGHDRGAKVIASAFADLGFDVDLGPLFQTPEEAAQQAVEND
FT                   VHVLGVSTLAGAHHTLIPALIRALCAEQAEDVLVVAGGVIPEQDYAFLREAGVAEIFGP
FT                   GTSVVDAAGRVLRAIRAKRG"
FT   gene            complement(452884..453864)
FT                   /locus_tag="Mmc1_0389"
FT   CDS_pept        complement(452884..453864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE0977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42915"
FT                   /db_xref="GOA:A0L4M2"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M2"
FT                   /protein_id="ABK42915.1"
FT                   /translation="MQPIHRYGLALSLTVIGVLGAVFLYNALWDPLWYFAGNQFRPVNY
FT                   TFDERLSKTNQFLRHPDSYDCFIFGSSRTTLLNPQQIKGYRCFNFAFSSGRIEEIVAYA
FT                   RYVKKWNPNPKLIIVGVDLYNLAKWEDALSIPAFVQRMEKPPSALRSYLSWGAVALSRQ
FT                   LQRGQSPLPRYYDGQFICRVEDGLPPYQPALDRPSDRLKLPLGGHNLHHYAALAEIFPH
FT                   SQRLGYIPPESTRHVAFWLEHYRLETIINLYQQVKTHFTRFYDFALPSQITANPAYTYD
FT                   GSHYDLSVTQRIAHRLSGHVDEFGLEVTHDSTANWVTHYQSAINR"
FT   gene            complement(453873..455396)
FT                   /locus_tag="Mmc1_0390"
FT   CDS_pept        complement(453873..455396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0390"
FT                   /product="membrane bound O-acyl transferase, MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase, MBOAT
FT                   family protein; KEGG: mca:MCA3074 alginate
FT                   O-acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42916"
FT                   /db_xref="GOA:A0L4M3"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M3"
FT                   /protein_id="ABK42916.1"
FT                   /translation="MLFNSYTFLLYFLPTVWAVTMLLRRYATEQLTLPWLVAASLFFYG
FT                   WWNPRYLLLILLSMGINYALAGMILQRRGSVALLTVGILVNLGLLGWFKYALFVGHTLN
FT                   QLLHSSWSLPQIVLPLAISFFTFQQIAYLVDCHRQQVDVHNPLHYMLFVTFFPQLIAGP
FT                   IVHHKEMMGQFRGAEALRPSATDLYVGLTIFIIGLGKKVLIADTLAPHADVIFNQAEAG
FT                   GALSLVEAWLGVLAYTGQIYFDFSGYSDMAIGLGRLFGIHLPLNFNSPYKAHSIIEFWR
FT                   RWHMTLSRFLRDYLYIPLGGGHCAPWRRYTNLMLTMLLGGLWHGAGWTFMVWGLLHGTY
FT                   LMINHAWQHVGTKRFTLHPWFAVGLTFMAVVVGWVFFRATSFAGASHLLAAMFGLHGVT
FT                   LPATLAPWLPHWSWLNYTGIAPHGLLNHTTAIAQVGMALLAAWVLPNTYQMMRQHVAPE
FT                   LANQLSHSQASFQGLLWRPTARWGIYTGLILAGVLLSLQQVSAFLYFQF"
FT   gene            455552..456688
FT                   /locus_tag="Mmc1_0391"
FT   CDS_pept        455552..456688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0391"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   dde:Dde_3316 glycosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42917"
FT                   /db_xref="GOA:A0L4M4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M4"
FT                   /protein_id="ABK42917.1"
FT                   /translation="MRLSFLCHEFPPTGGGAASALDHFTRVLVKRGHRVQILTIGLGAK
FT                   TLRETLDERQIIRYGVGRRSMLSPTTTELLRSYWALRHRSKRDLAEFKPDCSVAFFAFP
FT                   AGHALLKQRRRLTGPMAVSIRGSDIPGFSKKRWGLFQWLQPWLVRPVLEGADRVFANGE
FT                   TLATLTRAFAPHIAVTSIPNGVDTQQFSPADRAVGAHDGPLRVLSVGQLIPRKQVALLL
FT                   AGAALLQRPLEITLAGSGPLEEPLKAQAAQLPPPIKVHFCGHTQREAMPQLYRAHDLLV
FT                   HLSGAEGVSNVALEALASGLPLLATPQALGPEFVGSRGVMVLHDPNEAALAEALLTLDS
FT                   QRQRLGQMGHEARHFAERFDWQRAAAQFEAQMSRLWLA"
FT   gene            complement(456772..457656)
FT                   /locus_tag="Mmc1_0392"
FT   CDS_pept        complement(456772..457656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42918"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M5"
FT                   /protein_id="ABK42918.1"
FT                   /translation="MLKRLWSLLFALCLVPVVALSTAHAEVYFPYVLADIAAPTVDDGL
FT                   TQVKDRLSGAGFDVVGQYALNGDAQVLIATSGAQQALAAKSEHGGFGAATRISVTAVEG
FT                   TVQVAYTDPRWMAHAYRLEDDGSALLGRLTAALGNKQSFGSAAGMEKERLRLYQYMIFM
FT                   PDFEDVEKLASHSNYQAAVAAVEAGLQKGAGGTAKVYRIDIPGKEESLFGVALNEGAGA
FT                   DKAVMGIIDTAPLKHTAHLPYEMLVSGGKVVMLHGKFRMAQSFPDLSMGTFMEISAAPD
FT                   AIVEALSQAASGK"
FT   sig_peptide     complement(457579..457656)
FT                   /locus_tag="Mmc1_0392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(457954..461298)
FT                   /locus_tag="Mmc1_0393"
FT   CDS_pept        complement(457954..461298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0393"
FT                   /product="transglutaminase, N-terminal domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase, N-terminal domain protein; KEGG:
FT                   sde:Sde_3099 transglutaminase-like superfamily domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42919"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M6"
FT                   /protein_id="ABK42919.1"
FT                   /translation="MTIQVAIHHHTQYCYDRMVNLSPHVFRLRPAPHCRTPIRAYSLKI
FT                   SPGNHFINWQQDPFGNYLARLVFQEKTDQLTVDVEVVADMVTINPFEFFLEDSAKAFPF
FT                   AYEQALREDLTPYLKMTEESPALKKWLKDFKGSKGTVDFLVELNAKLNKDIGYTIRMEP
FT                   GVQTCEETFSRGTGSCRDTGWLLVQAMRQLGLAARFVSGYLVQLTPDVKSLDGPSGPTE
FT                   DFTDLHAWCEVYIPGAGWVGLDPTSGLFAGEGHIPLACTPIPASAAAVTGATDKCETTF
FT                   HYKNTVVRIHEDPRVTKPYSSSQWSDILTLGEDVDKLLKKEDVRLTMGGEPTFVSVDDF
FT                   ESPQWTEAADGPHKRERAVDLLGRMRNHFAPGGIYHFGQGKWYPGEPIPRWRYGCYWRT
FT                   DGEPIWRDINLLGFPTVDYGYGADEAEAFMGELARRLGHLGKFVSPAYEDPFYYVWAEA
FT                   KLPVNLDPFKFNLKDGIERQKMAQVLQHGLQNPVGYVLPMAWNAYDQRWDSCKWSFRRE
FT                   HLFLIPGNSAIGLRLPLESLFYQSPAERPLTPEQDLFDTLGRLPKYKQLAKQAETKTAK
FT                   KGKEPAIPPHPQVETFMQTALCVEVREGRLYLFIPPLTHVEGFLALVSVIEATAQALGI
FT                   CILLEGYSPPEDPRLKKFYVTPDPGVIEVNVHPSAHWHEMVENTEALYEMAHQARLGTE
FT                   KFMLNGRQNGTGGGNHVTLGGITPADSPMLRRPDLLASLITYWQHHPGLSYLFSGLFIG
FT                   PTSQAPRVDEGRDDALYELELALSQFPSGQVVQPWIVDRLLRNILVDVTGNTHRTEFCI
FT                   DKLYSPDGPTGRLGLLELRAFEMPPHAQMSLVQMLLLRTIIARMWKAPYRHPLIRWGTD
FT                   LHDRYLLGHYVRRDMEEVVDDLNREGYPFQLAWLEPFFEFRFPKWGEIQVGDIHLELRA
FT                   GLEPWHVLGEEAGQSGTTRFVDSSLERMQVKVNGLHRDQYTVMCNGFELPLHSTGINGE
FT                   YVAGVRFKAWQPWAALHPLMPTHAPLVVDVVDLRNGRSLGGCTYHVGHPGGRNYDTFPV
FT                   NAYEAESRRISQFWNHGHTIGPFVPSPSPAGPGKFIPQGSGKVAPTPPLPLRSNEFPHT
FT                   LDLRRWG"
FT   gene            461462..463990
FT                   /locus_tag="Mmc1_0394"
FT   CDS_pept        461462..463990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0394"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF403; protein of
FT                   unknown function DUF404; protein of unknown function
FT                   DUF407; KEGG: sde:Sde_3098 protein of unknown function
FT                   DUF403"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42920"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M7"
FT                   /protein_id="ABK42920.1"
FT                   /translation="MTPKAIPIVDGAAGPAYDEAFEQPGKPRAHWRRYLDYLYSRGPQL
FT                   PVQLERDADRLMRELGVTYNLHGGSGRRGQPWPFDPIPLILDTGNWKALEEGVIQRHRL
FT                   LTLLHRDIYGKQTSVRQGLLPPELLYRCGQFLFAAHGATPEDMIPMPLYGVDLIRDRDG
FT                   RHKVVSDRTSSPSGHGYVLQNRRVMNRLYAESSQFNNVPVLLPFFKSMRSRLAGLTPYA
FT                   KHDAHVVLLSPGPANEIYVEHALLAHYLGLILSQGADLTVRNGRLWIKSLSGLLPVDVL
FT                   LRKVDESFCDPLELRDDSRLGVVGLTQVARSGRLALANALGTAMLENLALHAYLPRLAR
FT                   FFLDEPLLLENPYTLWMGDPLHRQLVAEEPHRFVILPARYDPSTPMNGLSRDEALEQAL
FT                   LEQPHAFVARERLYPSRTPSVQRGQITSQPVQMRLYLNSDGEDTAVMPGGLARVSPQVE
FT                   RLTFSPRQGGLSKDIWVMHDHPIEDRGGVITATSIDPSPMVGVPSRVAESLFWLGRYME
FT                   RSESAIRLFREHLMLQTQETGLGVRQRIHCRNRFLVAFTRVTGTRPGFEGEEGAYNLAN
FT                   PAPELRSALLDSDRAGSLAFSLRAMIQNAFSVRDRLSTDTWHVVDDIATVLDRLQQDPD
FT                   KDLQNLFWETAPLLHGLTAFSGLIWENMYRDLGWRFLDMGRRMERGLFLTHLLETTLGS
FT                   DADDSLEIAVLERLLAINDSLAAFRMRYRTQLGVPQVLEKLLQDETDPRSLVFQLELME
FT                   KHARAVATGADESFYRTHLGRVVFEALATVRLATPELLSKPEKAGGSRTHLVALLKLMK
FT                   KFLPLFSESASNSYFRHAEATHLLFKTGSE"
FT   gene            463990..464877
FT                   /locus_tag="Mmc1_0395"
FT   CDS_pept        463990..464877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0395"
FT                   /product="transglutaminase, N-terminal domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase, N-terminal domain protein; KEGG:
FT                   mag:amb0821 transglutaminase-like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42921"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M8"
FT                   /protein_id="ABK42921.1"
FT                   /translation="MEYRIKHTTLYQYSEPVTLCHNRAILKPKDGMGQKCHKFTLRIDP
FT                   EPAIMESHKDAFGNTVHYFEIHEPHKQLEITATSQLTRTPVLLPPMAMENSPAWESVRS
FT                   QFDAGDGNEDMVHVALYRMPSPMIPALPALAELTDPIFTPGRPILEATMAFTQAIHEGF
FT                   KYDPEATTIATPITAVLAQRAGVCQDFAHIAVGALRQIGLAARYVSGYLETLPPPGQPR
FT                   LEGADASHAWFSLYLPGLGWVDFDPTNGCMTESHHLVVAVGRDYADVPPVKGVVMGGWE
FT                   HTLEVAVDVVRQTV"
FT   gene            465047..466126
FT                   /locus_tag="Mmc1_0396"
FT   CDS_pept        465047..466126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42922"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4M9"
FT                   /protein_id="ABK42922.1"
FT                   /translation="MEKPCKVVGLVQCKNEWGLIALSITHALRNHVDEVFVLNDSSSDE
FT                   SYQGLLKLQTLFPGRLHLYHMLGDEFLEDSSRTVLMHLSQSAQADWCYTFDADEFLYTT
FT                   TGVSLKALLSTVAADVGALRYPLYNYLSLDTFDECQLHGYAALQWQAQVTQRAPITLAQ
FT                   IIEGVRQGERNLFTLPFFPKLIVRNDPMLRLHVGAHTVRDFNRTPKRLMHADTVAVVHL
FT                   PMLSWARLQRKARMGQIFVESGVSPQLGWQNQLVYRMQQEGRLPQMWRQHSLSAEGQLE
FT                   PDRPRNVVQDRRFVTLIAPTLKFLEEAFQSKDLRVFRGERLQRGAAPESTLPLQSVVRL
FT                   LHRFMGFEARYDEQLHQPK"
FT   gene            complement(466222..466947)
FT                   /locus_tag="Mmc1_0397"
FT   CDS_pept        complement(466222..466947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0397"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: nar:Saro_0725
FT                   chromosome segregation ATPases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42923"
FT                   /db_xref="GOA:A0L4N0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N0"
FT                   /protein_id="ABK42923.1"
FT                   /translation="MHQTALWHAALFFSTYHSRSQPESHPAQTSKRLLEIGGQNVNGSI
FT                   RDVAPEGIHYIAADFVAGNGVDVVLDDPYSLPYGENSFDYVMASSVFEHSQMFWLLHLE
FT                   IMRVLKPSGLFYLNAPANGQFHRFPVDCYRFYPDAGGGLVTWANRNGYQSALLESFVGK
FT                   QKQDEYWNDFVAVFIKDETHHAHYTARMLDKHPSFNNGLRYPDPESFIRLNPISEDQRK
FT                   LFAMTNMAQNRPLNHYLRD"
FT   gene            complement(467058..468056)
FT                   /locus_tag="Mmc1_0398"
FT   CDS_pept        complement(467058..468056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0398"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   sde:Sde_3100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42924"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N1"
FT                   /protein_id="ABK42924.1"
FT                   /translation="MLSRVAEHIYWLGRYMERAEDTARLIMATSGATLELMSVPGHQPV
FT                   DWEQLLLIVGVLPNYNEHHHTYEEREIVHFLLASERNPCSIYNAMRMARENLRITRDAF
FT                   PRETWSQINGLRRRVEHIPDFALYGSGRQDLLEGIIGSCLQMSGLLISTMSRDEAYQMF
FT                   RLGQLLERADMTTRILDVQGAGVLGGDSDAELSMEHAVWTTVLRSLSGDQMYRKQVEPR
FT                   VRGRQTLAFVLKDKQFPRAFYYCLNGVRDRLVKLGRAEAAQGILGELEKSLYLADLDTL
FT                   AKQGLHEFLDGLQVQLGSLHEAVVDTYFRFRQEETPPAAPASQTQSQEQRA"
FT   gene            complement(468056..469510)
FT                   /locus_tag="Mmc1_0399"
FT   CDS_pept        complement(468056..469510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0399"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: hch:HCH_00983 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42925"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N2"
FT                   /protein_id="ABK42925.1"
FT                   /translation="MAAKNLPTTGLTYEAPGLFDELIHYAQSNTGCDLLPHLLDMGLDT
FT                   LRTRQQGAELAIESLGITFTIYSEGQNIDRAWPFDIIPRCIPDGEWQQLEAGLLQRSQA
FT                   LNAFIHDLYNDQKIIKDKKFPGELLDKSKNFLPPLIGANPRFGVWAHVCGSDLIRDKDG
FT                   VMYVLEDNLRVPSGVSYMLENRQLTKRVFPELFQRYHIRPVDDYPSQLYDVLASLHPRD
FT                   QKPNIVVLTPGVYNSAYFEHAYLAQQMGVELVEAGDLLVDDDKVYKKTIRGLQRVDVIY
FT                   RRVDDLYMDPTVFIPDSLLGIPGIIKSWLKGNVAIANAPGSGVADDKVVYSYMPDIIRY
FT                   YLGEEAKIPNVPTYRCNDPVERRHVIKNMHQLVIKPANESGGYGIMIGNRATRVEREAY
FT                   AARIEEDPRNYIAQPILSPSTCPTLVEEGMEPRHLDLRPFILQGKKGYVTAGGLTRVAL
FT                   RRGSLVVNSSQGGGSKDTWIVAGRRD"
FT   gene            469978..470940
FT                   /locus_tag="Mmc1_0400"
FT   CDS_pept        469978..470940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0400"
FT                   /product="response regulator receiver protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: response regulator receiver; KEGG: mag:amb1682
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42926"
FT                   /db_xref="GOA:A0L4N3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N3"
FT                   /protein_id="ABK42926.1"
FT                   /translation="MLLTKLAQELKPLIRPNVSVLYAEDHGETRLIVTEQLFKPLGIAV
FT                   KACNDGFSAAQAFSTGHYDMLVTDFDMPNMTGSELLKHVRKSNANMPVLLLTSLATLEI
FT                   VRSIKDNNLFVLPKQEFNRFLDDARGESADEKRLSAKQTLVKFLEASGAIKPSSMGGKN
FT                   YAPPAKAKLVPSDEAKLKKIGAAGPCEFPLLGISLVDQQHRQLFQLMYALQAQIENRDN
FT                   RVDLMIMALNNYANKHLADEEALLQRYAYPRLADHQKLHIKLREDLVQRAHAVKQAADD
FT                   NEKFKRAEELRDFIQEWLVSHIGSEDRKHCDYLLSKGAV"
FT   gene            471369..472616
FT                   /locus_tag="Mmc1_0401"
FT   CDS_pept        471369..472616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0401"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: mag:amb3447 signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42927"
FT                   /db_xref="GOA:A0L4N4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N4"
FT                   /protein_id="ABK42927.1"
FT                   /translation="MSGADIKKKLVFKQKSKQPEQVSDQPPWVLGVVDDEPHLHEVTAH
FT                   VLRNFSFQGRRVELVQGYSGAEAKQLVCNHPDMAVLLLDVVMESDHAGLDVVEYVRDVL
FT                   GNQSLRIVLRTGQAWLFPEDEVFEKYDINDYLDKAELSAHRMKVALKAAFRSFETMRDL
FT                   ERSQQREQVLRQIAEQASQAKSDFVASLGHELRSPTQSIMGFNRYVMDAVSQSNIEPDV
FT                   KAEIAKFIRYAQISSERLAGLINNLLDLSKLESGRMEFAIEPHNIWDAVRFLQMEMEPL
FT                   LQEKGVTLEHPQCTEPLELLFDMGKIIQVLVNLLSNAIKFTPAGGVIRITAHALDTGRV
FT                   KIAVSDSGRGIPEEEIEHIFGRYQQSTSNQQSDGGTGLGLAIAREICLNHGDSLVAENN
FT                   PNGVGACFSFTLAVVG"
FT   gene            complement(472662..475031)
FT                   /locus_tag="Mmc1_0402"
FT   CDS_pept        complement(472662..475031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0402"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: dde:Dde_3113 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region, ATPase domain protein domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42928"
FT                   /db_xref="GOA:A0L4N5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N5"
FT                   /protein_id="ABK42928.1"
FT                   /translation="MSIRTQIVTLLLLFALLVAGLYGWVLNRHNNDALLFAADQKLGAA
FT                   AALVAQILPVEYHDHIEGADSVSQKKYQSIVQNYNRLCQELKLDGMWSVLWLDKQPYLT
FT                   SSTSRSLVLQQGDYPPFFAPHPHPELFSENTTTPDYRTITQKGVPLRMIQLPQLDKRGR
FT                   LYIIGATLPLLPLQEALLETVSPALTLVLVFFTLLLLFGFLGSAWISQPLQQLVRLAPQ
FT                   QTARAALVMLERTGSPEVETLLASLNALSKDFTDQCALNRTYQHLSYAMDTSPIATAIL
FT                   DNRGRLLYANARFRAAAGGQELTQPGAHMDQFQLGFPAALDRSWRKHVSLSQPWAAEVE
FT                   TNVSGAASGYERVTITPFRNSNHAEHAILFTLQNVARRKKLEQELRHEINFQRVLMNTL
FT                   PIPVFFKDTQGVFLGCNAAYCTLLGMAEWEIVGRTIFQILPNEAASFYHKKDNLVLQGG
FT                   GLLDYEGYLRNSTGQERLLHLFTAPFHNADRSLAGLVAAIVDITDRVLFESKIMQMNAD
FT                   LELRVVERTRDLEESMESVQRLQRLLVETETMATLGTMVAGVAHEVNSPLGVGVMASSE
FT                   LQQEVAKFRKTYETEGISEEEFEGFIHRSEDLLGLTVTNLRRAGELLQNFKRVAVDQSD
FT                   EAQHVFQLDEQIEAVLHALSYLFRKRAIQMRLECPKGLTIKSLPGAVSQIVTNLISNAI
FT                   KHGFDVGMRGTITLTVKRHDQQIILDFYDDGKGMDQETQEKIFERFFTTQRGSGGSGLG
FT                   MHIVQSLVVQKLRGSIHCESELGKGTRFVVTFPVEA"
FT   sig_peptide     complement(474960..475031)
FT                   /locus_tag="Mmc1_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.518 at
FT                   residue 24"
FT   gene            complement(475137..477728)
FT                   /locus_tag="Mmc1_0403"
FT   CDS_pept        complement(475137..477728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0403"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase,
FT                   HAMP region domain protein; KEGG: tdn:Tmden_0909
FT                   diguanylate cyclase/phosphodiesterase (GGDEF & EAL
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42929"
FT                   /db_xref="GOA:A0L4N6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N6"
FT                   /protein_id="ABK42929.1"
FT                   /translation="MASPLFLYNPLKSIKGFILSIAVGATLLMSLSLYWVISDIYERSV
FT                   RNDARKVATLMAEQTFQSMYQVMRKGWVRRDVEDFIGALRRSVEGGDYRLEVLRAPLVE
FT                   ELFGPIHQPALDEAVGEVVGTAERKLIDQPTSLRLIYPLLAREECLKCHTNANVGNVLG
FT                   VIDVQQNLVPILRRTRAEFINTLLWIAPIPLLAAFFVALWIHGRLVGALNYLRDRMTRI
FT                   NKVSDLTQLNEGTPPPTFCEVSEILEQINDFSRRLQSFAVDKELLEFEIRLLERFVITS
FT                   DVVKDWQNYVKQLLLEINQVMSTYALFSIFKVEEEQFDLEIFWRDPPSADTRMGIESII
FT                   CTELQKNNSFHVDSSVTRINHHVARPDASEMVVNPEVFRLQIKSLVVELPKIGGIVGIG
FT                   VHVDLTRDPTRILVMESTLSTLLNVVGSVKAISKYTRDLEFYATRDPLTGLYNHRILWE
FT                   LLRTEVERAHRHNHQFALLLVDLDNFKTINDSHGHAVGDDLLIAFADQIGATLRQGDIL
FT                   GRHGGDEFVIMLPEVEEGVPFAAAERILSATDKIRVQTHDGQSIGISASIGVAIFPDHA
FT                   NSAKDLFLFADNMMFKAKAEGKHRFTIPSEEDVVDAFKEIGEKSALVMRAIEEKWVQPF
FT                   YQPIFDGHTGEVVAHEVLSRIQVPDARLYSANEFIEIAERLGVVHKLDYVGMEKAFNQA
FT                   GREGYEGLLFINMSPKAMVLSEFFPTVKKMIEAAGLQKQNIVFEITERDTVRNLKNLEI
FT                   FIRNLHGEGYKFAIDDFGSGFSSFHYLKRFPIDYLKIEGEFIAHMLDDVKDLAFVRSMA
FT                   MLARDLGIATVGEFVESAAIAQECRTSGVSLLQGYHLGRPSAHFITNKVKV"
FT   gene            478142..478981
FT                   /locus_tag="Mmc1_0404"
FT   CDS_pept        478142..478981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0404"
FT                   /product="thymidylate synthase (FAD)"
FT                   /EC_number="2.1.1.148"
FT                   /note="TIGRFAM: thymidylate synthase, flavin-dependent;
FT                   PFAM: thymidylate synthase complementing protein ThyX;
FT                   KEGG: nse:NSE_0163 thymidylate synthase, flavin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42930"
FT                   /db_xref="GOA:A0L4N7"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N7"
FT                   /protein_id="ABK42930.1"
FT                   /translation="MEASTGTAFQSEPTLEMAAEIETRLQLNPDYTKRIGNFGFLELEE
FT                   SWGDEATIINTARISTTNKRVNSLDAFTDKERTLLHYLLAHNHGTPFETVHFRFRVVAP
FT                   IFVLRQWMRHRICSFNEFSQRYRMPITAFYVPDQEARTVDGFEVLSQESVERYCELVES
FT                   MHRFYHDEYQQVCTRIEAAEQAGLVEKTAGSRNPYRARARELLRNAMPVSTYSDLYWTI
FT                   NFRALMNFFELRRKANAQYEIRAYADAAYEMFCKKMPLLGETMNRVLEERAKMGEQA"
FT   gene            478978..479739
FT                   /locus_tag="Mmc1_0405"
FT   CDS_pept        478978..479739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0405"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: eba:c1A43 tRNA
FT                   (guanine-N(7)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42931"
FT                   /db_xref="GOA:A0L4N8"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4N8"
FT                   /protein_id="ABK42931.1"
FT                   /translation="MSQTPMPQPDQAPPVDVGQPVDEAEAKRRRFKTHGRKKGKVNDTR
FT                   LARIEAGLLALSLPPGSADRGALIDQLGGNGQSQRVILEIGFGNGETLAALAARHPEDC
FT                   FIGIDVFLEGFGTLLNRLTRGDISNVRLVCQNALQVLLERIPDASLDGVIINFPDPWRK
FT                   KRHFKRRIVQTEFLDALAPKMRSGADLTLATDWANYAEWMVAHLEPHTAFVNQAEPGPF
FT                   AAPPPWWIETNFERKGVAAGRIIRHLHYKKR"
FT   gene            479859..480380
FT                   /locus_tag="Mmc1_0406"
FT   CDS_pept        479859..480380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42932"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4N9"
FT                   /protein_id="ABK42932.1"
FT                   /translation="MILKQVGMTALLMMGMGSHGAMAADCAQLPNKMAKVRQHAQVFTQ
FT                   MNAETQALCWTKHPYFQELDGETCPRYQDNFAMGVARMDAVLGGIKYATTQLTAMGAYG
FT                   AELTRCSAPYMVQKSHLVGQTSQLLKALQTLGVKADECREAHERLGIWCDKQVALKTMQ
FT                   EIQPAVPVKE"
FT   sig_peptide     479859..479930
FT                   /locus_tag="Mmc1_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            complement(480413..481564)
FT                   /locus_tag="Mmc1_0407"
FT   CDS_pept        complement(480413..481564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0407"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: gvi:gll3752
FT                   probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42933"
FT                   /db_xref="GOA:A0L4P0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P0"
FT                   /protein_id="ABK42933.1"
FT                   /translation="MEYRRFGQTEKQISVFTMGGMRFLHVWDKPHDQLPADSEEHCYQM
FT                   LQTALDGGINLIETAKGYGKSERLIGRALPRLRQSRDQYHLMTKASPTETAGQMRRHVE
FT                   DALRHMGVDHIDFFALHGINTRPLLRLSLRSGGPMSALEALQREGKIGHIGFATHAPLP
FT                   VILDTIQSGRFAFINLHYYFFRQGNRTAIEAAAARDMGIFIISPQDKGGLLYTPPPRLA
FT                   EQSAPLPIANFNERWILSHPAIHTMTVGMSEPSHLDLHLHSLALGKPYWGAAERAVEIR
FT                   LKQAAATTELDRCGHCTACLPCPERIEIPDLLRLEHLARAHDMVAFAQYRYGLMEPNCH
FT                   WVPGAHGDRCSDCGDCLPRCPQGLDIPLLVRQAHTRMHKASGS"
FT   gene            complement(482389..484818)
FT                   /locus_tag="Mmc1_0408"
FT   CDS_pept        complement(482389..484818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0408"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: noc:Noc_2021 PAS sensor diguanylate
FT                   cyclase/phophodiesterase; TIGRFAM: PAS sensor protein;
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42934"
FT                   /db_xref="GOA:A0L4P1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P1"
FT                   /protein_id="ABK42934.1"
FT                   /translation="MIIGGWNFHALRFFRPSHMGGKPKRGEDPRGDIRMAVRRSKVMVP
FT                   LLGGFVVLLTVMVGMWGYNYKTSEALIGTLQGSMTTVHKMHIISELMEVIRARTRIAAV
FT                   MLDENDVFENDRRKMELDGLANRFITLRSELLKLPLDQVEKRILHDLSTNVIPTTVKSL
FT                   QEVIEVALWVEDSALRDAARRKLFNTVQPGQGQVIDHFMQFQTHLETQITQATAVTISS
FT                   YRTNLHSQLLVLLLVLLVVLLTSYITMRRVMGIESTLHYEKERAQITLISIADGVITTD
FT                   TEGYIQDANKVVGALLGHKPASLIGKQLEQVFPTRARDEESPPLHEDLKTLLSSATPQS
FT                   MNTMVVLESDGDDLLLDATLSPVQSSEGVVLGAIITVKDVTEQQRMSEKIRYQARHDHL
FT                   TGLYNRHAFADLCRESMEAMKADEVHCLCVIDLDRFKAINDTCGHKAGDMALKQISTMI
FT                   QGCVRKYDYAARIGGDEFTIFLADCSQADGVKVMEKLLEQVQDYRFLWEGQQFNLGFSI
FT                   GICEIHFQVPFEKSFQAADAAVFQAKDDGRMCIRTRTVESNLLETPTKEETNWVGRLHR
FT                   VLGVEPLALVAQRMVPSPSMQDHPPLYEIFMRLPDGEKHHPPNAFLPTAERHGLTGDLD
FT                   YKVLKMALDNLLLHSDGRIYSINLSAKTLEDKASSAALLALLAAHPKRAKQICFEIDEN
FT                   TLINNMEVCSQFLFEVKQHGAVTALDNYGGSLGNCLYLEQLGLDILKVDGQLVQQAKNK
FT                   LSTRTVVSSIHNISHSMNILTVAKHVEDAELAAQLLTIGFDFQQGFYYAKPEPLMV"
FT   gene            complement(485153..486040)
FT                   /locus_tag="Mmc1_0409"
FT   CDS_pept        complement(485153..486040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42935"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P2"
FT                   /protein_id="ABK42935.1"
FT                   /translation="MTMFYPRALTIRRHVATLLLGGLLLSGCQSNPYTSRLHKMARQAM
FT                   LSYHLLPGVTFDLASWQRTETPGAVLHLYVESSGFVQQGGGQLSQDPTPHHPMAFYLAA
FT                   VDPHPNVAYLARPCQYVLENPQQRRNCAPRYWSSHALDDVVMADLLRATDWLQHAAGAT
FT                   QIHLIGVGSGASAAAWLSAKRPAVTRFLSVDGIFTPQAAPPLELPPPSELPPSLSTMEA
FT                   FNLLAQQLASVPQRHYITGLDHTLSSNHIQPFIITMGRHACAHVALHRYADLNQLLKHW
FT                   PSLLTEPLHCADRS"
FT   gene            486406..488379
FT                   /locus_tag="Mmc1_0410"
FT   CDS_pept        486406..488379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0410"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: gme:Gmet_0069 diguanylate cyclase (GGDEF
FT                   domain); TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; HDOD; SMART: GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42936"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P3"
FT                   /protein_id="ABK42936.1"
FT                   /translation="MASVLTQGDIASLGLPNTLLELLQSTRLERTNAADVVAIVERSPD
FT                   LAQAVLDCTGESERGLHGAVVQMGFNALRATALERLIFKHFITVQPAKESSFDRMTLWR
FT                   HNLWVACACRHIANQVGYGDCEEAYMTGLLHDLGKLLIDALGAMDYAALQEISMRTDWD
FT                   GVTYERSLLGVGHDGVGAHTLHKWGMNTSVVLAVALHHSRYQAKEIGQQAAQLTAIVQL
FT                   ADFLAWIQGLGSTVRGQHPVLPPEVSLYLPLNRAAYATIVEQVNGEIKRIAAHDGIDFP
FT                   DSLTFNRNLLDAGISLARVNTELKYDNRLKYQPKLAAVPLPSPVQETLLAPHKSLIKKE
FT                   ILHNTLESVCAAFQVKRGVVFHVDPVKRCLVNEAIYSTDSDLLMPLKHLQEIPLNDEPS
FT                   AFLECLRQRKQFLLSGQTPLEKQVRNQIGARQMALTPIVGPQRAYGIIALDNGRDGADL
FT                   NLAGLASLTQVAHELGMALEHAQQLQIANQMAHRDALTKLYNRGRIDEIVQEAFQQVQQ
FT                   QGGELSVAMLDVDFFKKFNDTFGHQMGDNVLKLVAAVLKKLTRGNGSVGRYGGEEFIVV
FT                   LRDTDYREAARYCERIRLAICQVGEAMARRYAGRPLSISIGVTCYDASLVSKDEMVRLA
FT                   DRALYMAKDGGRNQVIGLKPGG"
FT   gene            complement(488380..488745)
FT                   /locus_tag="Mmc1_0411"
FT   CDS_pept        complement(488380..488745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_3452 sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42937"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P4"
FT                   /protein_id="ABK42937.1"
FT                   /translation="MLECIARIENDRLTICLPRDFSNRHYPSFRASYKDHPNHWHYIID
FT                   CLQVTHLDSGALGMFLLLAQHIGTGDGHIRCINCKPLLAKQLQAAGFAQLLTIETLYQG
FT                   GGSNLHDGINPLASYAW"
FT   gene            complement(488880..489359)
FT                   /locus_tag="Mmc1_0412"
FT   CDS_pept        complement(488880..489359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42938"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P5"
FT                   /protein_id="ABK42938.1"
FT                   /translation="MAKKKKKGAKEKLLSAAKRLKQEERARKKLMQATKQLKDQKKASA
FT                   REDAPSGRGAIRVAQHLLTTPQPEPPRQPPPPVQASVPTLKEITPEILDLDRLHILGQI
FT                   LDYAIAHNFLDEETVLRWGKRCVNDPMLAKLNLTVHDEKLPPTKPIRLKPNLYGG"
FT   gene            complement(489526..490686)
FT                   /locus_tag="Mmc1_0413"
FT   CDS_pept        complement(489526..490686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0413"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bha:BH2688 alpha-D-mannose-alpha(1-6)phosphatidyl
FT                   myo-inositol monomannoside transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42939"
FT                   /db_xref="GOA:A0L4P6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P6"
FT                   /protein_id="ABK42939.1"
FT                   /translation="MATLMLTCRQIDLVLLLSERVPLQSWAQKGMLERELALYRAMQPH
FT                   LRSITLLSDGNRHELDFRPQVPGMHILCNRWGLRPWHYQRWLKMPWRGWQRGHVLFKSN
FT                   QLSSALLGLSLANHFKQKSITRCGYLLSEFAALHHGAASLARVRAFSREHRAFHGAHRA
FT                   VVTTPHMHSLLQQRYGIDPQKIFVQPNYVDCDLFQPAPRVQQNATTQRLLLVGRLHPEK
FT                   NILALLQAMIGLPKLHLDLIGQGEQLETLQQFVAQQALSVTFHGALPHRALVDFYQQCD
FT                   LFVLPSLQEGHPKALLEAMACGAPVLASDAPGNRDVVMHGNNGWLCQTDSASIRHALQQ
FT                   LLPNQAQRQSLGQQARHYALQEVSLPVIAAREMALYEAIFNDSQRP"
FT   gene            complement(490805..491749)
FT                   /locus_tag="Mmc1_0414"
FT   CDS_pept        complement(490805..491749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0414"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="KEGG: mag:amb0663 thioredoxin reductase; TIGRFAM:
FT                   thioredoxin reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42940"
FT                   /db_xref="GOA:A0L4P7"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P7"
FT                   /protein_id="ABK42940.1"
FT                   /translation="MSEAKHHKLIILGSGPAGFTAAIYAARANLSPVVIQGLQPGGQLT
FT                   ITTDVDNYPGFADGIQGPELMQRMQAQAERFNTEVIFDTVMHADLSKRPFTLNCDSGDV
FT                   YTCDALIISTGASARWLGMESEKKLNGFGVSACATCDGFFFKNQDVCVVGGGDTAVEEA
FT                   LYLSNICNKVYLIHRRDALRAEKIMQDHMFAKENIIPVWDSVPDEMLGDPNKGGLTGVR
FT                   IKNVKTGALSELTVTGCFIAIGHRPNTEIFGDQLDKDANGYLVTKPGSTAMNIEGVFAA
FT                   GDVQDTVFRQAITAAGTGCMAAIEAERWLAAHA"
FT   sig_peptide     complement(491663..491749)
FT                   /locus_tag="Mmc1_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.519 at
FT                   residue 29"
FT   gene            491956..493428
FT                   /locus_tag="Mmc1_0415"
FT   CDS_pept        491956..493428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0415"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: mca:MCA0509 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: cysteinyl-tRNA
FT                   synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42941"
FT                   /db_xref="GOA:A0L4P8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4P8"
FT                   /protein_id="ABK42941.1"
FT                   /translation="MINKENSVGITIYNTLGRKKEPFVPMIPGKVGMYVCGVTVYDYSH
FT                   IGHARVMVVFDVIARHLRVTGFDLTYVRNFTDIDDKIIKRANERGESIQTLTQRYIDAF
FT                   HQDMAALGVQPADIEPKATEHLPEMMQMIGTLMDKGVAYASGGDVYYAVERFANYGQLS
FT                   GKVLDEQEAGARVEVDSNKQNPMDFVLWKGAKPEEPQWDSPWGAGRPGWHIECSAMGTK
FT                   YLGASFDIHGGGRDLIFPHHENEIAQTEGCTGQHAVNYWIHNGFVNVVNEEGESEKMSK
FT                   SLGNFHTIRDLLALYPGEVLRFFILNSHYRSPLDFSFSLLEAAKAGLDRIYTALRSAQA
FT                   LLGKLPGTPIGEPADVPAGAPQDLVENYLKAMDDDFNTPQAIAFLFEAAKMLNTAISEQ
FT                   KDPAVIATWARLIRGLGHHLGLAGQDPELWFRSGIGAEQGLQAEAIEALIAERSAARAA
FT                   KNWAESDRIRDTLAQQGIVLEDGQHGTQWSRK"
FT   gene            493425..494165
FT                   /locus_tag="Mmc1_0416"
FT   CDS_pept        493425..494165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0416"
FT                   /product="23S rRNA Gm-2251 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase, substrate binding; KEGG: sdy:SDY_4409
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42942"
FT                   /db_xref="GOA:A0L4P9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4P9"
FT                   /protein_id="ABK42942.1"
FT                   /translation="MSDETKIHGVNPVQALLESGRPVSSLWVLKGRHGKRVEEMIEGFR
FT                   ARGVPIQFCERTAMDRMADGGAHQGVIARCAPREAMSWDDLLDVVEKAKQPLLVILDGV
FT                   EDPHNLGAIMRSAEAFGALAVILPKDRTAPLNAGAIKASAGAAERLDLIRVTNLARAIE
FT                   QLQQRNVWVIGLAGEAGAPLIGTLDCKGPLALVMGNEGSGLRRLTRERCDQLAAIPMGG
FT                   GVGSLNVSVATGVALYEVLRQRAG"
FT   gene            complement(494360..496465)
FT                   /locus_tag="Mmc1_0417"
FT   CDS_pept        complement(494360..496465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0417"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mag:amb3272 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42943"
FT                   /db_xref="GOA:A0L4Q0"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q0"
FT                   /protein_id="ABK42943.1"
FT                   /translation="MDAAASPLPGLRDELSLHPGPALWDGSPTWTIRDPVRNRYFRIGW
FT                   AAFEALSRWEGTAGEVAAAVRAETTIDMSDAEVMEVARFLSGNQLTQASSHADTVRLTA
FT                   QATAENHSVFNRLLHHYLFFRIPLLRPDRFLGKVLPLVAWLGSPWFRWASLGALLLGLT
FT                   LVARQWELFAATLVETFSISGMVSYGLALSLVKIIHELAHGLTAKRFGCRVPTMGVAFL
FT                   VMWPVLYTDVNETWTLASRRQRLLVGAAGIMAELSVAAWATLLWAFLPDGSLRQGAFIL
FT                   AAFTWVSSLAINLLPFMRFDGYFLVMDALELPNLHPRAFAMARWWLRESLFALGEPPPE
FT                   PMKPGRQRAMVAFAFAVWIYRLMLFLGIAALVYHFFIKIVGILLFAVEIGWFVLLPIWS
FT                   EVKAWVKRRERIFCGTRWMRPLFGLSLVLWVAIFPWRTRIEAPATVAAEIVAPLFLPAA
FT                   ARLEAVLVKRGQPVHAGMPLLLFTAPDILARQATIAAKLAGKRAEVEAVKLDLFGRERL
FT                   SALTEELARLDSEKAGLDAEAERLTVTAPHSGLFLDPLPDLQVGAWLSPRQQLALIRAD
FT                   GATIATAYVAEDDLERIHEGDAVRFIPYSLDQASMVGTIHTMDRNPVKVLTDPALATLY
FT                   GGEIPVRVSGQNLVPQGGFFRIIIHLEGLPPPIKLVGHVQISGQAQSLVGRVLRSALVV
FT                   LVREWGA"
FT   gene            complement(496468..497778)
FT                   /locus_tag="Mmc1_0418"
FT   CDS_pept        complement(496468..497778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0418"
FT                   /product="membrane-fusion protein"
FT                   /note="KEGG: mag:amb3273 membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42944"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q1"
FT                   /protein_id="ABK42944.1"
FT                   /translation="MSDNPLVALLGLEELARKAVDSAALGFVMVNDSRRLALYRQAALY
FT                   IDGEGLKAVSGVTGIEKGAPFTLWLQRLLKRFAAEDVRQLGPHDMEGSDRQEWSEWLPS
FT                   HALLLPLAERDGKRLGVLLLAREEAWSEQEVALLTRAADFYGHAWSVLHRPSRWVTWKS
FT                   GLMAIPKWPLKLAVVMVVALCIPVRLSVLAPAEVVPHNPAVIRSPMDGVIQRVHVRPNQ
FT                   SVAEGDLLFELERTMLASKLEVAKKALDTARAELDQASQQAIFDPKAKGTLAVIRARVE
FT                   ERSAEVAQLEELLARAQVQAPRGGVAVLDDPTEWQGRPVVVGEKVLAVASPHDVEVEAW
FT                   LAPADVIQLEEGGPVSLFLNADPLSPVSGKLRYITYEAIPQADGTLGHRVRAELNKGEA
FT                   GPRLGLKGTVRLDGRRVPLIYWLGRRPLAIIRTFVGL"
FT   gene            complement(498020..498748)
FT                   /locus_tag="Mmc1_0419"
FT   CDS_pept        complement(498020..498748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0419"
FT                   /product="membrane-fusion protein"
FT                   /note="KEGG: mag:amb3274 membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42945"
FT                   /db_xref="GOA:A0L4Q2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q2"
FT                   /protein_id="ABK42945.1"
FT                   /translation="MIRGITLAACLCCCGLATAAQDLTIPVQLVAVQFTTLSAELPGKI
FT                   DRITVKEGERFKGGRVLVGFDCTIQQAQVQEASAVLAAAEKSKAVHKRLLELHATGTLE
FT                   AEKSVWDAEVAQAKLNSARAAASKCIIVAPFSGRVAEQKARAFQYVQVGQPILDILDDS
FT                   AFNAEFIVPSSALSTLKAGSQLQIVVHETGKLYPAKVARIGAKIDAVSHSMKVVAEIRG
FT                   DYPELVAGMTGRLQFTPIPP"
FT   sig_peptide     complement(498686..498748)
FT                   /locus_tag="Mmc1_0419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.436 at
FT                   residue 21"
FT   gene            complement(498745..500403)
FT                   /locus_tag="Mmc1_0420"
FT   CDS_pept        complement(498745..500403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0420"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   mag:amb3276 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42946"
FT                   /db_xref="GOA:A0L4Q3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q3"
FT                   /protein_id="ABK42946.1"
FT                   /translation="MTTITNRRSTRLLAALSALALLSACSVKPTPFTQAEFAAQAKADR
FT                   TAMFQGQQAVTTPLTLNEAVARVLKYNLDKRSKMMDEALALGQTYLDRYDLLPKLEINA
FT                   GHTERSEINATRSRDLVTQTTTANPTYSEDRSSTTADLGLTWNILDFGVSYFTAHQNAD
FT                   RALIAQEKRRKTINNLVQEVRFTFWRAAAAQNLKTRVSQVIATAESALQDSERVEGERL
FT                   RNPIESLRVQKTMLESIRQLEAIDQELNAAKAELAALINLPPGSDFQLDVPSNDGMAIP
FT                   EWPLSVEEMEEAAMVNNPDLREQGYQSRIALDDTRKEILKLLPGITLSFSRQYDSNSFM
FT                   VDNRWNDAGAKVTWNLLNLLSGPDRIAHSESVEKLAEVKRLALRMAVLAQVHVVSHQFA
FT                   SASKQFERAHKLWTIERRLAEAAGNQSRGGTVNEIERISTETSAIAAELRRYQTYAQVQ
FT                   LSYGKLQATIGADPVPERLASHALDGIAGAIVLDPVGGTQHVLAEDDLFRQQDPTHTVR
FT                   DENAEPLADADAHTGAALSWLEDSTSKAIKTEGHE"
FT   sig_peptide     complement(500287..500403)
FT                   /locus_tag="Mmc1_0420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.656 at
FT                   residue 39"
FT   gene            complement(500425..504396)
FT                   /locus_tag="Mmc1_0421"
FT   CDS_pept        complement(500425..504396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0421"
FT                   /product="Cadherin"
FT                   /note="PFAM: Cadherin; SMART: Dystroglycan-type cadherin
FT                   domain protein; KEGG: mag:amb3277 RTX toxins and related
FT                   Ca2+-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42947"
FT                   /db_xref="GOA:A0L4Q4"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="InterPro:IPR030916"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q4"
FT                   /protein_id="ABK42947.1"
FT                   /translation="MTDHKSTHRRTALGLLALEPRWMFDGAGAIDATHASQDATVDTQD
FT                   ATMYVSVPEVPGAVATPPIRVLLVASNVADGDDLAAAAQEGVVVVRYDAFNDSGAAILE
FT                   KIAQALDGREADSIAFATHNAGTGALDITEALPMDLASLAANGEARAFWTEIGTMLNQD
FT                   GHIDLLGCEVAGSVQGDMLVSLISDIAGRAVAASDDATGNAASGGDWVLERGNVDAATT
FT                   YFDGERLQDFTGLLRGIELWSTDGTSDGTQLVKDITGTSGDSYPTPIEGTSERDSTVSR
FT                   SFTVMGGYLYFQAIDGSHGSELWRTNGTTAGTTLVKDINPGSNSSSIQYAVVCNDILYF
FT                   SANDGSGAALWRSDGTSSGTVKVTAATTAGITNPVALTVLSGKVYFIGDVPFQGSELCV
FT                   YDPVGNTASAVTDIFPGSTGGVSALENLGTQLVLAAKDSNSNGLEVWVSDGTAAGTTLV
FT                   KDVRPGPSSGLTLYTPYQFFTVINGKAYFAASDGSHGIEPWVTNGTADGTVMLADVNAG
FT                   GDSSPLNFTAVGGDVYFTAYDGTASQILTTSGTFASTVSVAGGFNSTPQFLIGMNGILY
FT                   FSSSNTDFNEEFYFSDGASAGVVKNINIYGSGNDKFYYPAVYNNNLYFRAQDGLTGNEL
FT                   WRSDGTSAGTTQVKNIHSGGYSSSPQYLTVFNGKLYFSGRTTSQSEDNYYGPIFSSSGN
FT                   AVFSENGGGTVFTAYANADGEVIFTLGGADADKFDINAATGVVTFKSIPDYETPASAAG
FT                   SNYYELTITATDTSGSMDKALQVLVHNVAPIWSQSAVEVADTSANGTSVATPSSTGDTT
FT                   SVTWSIQGGNASGLFAINASTGAITIADATKFDHATTPSYTLSVRASDGTTNTDHDITV
FT                   TVTHVTPGPTFTSGATATFAENGTGIVYTAAATTSGGTVSYAIGGTDGAKFNIDGSSGA
FT                   VTFKAAPDFEALASAASSNAYTVTLSATDDNGTHTQDVVITVTDAAPAWTALAPVSLND
FT                   NSTAGAVVATPVATGDNSGVTWSIQSGNASGLFAINAATGVITVADASKFDFSNTPFYT
FT                   LSVRATDGNTSADHNLVVAVVHVPSPTSAAQPLPAPPAPPAPPSAPPPVVVAPVGESTV
FT                   TVLRDNAPSQSFIPLPAVSLRATPPAASDAARTAPAALPASAASVVPVVMTAQFTVSTE
FT                   LGGFRVPVVTASQGGPAVEGLIALHPEILAPDMVDDVVRVSLPADAFAHTRTDAVVVLT
FT                   AARINGQPLPSWLNFDSRSGTLSGSPPADLKGTTVVKIIARDNLGNEAIITVRINGQTE
FT                   RSGALRDAATHKLVETLTGKPAFTQQLKAAARLAAVRFG"
FT   gene            complement(504393..505118)
FT                   /locus_tag="Mmc1_0422"
FT   CDS_pept        complement(504393..505118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0422"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mag:amb1138 AraC-type DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42948"
FT                   /db_xref="GOA:A0L4Q5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q5"
FT                   /protein_id="ABK42948.1"
FT                   /translation="MEQERHYFSVGDGVEIGVIEGVSSMPFPYAEIHLHTYLPKSDSGH
FT                   SRTKAALLVHLTKDEWRSLLQNVPIENGILTGKMTKFHINNPVLVRRVALEILKSGYND
FT                   AGRSMFLRAKVVELFVELLARPHAQGRFTAAFAARRILARDPLHMPTMAALSRMVGVTQ
FT                   RKLGAEFRQAFGLSVSAWLADWRLGRGLELVTADDLSMADIATALGYAHLSAFTAAFTK
FT                   KFGISPTKARSYRVLEVQP"
FT   gene            505311..506306
FT                   /locus_tag="Mmc1_0423"
FT   CDS_pept        505311..506306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0423"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mag:amb1137 AraC-type DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42949"
FT                   /db_xref="GOA:A0L4Q6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q6"
FT                   /protein_id="ABK42949.1"
FT                   /translation="MERMKDKETPILSREWSLDSGYSSNQLPEEAHPGFPPHVGQETLS
FT                   HIDLGEGCDAFHYRGQAFHRLHIKVRIETDEPFLMIRAPLAGVANFNFEGVGQTEDSPD
FT                   RINLFVHGNPEDACISTHPAHEAMDVVGIMLSASRLLSLCDGMKLPRPLEALSGPHAAN
FT                   AMASLTMSTTSRRLFKALVATPYAGALSRLYGESKLMEIAAAILTDLGAQAQESTRLLG
FT                   KEQAKIKQACEYLRSKLTDLPSQERLANLVGLSQRQLATAFRQFTGMTMPEWILERRME
FT                   MAADMLRSGELAIKQIAFQLGYAQVSGFTTAFSRHFGMAPADFRKSISGT"
FT   gene            complement(506325..507140)
FT                   /locus_tag="Mmc1_0424"
FT   CDS_pept        complement(506325..507140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0424"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: son:SO0837 beta-lactamase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42950"
FT                   /db_xref="GOA:A0L4Q7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q7"
FT                   /protein_id="ABK42950.1"
FT                   /translation="MFRWRFWQRCLFTLHLLLGGAVGAWANDAQLAELFTQQGVKGTLV
FT                   IASLDGEKQFEHNSSRAAQRFVPASTFKIPHTLIALQEMAIYPQEVFIWDGQHRSYAAW
FT                   NQNHTLATAFKVSCVWCYQELTNRISGLAYQDYLQKMAYGTAKLGPELSTFWLKGDLKI
FT                   SAREQVTFLRNLYHQGFTIAPPYYHLLKQMMQVEKTDRYSLYAKTGWGSGVIPQVGWYV
FT                   GYVESPSGVWLFALNMEITNPDQLPLRQQLVMAGLRTKQIIVDHAAALP"
FT   sig_peptide     complement(507060..507140)
FT                   /locus_tag="Mmc1_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.689 at
FT                   residue 27"
FT   gene            complement(507150..509831)
FT                   /locus_tag="Mmc1_0425"
FT   CDS_pept        complement(507150..509831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0425"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: dar:Daro_4142 PAS; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold-3 domain
FT                   protein; SMART: PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42951"
FT                   /db_xref="GOA:A0L4Q8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR033414"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q8"
FT                   /protein_id="ABK42951.1"
FT                   /translation="MSVFHHNQPRKVDRPIGRRLTLVMIGVSSLITLLATGFQLYDDYQ
FT                   GGINRIQSSLEMVQQSRLKALSHAVWVEDNEQIRLHLEGIMQLPDLDQAAIFVEGTMQW
FT                   YRGIVSSAHYITRHFPLNYPYGDTIQELGSLRVVASVDRVRARLIHSIPFMLASNALKI
FT                   TAVALLLLLLFHLWVIRYLGQLAHYASSVDLEQPPPDSIVLRAPSHHTDELDTITDALL
FT                   GMHHKIRTVYQDFKSREESLRTLLESTRAVGWRLNLTKKRLEYISPQIYTLLGYPPESW
FT                   LDLAVWQSRIHPDDRLATLTSMERILAQPREHSMEYRMLAADGRTVWVRDMSSPLSGDK
FT                   PGTFTHLGGFLLDISAQKDLERRLRTTTERAESASRAKSDFLAVISHEIRTPLNAIIGM
FT                   GEVLLDDPLTTEQKHYAMVSQQAAHTLLDLINDVLDLSKIEAGEFQLEHAPYDLVGLIH
FT                   SVVEVNTITANQQGLPIECNLPDTLPTLMHGDLRRVRQVLFNLLGNAIKFTEQGLIRVE
FT                   TERLETPVASWIRISVKDTGIGIAQEKQSLIFDAFTQSDGSITRRYGGSGLGLTISKRL
FT                   VEMMGGKIGVDSQLGKGSHFFFTLPVTARWDVLEPLYPPPATLLQQQRILLIHSDVENR
FT                   DRMQTLLEQAGATVILGGDCRQPTACLAQLDASLDGIVMNCGTLNSAGLNHLEQHLAHY
FT                   PKLAKRTVILTNKVRGSLLDRTTPLGIHYLNTPVQAEQIYPLLKGISDTSSLYQTPFVG
FT                   HTEGATPLLTQANVLVVEDSEDNRLLIRTYLKKSPYILDFASNGLEAIEKWQQNHYDLV
FT                   LMDIQMPLMDGLTATRHIRKQERREQRPHTPIVALTAHAMASDHQNAMAAGCDDFLTKP
FT                   IKRDTLFKALHHHLPALETNQS"
FT   gene            complement(509828..510727)
FT                   /locus_tag="Mmc1_0426"
FT   CDS_pept        complement(509828..510727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0426"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="KEGG: mag:amb2214 hypothetical protein; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42952"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Q9"
FT                   /protein_id="ABK42952.1"
FT                   /translation="MRLALGYLLSFFYAVALFSSAQAHDILQIPMDSPFYDFCAGMDAF
FT                   QHLDGDHSALTEHHPAPCLCGEKWHTLKASLRLNTTSSNPLSNDSFTGFQDLLTLEAFC
FT                   RQNLRISLTHLAGKPSLHMANRGVDDGTVGRIASLLEDAHLSNLVAVPESIMAWDFSAF
FT                   TRTPSMQPHSWAELAPYHVAYNRGWIILDHAIRTTKSTVRTQDSVQLLTLLAKNRVDVV
FT                   VVEKWQGLAAASQIGMQPLYLVNPPLASQPMYLFLHRNHRDLVKPLAATLQQMKQDGTY
FT                   QAIFAHTLQPLIAPIVTP"
FT   sig_peptide     complement(510656..510727)
FT                   /locus_tag="Mmc1_0426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.607 at
FT                   residue 24"
FT   gene            complement(510813..512573)
FT                   /locus_tag="Mmc1_0427"
FT   CDS_pept        complement(510813..512573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0427"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /note="TIGRFAM: para-aminobenzoate synthase component I;
FT                   PFAM: Anthranilate synthase component I and chorismate
FT                   binding protein; KEGG: sru:SRU_1685 chorismate binding
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42953"
FT                   /db_xref="GOA:A0L4R0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR010118"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4R0"
FT                   /protein_id="ABK42953.1"
FT                   /translation="MPALWVDVAPWGQPLQFDKPFAQRQAEQAEQVAPLLRWADVQAHQ
FT                   GHWVAGYVRYEAACAWDLPVHPTTQPLAWFGCYAPPQPACYPHLPTPPPVTLELLIQQA
FT                   RYDQDLKRILDFIHAGDTYQVNHTVRALPHFEGTLLDLFLDRQARYRFPYAIWLESPGT
FT                   SVASLSPELFLHRQGSLVTTAPIKGTRPRGETLAEDQQLAMALSQASKDAAEHIMIVDM
FT                   ARNDLGRVCETGTIRVPHLKNRRSFATVHHLESRVEGRLREGLDLAHLFEALFPAASIT
FT                   GAPKKRTMEIIKSLEPQPRSLYTGCVGVIRPGGEALFNVAIRTLEQQGHTPPLLGLGGG
FT                   IVADSQPLDEWQELAHKGGFLTNPPTLEAPGLIETMGVADAGMIPWRTQHMARMRHAAA
FT                   ALGIPFNAQTAQDLVDTALVQKPHMVRLALHSSGFLEYTTPPRPQPQHGLKLWIYPHAV
FT                   DGEDPLLRYKTSRRTLFNEALSQARAQGFDDVLFVNTHGHVTECAIRAILLQCHGQWYA
FT                   PPLQDGLLDSLWRRHALAHYGATPRSLSLADLQQAQQMRVGNALQGEQSVLSLHTCTDP
FT                   WVSYHSFSTF"
FT   gene            complement(512774..513661)
FT                   /locus_tag="Mmc1_0428"
FT   CDS_pept        complement(512774..513661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0428"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: chy:CHY_0065
FT                   putative succinate/fumarate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42954"
FT                   /db_xref="GOA:A0L4R1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4R1"
FT                   /protein_id="ABK42954.1"
FT                   /translation="MTMNFAYYIGCAAQQTQKEADWAAEAVCEELGIKLHRMKKATCCG
FT                   AVSLRETKPAFALAVAARIFVEAEEMGMDIATICNTCLQTLSQANHRLKNDDELLDSIN
FT                   EVLKKSGVAPYKGTVKIKHLAWVMVDDVEADVLKSKIKKPLNGLRVAPFYGCHSLRPAE
FT                   IFEAEAGEKAKHLETLIELMGGNPVRFDGRDKCCGFHVMLSDAKEMRQMVFNNTTSAKE
FT                   AGADVMITPCTLCDMAMGSYQGIAEKSVGKKVGLPEMNFAQLLGCAMGLDEKRLGLNRL
FT                   HVSPRPQLVARGVL"
FT   gene            complement(513677..514663)
FT                   /locus_tag="Mmc1_0429"
FT   CDS_pept        complement(513677..514663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0429"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: gme:Gmet_0309 succinate dehydrogenase/fumarate
FT                   reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42955"
FT                   /db_xref="GOA:A0L4R2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4R2"
FT                   /protein_id="ABK42955.1"
FT                   /translation="MSDQVYTLRIQRNVRRDDGTLETKWDEFQVKATPLTPVLNLLEDV
FT                   KGNQDGSLTFRQSCRSAICGSCAMRIGGKTRLACKTQIGEVVDENNTVQIAPQQNSPVL
FT                   KDLVVDITKFFNKVHQIKPYLQEGAESATEVNDTAFDQVNHVTQCIMCACCFSDCTMAE
FT                   VSDAFIGPAALAKAFRFVSDPREGNKRERLRVLSQDHGIWSCSRCTMCVMVCPKDVKPM
FT                   EAIVKLRTRAMDAGNVSGYGAKHAQAFHGDITSNGSLNEAFILNRTLGVLGALGEMGAA
FT                   LHLAKKGKIPSPFPHKIANLGEVQAIYDALEKNPLDVETKAENAVPE"
FT   gene            complement(514681..516387)
FT                   /locus_tag="Mmc1_0430"
FT   CDS_pept        complement(514681..516387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0430"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: cte:CT2042 succinate/fumarate oxidoreductase,
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42956"
FT                   /db_xref="GOA:A0L4R3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4R3"
FT                   /protein_id="ABK42956.1"
FT                   /translation="MRTGGVMYKHDLIIVGAGLAGMRAAVEAVKAGVDVAVISKVHPLR
FT                   SHSCAAQGGINAAINPKDSWESHAYDTVKGSDFIGDEDAIELMCQEAPNSVLEMDRMGT
FT                   PFSRLEDGLIAQRPFGAASFDRTCYAADRTGQVLLHTLWEQLVKAGVRVYEECQILKIS
FT                   NVDGRIAGVVAYDIKKGEVFGVQAKVTLLCTGGYGRVFLTSTNATASTGDGMALAYRAG
FT                   ASLCDMEFVQFHPTGLRYSGILVTEGARGEGGYLINKDGDRFMTKYAPNKLELASRDVV
FT                   SRAEQTEILEGRGVDGAIFLDLRHLGAQKINERLPQVRQLARDLEGVDPVYTPIPVRPT
FT                   AHYSMGGIRTNKYGETILPGLWAAGESACVSVHGANRLGGNSLLDTIVFGYIAGRELGA
FT                   KLGSMEMPTLPASEVQAVKDNIAQLVDRPNKGVRPASIRERLGESMNAYVSVFRHPDNI
FT                   QKAADLIPTLRQDLTTMHLDDKSKVFNVDLLRAMEMQNLVDLAETIIAGAINRTESRGA
FT                   HSRVDFPERDDENWRKHTITKWDNDAQTTAFSYEAVRTVGKDAYKLAVRSY"
FT   gene            complement(516950..517322)
FT                   /pseudo
FT                   /locus_tag="Mmc1_0431"
FT   gene            517564..520143
FT                   /locus_tag="Mmc1_0432"
FT   CDS_pept        517564..520143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0432"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: pca:Pcar_1413
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42957"
FT                   /db_xref="GOA:A0L4R4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4R4"
FT                   /protein_id="ABK42957.1"
FT                   /translation="MDQKYNPQAIESKWQKIWHQQKTFATPENLGDKETFYLLVMFPYP
FT                   SGRIHMGHVRNYAIGDVIARYQRMQGKAVLHPMGWDAFGMPAENAAAQRKVHPRDWTYE
FT                   NIATMREELKSMGLSYDWDREFATCDEDYAHAEQVLFLRLYEKGLVYRKHAFVNWDPVD
FT                   HTVLANEQVIDGCGWRSGAPVEQRELNQWFFRITHYADELLDNLQHMDGWPETVRTMQT
FT                   NWIGKSHGVEFAFALEGYPGTLPVYTTRPDTLMGVTFCSVAAEHPIAAAVAENNPAAAA
FT                   FIKTCQGVGTSEEALEKLEKKGFDTGIKAIHPITGESLPVYIANFVLMSYGTGAVMAVP
FT                   AHDQRDFEFAKKHGIEIKVVIQPEGQTLHAEQLSEAYTGPGRLVNSGLFTGMDNEQAKQ
FT                   RVAEYFEAQGIGKGTINYRLRDWGISRQRYWGNPIPMVHCAACGVVPVPVAQLPIQLPN
FT                   EVDFSEPGNPLERHPSWKTCDCPQCGQPARRETDTMDTFMESSWYFLRYCSPHMGGVPL
FT                   DKAAVDRWMPVNQYVGGIEHAVLHLLYARFFHKALRDIGEVSCDEPFARLLTQGMVRKD
FT                   THRCAQHGWRYPKEVQERDGALYCIECGGAVTVGRNEKMSKSKHNVVDPNDLIAGYGAD
FT                   TARLFMLFAAPADRDLEWNDSGVDGAWRFLGRVWRLVLAAIERCGERQACTTTPADEQL
FT                   KAFRSQLHNTIVKVTEDLNRQSFNTAIAAVMEMSNGAIATFKGEDRLTGEASALLWETA
FT                   QVTVKLLHPYAPHMTEELWQRMGEQSLLSDTPWPLADAAALVKERVLIVIQVNGKLRSK
FT                   LEVPVDMAQEAIEKLALADEHVKVQTEGKTIRKVVVVPGRLVNIVAN"
FT   gene            520147..520662
FT                   /locus_tag="Mmc1_0433"
FT   CDS_pept        520147..520662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42958"
FT                   /db_xref="GOA:A0L4R5"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4R5"
FT                   /protein_id="ABK42958.1"
FT                   /translation="MNVTLRLLLILSSLFLSACLGYRFPGSAAPAGEGLPPVLVQVKGD
FT                   GAYSHPRLARMLQEQLQQRLGGTPSGDKRTWPVLIVEMSTLERVLRVQEQSGRSDHYRI
FT                   TASAQPSWQIGGQTALPKLPMVKARANYYEMQAATTNQAASDLAREEAIKQLVASLATV
FT                   LYETPHLP"
FT   sig_peptide     520147..520242
FT                   /locus_tag="Mmc1_0433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.510 at
FT                   residue 32"
FT   gene            521046..521411
FT                   /locus_tag="Mmc1_0434"
FT   CDS_pept        521046..521411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0434"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42959"
FT                   /db_xref="GOA:A0L4R6"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4R6"
FT                   /protein_id="ABK42959.1"
FT                   /translation="MLSLAEIGLDAQIFARLLEQNKRSPGFLKKLFNLYIRNGEQLQQH
FT                   FAHAHQQGDWSAMRLHAHTLKSSSLTVGLQGISQQARRLEACCQAEQDPQRLSVALQQQ
FT                   WQQVIPQLQAYLEQQER"
FT   gene            521718..522839
FT                   /locus_tag="Mmc1_0435"
FT   CDS_pept        521718..522839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0435"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein; KEGG: hch:HCH_05185 response regulator
FT                   containing a CheY-like receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42960"
FT                   /db_xref="GOA:A0L4R7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4R7"
FT                   /protein_id="ABK42960.1"
FT                   /translation="MLGIGTVRKILIVEDDETSAWLLESFLRSEGYEVILARDGFAAVE
FT                   RYQSADPDLIIMDILLPGQDGYAATEQIRAITRNEDSPPPIIFLTAIESDAELARCLDC
FT                   GGDDFVVKPFNPIILKARIHSLLERLALAEEKQLALFQIASVLDKLRQSSHFQTSDLVF
FT                   LERPLGRISGDVVLSTSKANGNRLVVIGDFTGHGLPAAICGSLVIPLFYEMAAADADTE
FT                   SIIGSINTTLYEKLPSGFFMAASVIEFNPHAKQVTFWNFAAPGCFIRRGEAWQAYPLYQ
FT                   LPLGAVEQLPKPLESATLAVQSNDRVYAYSDGLCDTLGVMLEKDDPTPLIQFLDQLFCC
FT                   EATEGAITALPQPLLDQLTGAYDDITAVVLTIP"
FT   gene            522896..523582
FT                   /locus_tag="Mmc1_0436"
FT   CDS_pept        522896..523582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0436"
FT                   /product="preQ(0) biosynthesis protein QueC"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: gsu:GSU0483 ExsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42961"
FT                   /db_xref="GOA:A0L4R8"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4R8"
FT                   /protein_id="ABK42961.1"
FT                   /translation="MPTIMSAVVLLSGGLDSATVLRMAHATGQRIHALSFRYGQRHTME
FT                   LEMARKQALSLPGVAHRIMDLQLSLFGGSALTADIPVPKGGVDENTIPVTYVPARNMVF
FT                   LSLALAWAESLGAQHLYIGVNAVDYSGYPDCRPEFIQSFQQTANLATKAGVEGHPFTVH
FT                   TPLINLTKAQIIQQGLALGVDYGLTRSCYDPDAQGAGCGLCDACRLRLQGFAEAGVPDP
FT                   APYQGP"
FT   gene            523586..524635
FT                   /locus_tag="Mmc1_0437"
FT   CDS_pept        523586..524635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0437"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: pca:Pcar_0996 cell cycle
FT                   protein MesJ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42962"
FT                   /db_xref="GOA:A0L4R9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4R9"
FT                   /protein_id="ABK42962.1"
FT                   /translation="MDAKQRASLQRRFATHLQGLLPQWPLSAPLLVAVSAGVDSSALLH
FT                   LLRLCYPGPLQAAHFDHALRPCAKQDLAHVQQQCAQYAIPLHVGHWLPPAQKANLAAQA
FT                   RQARYRFLAQTAYGLKAPFIGIAHHQEDQAETLLERLLLRGAGLKGLSGMRPLAPLPMA
FT                   EFAQVQLLRPLLPFSKKELTSWLQGEQITWREDPSNQDLRYTRNHIRHRLLPSLNALGV
FT                   GEAIPQRLAETALHLQQADAALQWMVVQLAQQLPIEPYQENGLQLPLQPFAELPAELRA
FT                   RLLDHMLHTLVGITAVGQRAKENLWHHLSLPAKRWQMRMQGVAVTRVEQRLLVQPVLRA
FT                   PGKRGETNH"
FT   gene            524786..526807
FT                   /locus_tag="Mmc1_0438"
FT   CDS_pept        524786..526807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0438"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: gsu:GSU1809 cell division protein FtsH;
FT                   TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42963"
FT                   /db_xref="GOA:A0L4S0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4S0"
FT                   /protein_id="ABK42963.1"
FT                   /translation="MNGFFKNLSLWLVIGLLMVMLFNLFNSPQGPGQSITFSDFSEMVA
FT                   QGKVTAVTLEGRTVRGLSTDGSPFSSRVPDNYDLTKDLLAHGVDIDVREPEGTPMLMQI
FT                   LISWFPMLLLIAVWIYFMRQMQSGGGRGAMSFGKSKAKLMSDKAAKVTFQDVAGIEEAK
FT                   EELQEVVQFLKDPHKFQRLGGKIPKGVLLVGPPGTGKTLLARAIAGEANVPFFNLSGSD
FT                   FVEMFVGVGAARVRDMFEQGKKNAPCIIFIDEIDAVGRHRGAGLGGGHDEREQTLNQLL
FT                   VEMDGFESTEGVIMVAATNRPDVLDPALLRPGRFDRQVTVPNPDILGRTQILKVHMNKV
FT                   PLSDSVDAEVIARATPGFSGADLANLVNEAALIAAQLDKRVVEMEDFENAKDKVMMGKP
FT                   RRSAVISEKERKTTAYHEAGHAVVAMALDGADPVHKVTIIPRGRALGLTMQLPLEDRYT
FT                   YSKVQLEQNIAILMGGRLAEELVLNQLTTGAGNDIQRATDLARKMICSYGMSDTLGPLT
FT                   YGENEQEIFLGREITQHKSVSEETARRIDAEVFDIVDRNYKRAKQILTDKMEVLHTMAQ
FT                   ALLERETIDADEVIKLMAGEPAETALKPLKKKDERANKPTPTVADDGEQGDQTAKDAVA
FT                   GSVTQAEDDVEGSTRTATEASTQEVVSKDTPEGDDKDR"
FT   sig_peptide     524786..524929
FT                   /locus_tag="Mmc1_0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.389 at
FT                   residue 48"
FT   gene            526804..527961
FT                   /locus_tag="Mmc1_0439"
FT   CDS_pept        526804..527961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0439"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: xac:XAC1733 dihydropteroate synthase; TIGRFAM:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase,
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42964"
FT                   /db_xref="GOA:A0L4S1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S1"
FT                   /protein_id="ABK42964.1"
FT                   /translation="MTHYAVVTPTMGAAGAHFFAAPRMGDGVAPFPAMPELPMAVRLFP
FT                   WPEAWDGLLPEGMEIYLSGTLRMARGWLLPSVLERWQERIFQTVAQDSAMALHQSLRNL
FT                   NTPRAAMSYLDAQGKRRKLAGDRPLIMGIVNVTPDSFSDGGHYHDTGRAVAHAMALVEQ
FT                   GADLLDIGGESTRPGAAMVPVDEELRRVVPVVRAIAAQTKVPISVDTAKGRVMEAALEA
FT                   GAALINDVTALKGDPLSLRVLRDAHCPVVLMHKKGTPRNMQNSPHYEDVVAEVYGFLGD
FT                   RMQWCVENGIGRERLVIDPGIGFGKTHGHNLELLAHIGAFTGLAAPLLLGISRKRIVGH
FT                   LTGCEDAAQRDVGSHLMAALGVQRGANWVRVHDVAGMQQALRCLV"
FT   gene            complement(528050..528355)
FT                   /locus_tag="Mmc1_0440"
FT   CDS_pept        complement(528050..528355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0440"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: ppu:PP4364 anti-sigma F factor
FT                   antagonist, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42965"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S2"
FT                   /protein_id="ABK42965.1"
FT                   /translation="MDLIKKQFDEAGNLTIIQLPETFTFRLFNEFRGCYEALDRQGSVE
FT                   VDLCHVTHLDSSALGMLVAVWEHMGRNREQVRLSNTSIAVRKILMDANFNQLFTIS"
FT   gene            complement(528718..531150)
FT                   /locus_tag="Mmc1_0441"
FT   CDS_pept        complement(528718..531150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0441"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: dps:DP2258 similar to
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42966"
FT                   /db_xref="GOA:A0L4S3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S3"
FT                   /protein_id="ABK42966.1"
FT                   /translation="MSLFNYLLGLSIKNKMWLVAIFSIIVELILIIPNFQLIQNSGTQV
FT                   EQQITTVEKELTHLEDLQSRQGVVSDLMKSVLTIHHGITLIADEEEGWNRERLQEVVKE
FT                   FTAARERLNTMWPPNGNRDKLDELLENVQIIINMGMEYDPQEEGGREALLNGMNLMMVD
FT                   LMHSLNGVNAIYRDYMEKEIEGVSKAIIGGVKQAQDMVSKLGHTSLQGMLFQFVVVLFL
FT                   IILMAVILTWILRRLDTIQIVFREVKAGRITARVPVARWHDEITEISDGVNETLMELTK
FT                   LIREIRIHVAGTLPPVSKEFADAVDRLNGAVGLVFTAITKADQANENLSLKISDNVKAA
FT                   TEWIVQALEEISKSAATQAEAAGHVAESADEGSYRSSRLSTAIDEMVGNVDSVSNSINK
FT                   ISGLMGDMHKTIRENATSQKQVLAFSESAVREAGEAANQVEETQTVMSSLAESANEIGK
FT                   AVSSIKNIAKQTNMLALNASIEAAGAGEAGKGFAVVANEVKELAKQTEQATNMISQRVE
FT                   EIQSGTKDATSRVMQTVEVVNMLAETNRHVGDMAQEQSARVDDVNQAVQGVASATNDVA
FT                   HNLNSLSTKAQEVANTVAELSESAQALSNTATAMSHNAQGAREQSSKANEHAQQVLISV
FT                   GMAIAATELMDNEMGHVTHGLGNLQITTQTINLFIGVLGEVETKLNHAQQAFNLGPEKL
FT                   KMSLIKGALLAWLSKLELHACGQIKLEDGGDPRHSPLGEWLYHPETGSRLSHLPVYKEV
FT                   EQSNRKLHELVSAAIVQLNQKKKEAAKTTLAQLHDERRKLFTALDNLYHASVDEAKR"
FT   gene            complement(531259..532857)
FT                   /locus_tag="Mmc1_0442"
FT   CDS_pept        complement(531259..532857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0442"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: hal:VNG0056H
FT                   hypothetical protein encoded by ISH10"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42967"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S4"
FT                   /protein_id="ABK42967.1"
FT                   /translation="MKLSDHDLLQIDEEYLSSLSSAELLAVSRKMLEDLKESRERLNRT
FT                   PDNSSQPPSSRPAYLGIPVEQDETLSDEDEEDVSPVEKKGTDDADGDDSPGPSGSSTPS
FT                   APGNGKSDSSGKKPKGRAGKPVGAKGFGRTQIIPIRSTVVHRAETCAACDAALPLDARF
FT                   TARIGYVTIDLIRGAPDQPGLRLEGTKHLFGEVACRCGHISCTGPGTGDRLEIAGRKTA
FT                   TSLSEWRIVGPMLAAFIVALAKRMRLSRSKVQEFLIDWFGLELSVGTIDNCIREVGLAA
FT                   APVQDELIAELRASALAHVDETPWKQKGQALWLWVFATANTVLFCVGRRTRQMVLDILT
FT                   EEYAGWLMSDGLMNYRIFSRRLRCWAHLIRKAKGLSTSLDKESKRFGSRVLEVLEYMVE
FT                   EVKDGSDPPAAESILEEFQGYCELYRDYPPSEKVRSLAVELLNDWDVIWQPVRVPGLPL
FT                   TNNDAERALRHWVIARLISHGTRTAEGSRVLGVLASVIETCRLRNVSPWDYLAEVIAER
FT                   RKGNLVPPLPAPVAA"
FT   gene            complement(532873..533115)
FT                   /locus_tag="Mmc1_0443"
FT   CDS_pept        complement(532873..533115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42968"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S5"
FT                   /protein_id="ABK42968.1"
FT                   /translation="MAKNILDTIFVENVKFQKESAIRSVFAYQSLEESSGGFSAVAPTP
FT                   GYERIFALDPMGRRSAKISSWKPVLSCVRGFIHRR"
FT   gene            complement(533601..534608)
FT                   /locus_tag="Mmc1_0444"
FT   CDS_pept        complement(533601..534608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0444"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: ade:Adeh_3950 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42969"
FT                   /db_xref="GOA:A0L4S6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S6"
FT                   /protein_id="ABK42969.1"
FT                   /translation="MITYLKQAALALAVMVPMLSSAYAESPVVGQMGTWKVTLEELDKS
FT                   IAGELFELENKIYETRAKALDSMMVEHLLDTEAKKQGITIDALEKREVTDKVTPVSDAE
FT                   VAQFIEQNSERLPNAGEGLEERIKSYLTEQRAAKFRRALLAQLMSQVEVTTNLPEPEEP
FT                   RYTFNSTMTPSLGAADAPVTIVEFSDFECPYCRRVQPALKQLKTKYGDKIQFVFRHYPL
FT                   SFHKLAPLASKAAMCGEDQQQFWAFHDALFEEGVDLSRAGLDKVAADLKLDMALFKNCL
FT                   DSNKHEAKLDADLTEGQSLGVTGTPTFFINGRKSSGALPYSTLEKMVEQELTSK"
FT   sig_peptide     complement(534534..534608)
FT                   /locus_tag="Mmc1_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.975 at
FT                   residue 25"
FT   gene            complement(534739..535176)
FT                   /locus_tag="Mmc1_0445"
FT   CDS_pept        complement(534739..535176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0445"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: rru:Rru_A1876
FT                   cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42970"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S7"
FT                   /protein_id="ABK42970.1"
FT                   /translation="MPKIKIEEIVPFSPQQMYDLVVDVDRYPEFLNWCCHAHIVKQEGN
FT                   QFEAELTIMFKGIREKFRTLDKVVPGERVEISLVSGPFKHLTSLWVFEPVEPQGARCRI
FT                   HFSIDFKFRNPVLNMTLGPVFSMISKQMVSDYRKRAAKLYR"
FT   gene            535561..536559
FT                   /locus_tag="Mmc1_0446"
FT   CDS_pept        535561..536559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0446"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: dps:DP0822 probable glyceraldehyde 3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42971"
FT                   /db_xref="GOA:A0L4S8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S8"
FT                   /protein_id="ABK42971.1"
FT                   /translation="MTIRIGINGFGRIGRSIFRAQRMDPAFKDIEIVALNDLTPKPSLA
FT                   HLLKYDSVMGVLNAEVSATEKGVSVDGKEITVFEERDPAKLPWGELGVDYVVESTGLFR
FT                   KRETAGAHLKGGAKRVIISAPAGGDIPTFVMGVNENDYNPATDDIVSNASCTTNCLAPM
FT                   AKVIDDKFGIERGLMTTVHAYTNDQALLDQPHSDLRRARAAALSMIPTKTGAAAAIGLV
FT                   MPNMKGRFDGLAVRVPTPNVSLVDAVMEVRAETTAEEVNAALKAATTRFLGYFDAPLVS
FT                   IDMQGDPRSSIVDGGCTRVNGKQIKVMSWYDNEWGYSNRVLDLILHMASKA"
FT   gene            complement(537972..539444)
FT                   /locus_tag="Mmc1_0447"
FT   CDS_pept        complement(537972..539444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0447"
FT                   /product="sodium/proton antiporter, NhaD family"
FT                   /note="PFAM: Citrate transporter; KEGG: sde:Sde_0065 Na+/H+
FT                   antiporter (NhaD family); TC 2.A.62"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42972"
FT                   /db_xref="GOA:A0L4S9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4S9"
FT                   /protein_id="ABK42972.1"
FT                   /translation="MNKLFLYSLAAMLVLLGMPELALASGGAALSALPANMPDLTQTWV
FT                   GPTAVIIFVVAYALVMGEEFTHMRKSKPVIFAAGLIWAFIAYVYAGFAAGLTDPAAQKA
FT                   VTHATEMAVRHNILEYAELFLFLLVAMTYINAMDERQVFQSLRAWLVRSGYTYRQMFWM
FT                   TGLLAFFISPVADNLTTALLMCAVILAVGRTKPNFVGIACINVVIAANAGGAFSPFGDI
FT                   TTLMVWQKGVVPFVDFFYLFIPSLVNWVLPAYIMSRTVSTETPEASNEVVKIRRGGYVI
FT                   IFLFLLTIVTAVCFHNFLHLPPMLGMTTGLGALKLYAYYLKLTHAKEQHGSNGEIGDVR
FT                   FDIFRKVERAEWDTLLFFYGVILCVGGLGYIGYLEIVSKVLFVDWGPTWANITVGFLSA
FT                   IVDNIPVMFAVLTMMPDMDMQQWLLVTLTAGVGGSMLSIGSAAGVALMGQARGMYTFFG
FT                   HLKWAPVIMLGYFASIGVHFLVNSHLKGVLVH"
FT   sig_peptide     complement(539370..539444)
FT                   /locus_tag="Mmc1_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.862 at
FT                   residue 25"
FT   gene            complement(539815..540756)
FT                   /locus_tag="Mmc1_0448"
FT   CDS_pept        complement(539815..540756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0448"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: rru:Rru_A1795 HAD-superfamily hydrolase,
FT                   subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42973"
FT                   /db_xref="GOA:A0L4T0"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T0"
FT                   /protein_id="ABK42973.1"
FT                   /translation="MSKQIIGDGAQLRRLYRSYGRWLSPSCGGLGKRPLESTFMGVVEP
FT                   FSTLFFDAYGVLYGGSVEPAGVAQAMALLRRQDKCIRLLSNNGHESVPVIVSKLAAVGL
FT                   FFEPHEIITSGMVVASYLARGGLRGAPYLLIGSEQSRQAYAPEPMRLERPPGDARLGLE
FT                   PPRVLLVCSDSAYWGTPYQAHVESILAVHPLPMLVANPDLVVPLPEGGWLPVAGHAALT
FT                   LNQRYGAAFIGLGKPFRPVFERAMASVPGVKADEILMIGDTPETDILGANGMGIKSCLV
FT                   GSGILAKMDLTWYDYCVQQGIMPDFYVPAVAC"
FT   gene            541092..542015
FT                   /locus_tag="Mmc1_0449"
FT   CDS_pept        541092..542015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0449"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: tcx:Tcr_1555 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42974"
FT                   /db_xref="GOA:A0L4T1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T1"
FT                   /protein_id="ABK42974.1"
FT                   /translation="MSFSDTRLRVFYAVAKHLSFTRAAEELYLTQPAVTFQIRQLEEHF
FT                   DTRLFDRHHNRISLTEAGLEVYSYAERILDLYRETEKAVSELTGVTRGVVKVGASTTIG
FT                   EYLLPRILSDYRDQFNDVQIRLSIDNTRTVVRKLEDATIDVGMIEGPVKNKNIARDGCL
FT                   DDELVVILPPNHPLCDLDEIPVKELKAYPFVSREEGSGTRQVVHDHLLHAGLPYDQLDI
FT                   VLELGSTEAVKGSVEGGIGIGIVSSASLIKELKLGILVAKRVQGMRITRTINFIHQKQK
FT                   FRSKAVEAFINFAKDHCKHMVSPIDE"
FT   gene            complement(542086..543342)
FT                   /locus_tag="Mmc1_0450"
FT   CDS_pept        complement(542086..543342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0450"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: cpe:CPE0030 probable hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42975"
FT                   /db_xref="GOA:A0L4T2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T2"
FT                   /protein_id="ABK42975.1"
FT                   /translation="METLLTLLLLLFLSGFFSGSETALTALSHARVESLMLERRPGAKA
FT                   LYRLKLNTDRMLITLLIGNNLVNIAASAIATVFATEQFGHLGPGLAVGGLTLFILIFGE
FT                   IVPKTFAARNMVSIALVVAPPLYLFAQAVFPLTWLLEHITQSLQRFSRQSEPTVTESEL
FT                   LTLASHGAREGAIEADEEAMIKRVFELNDLCAEDIMVPRPQMVMIDGDLTVEAAAKRLL
FT                   AQPFERIPMTTGGSDEIHGVIHIRDVLEALIQNEGSKLLRDMSHEPIYVAKNQRLDHLL
FT                   ENMRGRKQKMAVVVDDMGMALGLFTLEDILEEVVGEIYNESDGPEHQALIENSPGEIVV
FT                   DGITEMRHVIAYFGRSLDAKPTDRVNQWLLANIARIPDLGERFTIADLEIEVKRASRRR
FT                   ILKVVIRHLLTETDMESEE"
FT   sig_peptide     complement(543265..543342)
FT                   /locus_tag="Mmc1_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.523 at
FT                   residue 26"
FT   gene            complement(543528..544220)
FT                   /locus_tag="Mmc1_0451"
FT   CDS_pept        complement(543528..544220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0451"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   nmu:Nmul_A0343 protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42976"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T3"
FT                   /protein_id="ABK42976.1"
FT                   /translation="MLLAFLCMRRWPKLARFTLVLAMLALYLQSAPWVSEAMIQYLESK
FT                   TQALNPQRAAADPAQLTVVLGCGRYPEAPEYGGVDTLSTCGLARVRYGAYLYRATGRPI
FT                   LVAGGAPYGEQRSEADAMAEVLEREFRIPVMFREGGSRNTWENAKNSAAILKREGLTHI
FT                   FLVTHAKDMSRAAWAFREQGIQVTEAPTLFKTKSPAWPLPYLPDNFYEFRWALHELVGI
FT                   LYYRLVAH"
FT   gene            complement(544286..545293)
FT                   /locus_tag="Mmc1_0452"
FT   CDS_pept        complement(544286..545293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0452"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   mca:MCA0861 integrase/recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42977"
FT                   /db_xref="GOA:A0L4T4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T4"
FT                   /protein_id="ABK42977.1"
FT                   /translation="MELPYLQRFFDHLMQERRLSVHTEKGYRRDLEAFSAFYAEYEGEP
FT                   LTPTKLAQLDGDHILAFLGRGHREGLARTTMQRRMAALRAWFNYMQREGLVSGNPAAAV
FT                   SSPKAPKRLPRAPSVEQTLNLLDKSTPRPLSPEASDFDTSAWAVLRSLRDTALLELLYS
FT                   AGLRISEACNLDRADVDLRGGELRVRHGKGGKQRMVPLGRTAVAAIEAWLQARTRAKPQ
FT                   LDPMGPIFTGQLGKRLNSREGQRLLEKWRARLDLPESVTPHALRHAFATHLLQAGADLR
FT                   AIQEMMGHASLSATQKYTHLDMQALAKVYDAAHPRAQRRTPRPSTTPQFQKDLP"
FT   gene            complement(545298..546122)
FT                   /locus_tag="Mmc1_0453"
FT   CDS_pept        complement(545298..546122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42978"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T5"
FT                   /protein_id="ABK42978.1"
FT                   /translation="MGNRAKFPCSQIETIMNKAAIQQAMTEPLSEKQVRDYLLDNPSFF
FT                   NENGDLLPSAINVSGRVLSLEAGQLNQLRQENTRIREQVDHIMERIGQNDAIYHAFHTI
FT                   QKGLLVEMGQDVATLINRFCQSLEDTFNIYRVALTLSDSAPALLPLRHAMQSNPALAGA
FT                   LMGRVHIMPHAELIKVIGHTGRSVIRVGREGGDRTPFFGMQAGQIKSDALIPIFNPPLD
FT                   LLPIESPTPEPIASLNLGGESTNRFLPGYSSDLLQDMTDIFVLILDRTLEAG"
FT   gene            546328..546606
FT                   /locus_tag="Mmc1_0454"
FT   CDS_pept        546328..546606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0454"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: cvi:CV3351
FT                   probable transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42979"
FT                   /db_xref="GOA:A0L4T6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T6"
FT                   /protein_id="ABK42979.1"
FT                   /translation="MKALAHPLRLKVIVALNEKELSVQELVESVGTTQSNVSQHLTIMR
FT                   DKNILSSRRVANQVFYRVGDCKVLDLVSLTKKIFCQEEDDKTGNKKP"
FT   gene            546755..547174
FT                   /locus_tag="Mmc1_0455"
FT   CDS_pept        546755..547174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0455"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: mca:MCA2536
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42980"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T7"
FT                   /protein_id="ABK42980.1"
FT                   /translation="MSWLQDNWLTLLLVLVLMGLMFKGPILSILYKINQITPHQLAEML
FT                   AHKPPPLLIDVRTAAEFNTDGRIEHAILVPLSDLSRRAPEMFKQYPGREVAVICRSGNR
FT                   SIMGSVGLKKAGFAKVYNVTGGMLNWQSQGYKVRR"
FT   gene            547229..547726
FT                   /locus_tag="Mmc1_0456"
FT   CDS_pept        547229..547726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0456"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mca:MCA2134 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42981"
FT                   /db_xref="GOA:A0L4T8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T8"
FT                   /protein_id="ABK42981.1"
FT                   /translation="MPRSLFFELSVGNLEMSESLIATCAGCGTGNRIPTNKAGFNARCG
FT                   KCGEPLNRVGPDFPVTVGELQFHDEVLHSPMPVLVDFWAPWCGPCRQMSPLLADFAREM
FT                   AGRIKVVKVNTDDNRILANQFNIRSIPTLMLFDHGQLKDQVSGSMTLPALRDWINRILE
FT                   IS"
FT   gene            547726..548352
FT                   /locus_tag="Mmc1_0457"
FT   CDS_pept        547726..548352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0457"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gka:GK2073 SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42982"
FT                   /db_xref="GOA:A0L4T9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4T9"
FT                   /protein_id="ABK42982.1"
FT                   /translation="MGHHHHHHPKHRFDPSHAARLLDPARRGIEDPHALVQEIGIKPGM
FT                   ALVDLGCGAGFFTPALLQTVGAEGSVTAVELQPEVLAFFRGHVGTPPNLQDCCADLTQT
FT                   GLPAAHYDAVFIAFTLHEVTVAEALVEIKRLLKPGGVLVALDWGVFGPCPERADGKKMG
FT                   PPEDHRLLLDTLRGLLQAAGLVEEAAGERLGGCQYWLRAHKPMEV"
FT   gene            548355..548990
FT                   /locus_tag="Mmc1_0458"
FT   CDS_pept        548355..548990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0458"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: dsy:DSY1427
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42983"
FT                   /db_xref="GOA:A0L4U0"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U0"
FT                   /protein_id="ABK42983.1"
FT                   /translation="MALELEIKLTAEDALTLDAVLADAEIAAMADPPERVDYRATYYDT
FT                   ADLLLLHNQLAFRSRPEGDGRWRAAVKGFGGVVDGVSRREEWEGFLPHNPTNLSDFPPG
FT                   EMREALAHLRQRAPLAPLQPLMVTDFERRAVRLHLAGGTQVEMALDRGQVEAGGQLQGL
FT                   CEVELELLQGELAPVEALAKRLTHRYKLVPSPHSKFAIGLLLLGLLQA"
FT   gene            549105..550484
FT                   /locus_tag="Mmc1_0459"
FT   CDS_pept        549105..550484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0459"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="KEGG: gsu:GSU1695 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42984"
FT                   /db_xref="GOA:A0L4U1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U1"
FT                   /protein_id="ABK42984.1"
FT                   /translation="MRYISTRGGVAPLSFSEAVMMGLATDGGLLVPERLPQVDGATLRR
FT                   WAKLSYQELALEVMRPFVEEDIPEADLRPLVINAYAKFEHDEITPLVKVGDVQILELFH
FT                   GPTLAFKDVALQFLGNLFEYLLEKQGGRLNIIGATSGDTGSAAIHGVRGKSGIDIFILH
FT                   PHQRVSPVQERQMTTVLDDNVHNIAIEGNFDDGQAIVKALFNDLAFKEKYHLGAVNSIN
FT                   WARILAQIVYYFRGWARATGGNPEQKVSFSVPTGNFGDIYAGYLARQMGLPVDRLILAT
FT                   NRNDILSRFVLHGSYSKGVVEPTISPSMDIQISSNFERYLFDLLERDGDGVKGCMAELA
FT                   EQGGFSVSAEKLAQVRTIFDAVAVSEAQTLETITRVHRESGYVLDPHTAVGVAAAAGRQ
FT                   GVICLATAHPAKFADAVRQATGEAVALPPSMQDLMTLPTRCEVLPATAAAIKAKVEQTL
FT                   A"
FT   gene            complement(550716..551414)
FT                   /locus_tag="Mmc1_0460"
FT   CDS_pept        complement(550716..551414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0460"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein, Crp; KEGG: tbd:Tbd_0079 transcriptional regulator,
FT                   Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42985"
FT                   /db_xref="GOA:A0L4U2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U2"
FT                   /protein_id="ABK42985.1"
FT                   /translation="MNHHPLKDADLDQTRKSHLFTPLSEPAWLPLAAQLSRRTLASGEI
FT                   LFQQGDPFEAFFLVLRGGIKLYRLSADGAEKVIEVIMPGQTFGEAVMFAQGNRYPVTAE
FT                   ALEATVLVAVPSSAYMAMLQRYPEASVGLLKDMSQRLHHLVMEVDRVTLQRARERLLSY
FT                   LGQQVACGNGSSCTLKMPRKVLASRLSMQPETLSRLFRGLKDQGIIAEQGQIITVLDPH
FT                   AVQEGYLDEL"
FT   gene            complement(551432..553717)
FT                   /locus_tag="Mmc1_0461"
FT   CDS_pept        complement(551432..553717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0461"
FT                   /product="small GTP-binding protein"
FT                   /note="KEGG: mba:Mbar_A2306 leucine-rich-repeat protein;
FT                   TIGRFAM: small GTP-binding protein; PFAM: leucine-rich
FT                   repeat protein; Miro domain protein; Ras family protein;
FT                   SMART: Ras small GTPase, Rab type; leucine-rich
FT                   repeat-containing protein, typical subtype"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42986"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032171"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U3"
FT                   /protein_id="ABK42986.1"
FT                   /translation="MNREELLSKLALARQQGLKALDLSSLELTELPDEIGLCSNLESLD
FT                   LSDNRLTTLPVALGHLDRLQLLDLRDNQLTDLPENLVKLQRLAFLRLGNNHLSKLPNVV
FT                   CRLSGLRRLVLRGNRLSSLPPELGALTQLQELALHDNLLTALPETIDRLLHLETLLLPG
FT                   NQLQTLPESFARLPALKRLDLARNRIMDLPPELGGLRHLAWLDLHHNSLPVPEAILDEV
FT                   QEPSKIIAAYHKALASERRHLDEAKLMVLGDRGTGKSSLVARLLDGRFVADMHPTEGVS
FT                   LRTWRFSDGQRRLRLNLWDFSGADHYFAAHPYFITPQGLILLVMDGAEPEPERRLARWM
FT                   RIIRSLAGRQASVALICHRADRFPLELDWNEIRQRYPSIKVAVRRASSMTGEGIESVQQ
FT                   AITKLLDTFEPAQALYWRSWLDTKAIVEEINESHIPYRFYQALCRERGIHDGDQQEQLA
FT                   NRMHLLGSAVYFRNHPLAGSTDDLLDPAWLTQALYRPLGSKRIRDNGGVLERKELGQIL
FT                   DPGLHGSSKHALVLTWLRRFQICFPLLEEPGEEQAQAPHVERFLFPDLLPVNYTSVGMS
FT                   RETLDFSYHYDHLPPALMGRLLVRFYPFLHSRTCWRDGLLLASEGGGNRALIQMDREAG
FT                   TLRMRIWGQPKMRAVFLALLRLSLERLNSIWSDFEVQEKVPLAITGAEDVGYRHLHAMQ
FT                   KAGLERFLPVGVTEPIAISPLLETLELPPAPPPESRPLPNKPGRVTLKQRLQQRRMQAH
FT                   EPTATPTH"
FT   gene            554051..559306
FT                   /locus_tag="Mmc1_0462"
FT   CDS_pept        554051..559306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0462"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; protein of unknown function DUF1058; SH3, type 3
FT                   domain protein; SMART: SH3 domain protein domain protein;
FT                   KEGG: tcr:509269.4 Tb-291 membrane-associated protein-like
FT                   Pfam: Plasmodium_HRP Vicilin_N PROSITE: ALA_RICH ARG_RICH
FT                   GLU_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42987"
FT                   /db_xref="GOA:A0L4U4"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U4"
FT                   /protein_id="ABK42987.1"
FT                   /translation="MTRRNNPTRFRRLKSLLALAACFAWAPALRAESLSLWSVSHEKAV
FT                   VYSAPNGAGERQFAWLTGRFVQVLEEQGEWVRVRAEWGSAEDTGWTLKSGLEPVEQRLP
FT                   QHFDRTVEVRVLGAKVRQSPHAGAPVVMQVFRKTPLVVFEENHDNWMRVARQDGFGPQG
FT                   WIYGDLVDQALARDAESAKPQPPMQEPVALGGDTGPAEEIKRVMPEMAHWVVNVDAVNL
FT                   REGAGRRFAVQGQVRQGDLLIASQQQGAWLHIRTERDSRVTGWVSAELLRQAAGSVVQG
FT                   EAATPRVEQINLRAEPNAESQKLLRIYMDQQVTMVSEPNNGWVQVQRADGLGGVGWVRE
FT                   DLVQRLPDAVASHAEVANDDAPESQNTEEARLAEEARVAEEARVAEEARIAEEARIAEE
FT                   ARIAEEARIAEEARIAEEARIAEEARIAEEARIAEEARIAEEARIAEEAQIAEEARIAE
FT                   EARIAEEARIAEEARIAEEARVAEEARKAEEARIAEEARIAEESSPASSMVVQGVAVSP
FT                   DQAAAYWVVNADTVRLRGGPGTQFEQMGYVGQGDVLIATAQQDAWLQVHMEQEPAKQGW
FT                   IYAPLLRQGAGQVMAGQPAALRAVLTNMRAESSEESNKVLRLYQDQGVMLVAEPVEGWV
FT                   QVQRADGIGGVGWVREDLVQRLPDAVASHVEVANDDALESQNTEEARLAEEARVAEEAR
FT                   KAEEARVAEEARIAEEARIAEEARKAEEARLAEQARKAEEARIAEEARVAEEARKAEEA
FT                   RVAEEARIAEEARIAEEARKAEEARVAEEARKAEEARIAEEARIAEEARIAEEARIAEE
FT                   ARIAEEARIAEEARIAEEARIAEEVRIAEEVRIAEEARIAEEARIAEEARIAEEARVAE
FT                   EARVAEEARVAEEARIAEEARVAEEARIAEEARIAEEARIAEEARIAEEARIAEEARIA
FT                   EEARIAEEARIAEEARIAEEARIAEEARIAEEARIAEEARIAEEARIAEEARIAEEARL
FT                   AEEARVAEEARVAEEARIAEEARIAEESSPASSMVVQGVAVSPDQAAAYWVVNADTVRL
FT                   RGGPGTQFEQMGYVGQGDVLIATAQQDAWLQVHMEQEPAKQGWIYAPLLRQGAGQVMAG
FT                   QPAALRAVLTNMRAEPSEESNKVLRLYQDQGVMLVAEPVEGWVQVQRADGIGGVGWVRE
FT                   DLVQRLPDAVASHVEVANDDAPESQNTEEARLAEEARVAEEARKAEEARIAEEARIAEE
FT                   ARKAEEARVAEEARKAEEARVAEEARVAEEARVAEEARIAEEARIAEEARIAEEARIAE
FT                   EARIAEEARIAEEARIAEEARIAEEARIAEEARVAEEARIAEEARIAEEARIAEEARIA
FT                   EEARIAEEARIAEKARVAEEARLAEEARKAEEARVAEEARIAEEARIAEEARLAEEARA
FT                   TARAQAEEQARLAAQAQADIQRLVAKNQNADGFTPNSRWVVKVQSARVRQGPGSEFATL
FT                   DVAHHGEVLIVLEQQKGWMRVRQEYKNAKQFNGWIYAELLKNATDTEPRGTLAEVVVPQ
FT                   ANLRAEPSAEADKLLRLYQGQAMVMLQESQQGWQKVQRADGVGGPGWINARLIRQLEQQ
FT                   AQGQVETSLPEVSLADKTPMVAAEVLDIPVSQQAMLAQGSSDDGDVVASMAPETPLMAD
FT                   VQEVMAAVPNPLENLILKHPDNKAFTEAFTAIQTATQRLVGHPFFADVGLAQDGALILV
FT                   GTDHMFEPIITRNLRRRKMIALARAWRDTNRLTHGVHVKLYSGDGTQQMQMFLP"
FT   sig_peptide     554051..554146
FT                   /locus_tag="Mmc1_0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.762 at
FT                   residue 32"
FT   gene            559550..563494
FT                   /locus_tag="Mmc1_0463"
FT   CDS_pept        559550..563494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0463"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: son:SO0577 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; GAF domain protein;
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase A domain protein domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42988"
FT                   /db_xref="GOA:A0L4U5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U5"
FT                   /protein_id="ABK42988.1"
FT                   /translation="MQRPRESDGMPQSTNPSMQPNPAQASTPQAVPPSPRPAQLRLTRR
FT                   VLTLLTLFALLVALGIGLLLGALPFLQGFNLTAWWQALQPRLWTLLPGVVLLVGTTLWL
FT                   LRGVVYPLLNSYHHQLNVLDQQRLDQHDQIKQHQHQLHEANAHALRLQRMSQFLHHITE
FT                   STQMSMDEKIEQGLEYGQSLFGMEISFVGQVREGICRVIHVLNSDTLQKNSRLVMDNRC
FT                   CLKQLAQNEQGVVSPLLSACCAEMVCAQLHQFQALICAPLVVEHQSYGVLAFASMQPFQ
FT                   SLDSRRDEALLELLAQWVGTHLAQQQRMQALQWSNERLARFRATLDHLDDMIALADPRT
FT                   LRFVDVNRGMVESTGLSLDGLLSKRLADLTTPQSQAKVNRIMNRLVVGLDRMLRFEVTL
FT                   QHTNGSCIETDALVQWVELEAGKPVVVHMLRDATERKRAETALRVSEERLTFALEGSND
FT                   GLWDWNIAEDNLHCSPRLEAMLGFRRGSLTGSMARLKSMIVEQERPGVEALLRIHLDGH
FT                   VDLYEAEYRINSASGRLLWILDRGKVVQRNSKGQPIRAVGTFTDITARKDMEAALHDAK
FT                   VEAESASRAKSRFLANMSHEIRTPMNAILGLSSLALEQAKEARQRDFLEKINHSGHFLM
FT                   GLLNDILDLSKIEAERMDLESQPFRLDELLKQLAANVLPAMRNKAVEVHFFIASGTPLA
FT                   LVGDALRLGQVLHNLLSNAMKFTHEGEVRITLTAEPYVQLTDHYLFTFEVKDSGIGIPA
FT                   EVQPKLFESFIQADSSTTRQYGGSGLGLAICRRLMEMMHGKITLQSSLGQGSTFTCRLP
FT                   LQIQSCTVTCCPMPEDAFKGQRLLVVSNSGSLPESIQFSMGSLDLQLRHTVDPEAMAAL
FT                   VAQGFYPDVVLLDDNCGDSTQLVNAISQFTLMMTEQKKPTILMTTVHQDSTLLERLSAA
FT                   GMDGVLDKPLLPMALYDVLMRLLHTGSLNMGGLESVSSRDHAAHLAGLHVLLVEDHDLN
FT                   MEVAKAILERVGIRVITAQHGGEALALLEQTEGAAFDAILMDLQMPVMDGFETTRVIRS
FT                   KTAWAQPPIIALTANAFSQDRERALQVGMNDHITKPIAPGLLYAALERWIDRKDRAIGH
FT                   LDLLSQAEEVVVFPPLQGWQQQQVLIRFEGDEALVRRLLDRLVEECHRLLSHVEPLLTQ
FT                   QAWPELLASVHGFKGITGNLGLEILQKNASIMEQGLCKERVVASQVAQHWHILAGSIRD
FT                   FVGTYGQWQQQCMEGDKGHGKRDEQGKGDDILQELLELLAGRQMGARDHYKRHRRVLMA
FT                   WLGESKAAALEKAMAELDFVTAEKVLLSRS"
FT   gene            563676..564203
FT                   /locus_tag="Mmc1_0464"
FT   CDS_pept        563676..564203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0464"
FT                   /product="HPP family protein+B94"
FT                   /note="PFAM: HPP family protein+B94; KEGG: dvu:DVU3251
FT                   membrane protein, HPP family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42989"
FT                   /db_xref="GOA:A0L4U6"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U6"
FT                   /protein_id="ABK42989.1"
FT                   /translation="MTGYLKRLIAPATPNAKVADMFWSWLGSFLGIGLVAWLHDHLLTQ
FT                   QDLVFIIGSFGASAVLIYGAISSPLAQPRNLLGGHLISALVGVAVFQTMGSLPWLAAAL
FT                   AVSLAIVAMQFTRTLHPPGGATALIAVIGSQRIHDLGYWYALLPALSGAICLLVVALLV
FT                   NHLAPGRNYPTT"
FT   gene            complement(564311..565444)
FT                   /locus_tag="Mmc1_0465"
FT   CDS_pept        complement(564311..565444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0465"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   nha:Nham_3508 TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42990"
FT                   /db_xref="GOA:A0L4U7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U7"
FT                   /protein_id="ABK42990.1"
FT                   /translation="MQTQSLLATARRLAWVTALSVTLSACVTNPDFSSAPTTTKGAKSP
FT                   VELAMDEVHSKLDALTAADASRRTALTDQNKRLELLQQEITSLRGELDQTRHGAQQLGQ
FT                   HVAELRNYIARAYGMPMQSSPSVDFAQPPAEQGAQVGFNQPGMGLVGMQQNQESARQAQ
FT                   ATMEQPGMNPNAAMQPGMEPMAQSNLGNGTLQPQGMGGAVMQPPPLLPQQPGMGQPTMG
FT                   MLGQNTQQALTAAQPPAPKVLPQATNAKEAYDQAKLYVTSGQYDRAQELFDGFLKQYGS
FT                   DPLADNAQYWLGEMHYVQRNFRSALVEFNNVLVKWPNSGKVPDSLLKIGFSFYELEDYE
FT                   NARRALEQLVQNYPNANAVPLAMQRLKRIEQVKANIH"
FT   sig_peptide     complement(565337..565444)
FT                   /locus_tag="Mmc1_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.525 at
FT                   residue 36"
FT   gene            complement(565566..566177)
FT                   /locus_tag="Mmc1_0466"
FT   CDS_pept        complement(565566..566177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0466"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rru:Rru_A1095
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42991"
FT                   /db_xref="GOA:A0L4U8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U8"
FT                   /protein_id="ABK42991.1"
FT                   /translation="MKRTGLFITATLLTVILTGCGGVPKDKPGDLRQEQMQDQYKGTTD
FT                   EGQALTRPEGMAEEIGGGAGMDGSQYKSGSYYDEQSAAGSAGGTQDPMGQPENMIFFGY
FT                   DSEALTYEAQTVLAQHAVAIIKGGVQSVSIEGHCDERGTREYNLALGQKRADSVKNFLN
FT                   AQGVPTTVMRTVSYGKERPLYTGHTETSWARNRRAVLVYQ"
FT   gene            complement(566344..567696)
FT                   /locus_tag="Mmc1_0467"
FT   CDS_pept        complement(566344..567696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0467"
FT                   /product="TolB, N-terminal domain protein"
FT                   /note="PFAM: TolB, N-terminal domain protein; WD40 domain
FT                   protein beta Propeller; KEGG: sme:SMc04461 probable TOLB
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42992"
FT                   /db_xref="GOA:A0L4U9"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4U9"
FT                   /protein_id="ABK42992.1"
FT                   /translation="MNMIFPPIHRLGIRLLASLLFLLLSGSVHAQGMMIEVQKQGLEPM
FT                   PIAIPSFASVGLNGHVEVGDRFSHQLTGLVISDLSGSGLFRPLEQRGFLQPSDKLWQQG
FT                   PDFRKWRLVGADAVVQGAITYRGSRIQVDFFLHDISRGTLIGKGWRFTTKPENWRHVAH
FT                   RVADEIYTRLTGERAYFTSRIAFVAKRDKQSFLSMMDADGANRMDLKVKGRNDLVLTPR
FT                   FSPNGEQLLYISYESSEPRIYLWDLYTGKRVKRSNYPGLNSTPAWSPDGNRMALTLSKD
FT                   GNSEIYVIDMRNQSLQRLTYNAAIDTSPSWSPDGRRMVFTSDRAGTPQLYIMDADGSDV
FT                   RRLTQRGQSSTAPSWSNRGDKIAFVRGGGGKFRIAVIDPTGRDEQLLTDSWMDESPTWS
FT                   PNGRVILFSRQQQGSSRTRLFTIDITGFNEQEVPLEQDISASDPSWSPVIK"
FT   sig_peptide     complement(567604..567696)
FT                   /locus_tag="Mmc1_0467"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.946 at
FT                   residue 31"
FT   gene            complement(567714..568976)
FT                   /locus_tag="Mmc1_0468"
FT   CDS_pept        complement(567714..568976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0468"
FT                   /product="Cell division and transport-associated protein
FT                   TolA"
FT                   /note="TIGRFAM: TonB family protein; TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42993"
FT                   /db_xref="GOA:A0L4V0"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4V0"
FT                   /protein_id="ABK42993.1"
FT                   /translation="MRRRGWLLLLFGLWPGLLHAAPSRQAIQQWGAELVAQVEANWLAP
FT                   AGIDSHGLTVQLSIQWQSTGALIMHGIRRASGQRAFDESVVHAIEQSQNLPAPPVGCQI
FT                   CLKPITFNFAPGAKPQQPAQIRPRAISRSVPPPRAKAGSAPPPAQGDFSQAIDQMLKSQ
FT                   PTPQQLAQQQAEQQAWQAQLYPLWQQQWQPPAQVDTRTLWGQWRVGWNGKGGLQVLERL
FT                   QSSGHGAVDAAIVQALQGITQLPTPPPHCTVCQQPMVMTFERGSLRKAAEQTAASELAA
FT                   PSPPETPALPHWLGPSWHEDAKPMEPTLHKPYEPPPQPSSAVEKQREVAQWFQHVRHAI
FT                   SNQWQRPSGDIHVGRSMMLRVQWLENGTLEWVSTVRPSGHEGYDETVLKAVEAVAQLPP
FT                   PPEGCTLCLRPIYITMHNEQP"
FT   sig_peptide     complement(568914..568976)
FT                   /locus_tag="Mmc1_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.784 at
FT                   residue 21"
FT   gene            complement(568982..569989)
FT                   /locus_tag="Mmc1_0469"
FT   CDS_pept        complement(568982..569989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0469"
FT                   /product="Cell division and transport-associated protein
FT                   TolA"
FT                   /note="TIGRFAM: TonB family protein; KEGG: nmu:Nmul_A2715
FT                   TonB-like; TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42994"
FT                   /db_xref="GOA:A0L4V1"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4V1"
FT                   /protein_id="ABK42994.1"
FT                   /translation="MFADRQFLWWSLGLHVGVVLIALLLPLLTPRVAPPPAAMMVNLVD
FT                   LPAPQAKATQPEPPQLQKPKPPEPKPVAPKPVEPKPVESKPVAKPEIEPTPPEPKPQPA
FT                   PKPPEKVVEEPDQPAEKVDITPMRRKPDPKKIAEEQRAKEEALKKKQAEEKRLQEEAAK
FT                   KKQAEEQRKKEEARKQAEEQRKKEEARKQAEIKRKQELAAQQMREAIAKQQAEIKAQQQ
FT                   REEAIRQQQLREAALAQQQAEEIRKWQGALREATYKAWRPPFGVDISSMKCLATVKITV
FT                   DGRLSLISISQTSGFAPYDDSVQRAIAATRNLPKPPSHCSACRGEITISFTPSR"
FT   gene            complement(570012..570437)
FT                   /locus_tag="Mmc1_0470"
FT   CDS_pept        complement(570012..570437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0470"
FT                   /product="Cell division and transport-associated protein
FT                   TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   gox:GOX1685 ExbD/TolR family protein; TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42995"
FT                   /db_xref="GOA:A0L4V2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4V2"
FT                   /protein_id="ABK42995.1"
FT                   /translation="MGMNAGMGNGGVHRFQAMSDINVTPLVDIMLVLLIIFMVTAPLLT
FT                   HGIEVELPHVQSDAITAQVEPLTISVSPDGSASIEGERMSLSEMTDKVTFVRKSTPSIR
FT                   IFVRGDTHAAYGHVMAVMGALKAAGIEQVGLITQPNS"
FT   gene            complement(570439..571131)
FT                   /locus_tag="Mmc1_0471"
FT   CDS_pept        complement(570439..571131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0471"
FT                   /product="Cell division and transport-associated protein
FT                   TolQ"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   mca:MCA1226 TolQ protein; TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42996"
FT                   /db_xref="GOA:A0L4V3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4V3"
FT                   /protein_id="ABK42996.1"
FT                   /translation="MTKHSVFDLITQAGPLVQLVMLALLAASVVSWAIIFDKWRRYRRI
FT                   TQDAEAFEERFWSGGSVASLFQSATKEWPDSPMVVMFSAGFREWKRWESNEPTSEGDGG
FT                   DLVTNVRRAMTVALNRELENLEKGLTFLATVGSTSPFVGLFGTVWGIMNAFLGLTGAKA
FT                   STLTMVAPGIAEALIATAMGLVAAIPSVIAYNKYSSEMRRLHAKMDNFGAEFLNILERR
FT                   SASRRRGQ"
FT   gene            complement(571140..571535)
FT                   /locus_tag="Mmc1_0472"
FT   CDS_pept        complement(571140..571535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0472"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mca:MCA1224 thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42997"
FT                   /db_xref="GOA:A0L4V4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4V4"
FT                   /protein_id="ABK42997.1"
FT                   /translation="MNLFSQDIRVYYEDTDAGGVVYHSRYLNFMERCRTDWLRSLGIEQ
FT                   ATLAEQTGLRFAVTHMEIAFQKPALLDDLLTVSVSELRRRPASLEFTQEIARQNTPLIR
FT                   ASARVACLDEGLRPVRLPAVLLQRLPQ"
FT   gene            complement(571532..572563)
FT                   /locus_tag="Mmc1_0473"
FT   CDS_pept        complement(571532..572563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0473"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /note="KEGG: pca:Pcar_2338 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42998"
FT                   /db_xref="GOA:A0L4V5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4V5"
FT                   /protein_id="ABK42998.1"
FT                   /translation="MEEMASRMISGDPELGEPFQENGLRPKYLKEFVGQKPLKANLTVF
FT                   LHAAKQRAEAIDHILLHGPPGLGKTTMAQIIAWEMGVGLRSTSGPVIDKAGDLAALLTN
FT                   LNPGDVLFVDEIHRLSPAVEEILYPAMEDFQLDLMIGEGPSARSVKIDLPRFTLVGATT
FT                   RAGMLTSPLRDRFGILARMQFYEPDELQQIVTRSASIMGIDISADGAFEIARRSRGTPR
FT                   IANRLLRRVRDFAQVAGPGYIDKDLADRALLALEVDRNGLDNMDHRLLKALLDKFAGGP
FT                   VGLDTLAAAIGEERSTIEDVIEPYLILQGMLDRTPRGRKATHASYTAMGRTAPRPVQQG
FT                   TLL"
FT   gene            complement(573096..574676)
FT                   /locus_tag="Mmc1_0474"
FT   CDS_pept        complement(573096..574676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0474"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: ppu:PP3985 ISPpu13,
FT                   transposase Orf2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK42999"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F5"
FT                   /protein_id="ABK42999.1"
FT                   /translation="MKTLPKTLPDDPAALREIILSLQAENVLLQDKSKRMEHEAQLLRE
FT                   KLNILIAKRFGRSSEKSDPRQLGLFDEAEVTAAEEPEEDAEEIQVPAHSRKVKSKGRKP
FT                   LPEWLPRVDIIHELPESALVCGLDGHHLVEIGRETSEQLDIIPAKVQVLRHIQIKYGCP
FT                   HCKQGVKTAPTPKRPIPKALATAALLAHVAVSKYADGLPLYRQGAILTRAGIDVCRTTL
FT                   ANWMIQCGQLVQPLINLMRDKMLDYDILQMDETTIQVLKEKDKVAASNSYMWVQRGGPP
FT                   GSPVILFDYDPTRGAEVPKRLLAGYKGWLQTDGYAGYLGVGAQEDVILMGCFAHARRQF
FT                   DEAIKALGKSKKGKIGKAGQALSLIRKLYAVEKDLREEEATPERRYKVRQERSRPIIDE
FT                   LKTWLEDNRAGVLPKSKLGEAMGYLTNQWSSLIRYLDDGRLEIDNNRAENAIRPFVIGR
FT                   KNWLFSNSVRGAKASANLYSLIETAKANGWEPFVYLTKVFEGLATAQTVDEFDLLLPWN
FT                   LKSAAEPAG"
FT   gene            complement(574712..575071)
FT                   /locus_tag="Mmc1_0475"
FT   CDS_pept        complement(574712..575071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0475"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: rme:Rmet_1275
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43000"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F4"
FT                   /protein_id="ABK43000.1"
FT                   /translation="MMRPSPDISVVHLCLEPVDFRKGINGLAALVEAELELNPFDEALF
FT                   VFRNRSLDKVKILYWERNGFCLWQKRLEKDRFHWLRQGGAAEIQITGRQLNWLLDGYNL
FT                   AAMKGHNKLHFSSIV"
FT   gene            complement(575071..575412)
FT                   /locus_tag="Mmc1_0476"
FT   CDS_pept        complement(575071..575412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43001"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4F3"
FT                   /protein_id="ABK43001.1"
FT                   /translation="MEDKSIEASVLSEKQRYWLDHLRSCRSEVGTIKEYAEVHKLSLPS
FT                   LYFWKRKLTQMGFLEESGSGKRRFQRLELSSKSSAGVCRIQFPNGMTVEWSGNGGESLL
FT                   SVLRSVAAL"
FT   gene            complement(576260..576874)
FT                   /locus_tag="Mmc1_0477"
FT   CDS_pept        complement(576260..576874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0477"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /note="KEGG: sth:STH1160 Holliday junction DNA helicase
FT                   RuvA; TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA, domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43002"
FT                   /db_xref="GOA:A0L4V9"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4V9"
FT                   /protein_id="ABK43002.1"
FT                   /translation="MIAQLKGSLAAKHPDHVVMDVHGVGYRVFISLATYNELPTVGEAC
FT                   LLYTVTHVREDAFLLYGFHSESQRKVFNLLTSVNGIGTKLALAALSSHTPEALLTALSR
FT                   EDLTLLCTIPGVGKKTAQRMAMELKDKLGALPMAAPTTAIGAATMAANPAGLREEVASA
FT                   LLNLGYKPPQVDAALAKLFSAGEITDISVALKGALKLLAPA"
FT   gene            complement(576871..577413)
FT                   /locus_tag="Mmc1_0478"
FT   CDS_pept        complement(576871..577413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0478"
FT                   /product="Holliday junction endonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="TIGRFAM: crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC;
FT                   KEGG: gsu:GSU1075 crossover junction endodeoxyribonuclease
FT                   RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43003"
FT                   /db_xref="GOA:A0L4W0"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4W0"
FT                   /protein_id="ABK43003.1"
FT                   /translation="MSSASPIRVIGIDPGSNVTGWGVIDGLGQRQQVVEYGTIRLDGKE
FT                   PLPMRLHQIHAQLVSLIQRLQPHEMAVEEVFVSQNVQSALKLGHARGAAIVAGAQMGLP
FT                   IAEYTAMQVKKAVVGYGRAEKNQMQEMMRMLLNLDKKPAQDAADGLAIAMCHLNQRQWH
FT                   QQTLPAAILGLQRGGRA"
FT   gene            complement(577410..578162)
FT                   /locus_tag="Mmc1_0479"
FT   CDS_pept        complement(577410..578162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0479"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   gme:Gmet_0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43004"
FT                   /db_xref="GOA:A0L4W1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4W1"
FT                   /protein_id="ABK43004.1"
FT                   /translation="MAGHSKWANIKHRKGAQDAKRGKIFTRLIKEITVSARMGGGDAAT
FT                   NPRLRSAITAARAQNLPKDTMDKAIKRGTGELEGVNYEEVRFEGYGPGGVAIIVDCLTD
FT                   NNNRTVADVRHIFNKYGGNMGTHGCVAFMFDKKGQIMFDAEGINEDAIIEAALEAGAED
FT                   VVHEGDSFEVLTDPNDFSDVLEALATAGFATPSEAEVVMRPQNLQQLDEQQASTMLKLY
FT                   EKLEENEDVQNIYANFDISDEIMETLSA"
FT   gene            complement(578246..578506)
FT                   /locus_tag="Mmc1_0480"
FT   CDS_pept        complement(578246..578506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43005"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4W2"
FT                   /protein_id="ABK43005.1"
FT                   /translation="MGMGCPNCKWPRGLPRTIRASCLPLAAGLPRQTPPWCLTILCGCV
FT                   IPTGLPKPLFTHAYLKTSITSPLALATLRALYTCLGFTRGG"
FT   gene            578554..579819
FT                   /locus_tag="Mmc1_0481"
FT   CDS_pept        578554..579819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0481"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: gsu:GSU1624 glycolate oxidase
FT                   iron-sulfur subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43006"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4W3"
FT                   /protein_id="ABK43006.1"
FT                   /translation="MNKPNYGPLKNAEKCTHCGYCLPVCPTYRVERDEMQSPRGRVSIV
FT                   LALMRGAMQPAAAVDALSHCIGCRACHGACPVGVRPGKLSLAARAFQPIPSTRLGGWLH
FT                   RITDSHQTTAVASRMLDFYVRSGLQRVVRPLLKGIPPLADKERLIPSHRPKPPVFLPEP
FT                   PPDAPTVALLGGCMARLFLPHVGMSARALLQSMGFRVITPKGFGCCGAPHRERGDKEAF
FT                   VRQAKKTLDAFGALDHIEAVICDSSVCTITARSYDKAVSKRDGDYAPIAKAFSSKVMDL
FT                   TEFLSQHQPRWQQAAVDPGMGTLAYQDHCQMRHGLGTYAEPRNLLDALPVAVTEIAGDG
FT                   ACCGAGGEYMMRYPQRSRLIRQDKLEAIHASGAQTVVATNPGCMLNTQAGLEAEHSPVQ
FT                   VRHLAEVLWKSRENLLPRVKQS"
FT   gene            579944..580939
FT                   /locus_tag="Mmc1_0482"
FT   CDS_pept        579944..580939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0482"
FT                   /product="import inner membrane translocase, subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase, subunit
FT                   Tim44; KEGG: gme:Gmet_1927 import inner membrane
FT                   translocase, subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43007"
FT                   /db_xref="GOA:A0L4W4"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4W4"
FT                   /protein_id="ABK43007.1"
FT                   /translation="MGQRRGFALVAITLTLMFSTLTVWPEQAEARMGRSSSFGSKGSRS
FT                   MSTLPQSSPSRFSSTQRPSATQQTANQPQQKSGFGGMLGGLFGGLLLGGLLGSLMGAGG
FT                   GLGGLLMMVLLAAGVFFLVKRFMGTRPPADEAAYARSHGAYRPQPQEMDQPMQREMHMP
FT                   QGLPMGSGSDVEDFSAQDERQQTLDRLLAEDSNFDEFTFIDGAKRCFEMLQTSWSTFDM
FT                   TTLQGLLTPQMMEEVENHARQLQANGQRDVVKNVHFSEAALVEAWSEQGQDYLTVRFDV
FT                   SLVEYVEDASGQVVSGDANHPQQVQEFWVFTRAQGARNPNWQLSAIQQAQ"
FT   sig_peptide     579944..580036
FT                   /locus_tag="Mmc1_0482"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.695 at
FT                   residue 31"
FT   gene            581012..581395
FT                   /locus_tag="Mmc1_0483"
FT   CDS_pept        581012..581395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43008"
FT                   /db_xref="GOA:A0L4W5"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4W5"
FT                   /protein_id="ABK43008.1"
FT                   /translation="MWRFGGMVSLFLLLIALPLYGAPEQHSSAAVAPGAVDRLQGEPGE
FT                   VSVAPLARVERGRVAESQGSWWMAWGLPLLVVLLLWRWISRMPSRGMTGLGDAYLEGLG
FT                   GTAEAKNQGQAAKTDKETTVKPS"
FT   sig_peptide     581012..581101
FT                   /locus_tag="Mmc1_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 30"
FT   gene            581611..582861
FT                   /locus_tag="Mmc1_0484"
FT   CDS_pept        581611..582861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0484"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   sat:SYN_02860 membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43009"
FT                   /db_xref="GOA:A0L4W6"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4W6"
FT                   /protein_id="ABK43009.1"
FT                   /translation="MLRKSLWAALIALMALLSGCSFFGVPDEPLPPVEIQPAQALQEVN
FT                   WQDLPMTKPKRADLRAWAEALKQSYHYYKSQPAAKKVRFGRYYTTNAKMAEFTLELAEN
FT                   AAHTSPYGFARWVYKNVTPFRAVGHDGQGSVLFTAYYEPLLLGSKTPTERFRYPLYKRP
FT                   PELITLRLQDFRTDLPNVMLRGQRKGDQLVPFHDRQAIEQRNVLRDKALELVWVDDPVG
FT                   HFFLQVQGSGRVKLPDGSLMRVGYADANGHPYRSIGKLLIEEGRVPKEEMSLPVLRQWL
FT                   AAHPDEMQRVMHHNPSYVFFKEIKGGPYGNIGVPLTAGRSIATDYRLFPRGAPAMIRTE
FT                   LPVFSGEGPPSGWEKEVRLVANQDTGGAIRGAGRVDLFTGFGPDAERTAGEMKQDGGAL
FT                   YFFAPKNMALWPEGQQD"
FT   sig_peptide     581611..581733
FT                   /locus_tag="Mmc1_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.799 at
FT                   residue 41"
FT   gene            complement(582858..584951)
FT                   /locus_tag="Mmc1_0485"
FT   CDS_pept        complement(582858..584951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0485"
FT                   /product="ATP-dependent DNA helicase, RecQ-like protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: psb:Psyr_3804 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family; PFAM:
FT                   helicase domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43010"
FT                   /db_xref="GOA:A0L4W7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4W7"
FT                   /protein_id="ABK43010.1"
FT                   /translation="MDKRHAETLLQTMVGSAEAHFRPGQWQAVDALVNQQQRLMVVQRT
FT                   GWGKSAVYFVSTAILRQRGAGPTLIVSPLLALMRNQVQAAERLGIRAISINSANTEAWD
FT                   GLLDDLHGDRVDALLISPERFSNPQFADTVLPHMLDRIGLFVVDEAHCISDWGHDFRPD
FT                   YRMLVHIIQQLPPTTPVLGTTATANDRVLADIQAQLGNVQILRGPLMRESLLLQNLHLP
FT                   DQISRLAWLAEHIPHLPHSGIVYVLTKRDAEQVSQWLNRNHIAALPYYSGVQGHGFTES
FT                   NSYRLYLEDQLIHNKIKVLVATSALGMGYDKPDLGFVIHYQAPGSVISYYQQVGRAGRA
FT                   LEQAYGILFHGAEDEAIHHYFRQQAFPSPQEVETILEMLHQHGATTTRGLMRHGNLGWG
FT                   AVEKALKYLSVQKPAPVTREGSQWQLSGHPFNMDHAHIDYLTSQRELEWQEMQRYVQSP
FT                   TCLMRFLRNALDDPDASNCGRCAVCRGQAIVPTRWSAAQAAAARTVMQSDPITWEPRKQ
FT                   TEKGAFVLTKLATHLPKAQQAQVGRALCRWQQAEWGQLAAQGYKKGHFAEALVQAMAHM
FT                   IQQWNPQPAPTWVTCVPSSRMPTRVPDLALRLAQQLKLPFATCVSQSRPNARQKTMRNS
FT                   FYQCRNLDGVFALGSIPHNGPVLLVDDFVDSRWTFTVVAALLAQGGVPLIYPTAMISLE
FT                   QTL"
FT   gene            585141..586265
FT                   /locus_tag="Mmc1_0486"
FT   CDS_pept        585141..586265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0486"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pae:PA4913 putative branched-chain amino acid transport
FT                   system substrate-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43011"
FT                   /db_xref="GOA:A0L4W8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4W8"
FT                   /protein_id="ABK43011.1"
FT                   /translation="MKAWLKGTMAAAVGVWGLAAVAVQAEEMVRIGVAGPFSGAYAAFG
FT                   EQQWRGAEAAIVDINRGGGILGKQILLIKGDDACEPKQAMAVANRLVDNDEVQAVVGHF
FT                   CSSTTMPASEVYDEAGILVMTHGSTNPMVTERGLKTVLRMCGRDDQQGTVGAEFVVKRL
FT                   GAKRVAVLHDKDTYGQGLADAMKAHLHTLGLTEVMYEGLTRGEKDFNALVTKIKAAKAD
FT                   AVYFGGLHSEAGPLVRQMREQGVDVPLVSGDGIVSEEFVTAAGGGRFVKNVYMTFGADP
FT                   RKSPEGKALVARFREAGYEPEGYTLYAYAVVQSIAAAMQESGSYNGVELANWLKRHSVE
FT                   TVMGPKSWDAKGDLKVSDYVMYQWDENGKYAEVE"
FT   sig_peptide     585141..585218
FT                   /locus_tag="Mmc1_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            586469..587392
FT                   /locus_tag="Mmc1_0487"
FT   CDS_pept        586469..587392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0487"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pfo:Pfl_0553 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43012"
FT                   /db_xref="GOA:A0L4W9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4W9"
FT                   /protein_id="ABK43012.1"
FT                   /translation="MNSYVIGQQLVNGVVLGSIYGLIAVGYTMVYGIIGMINFAHGEIY
FT                   MISAYLTAITLAVLTTWGVDSVFLALILTLISSIAFTALYGWTVERIAYRPLRRSTRLA
FT                   PLISAIGMSLVLQNYVRLAQGSRNQGVPSLMEGNLRLVGENPEQFVQVTYVQLVIVLTA
FT                   LISMGILSWTIQKTALGRACRATQQDRVMAELLGVNTDRIISVVFVLGASMAAVAGVLV
FT                   TVNYGSFDFHVGFVTGIKAFTAAVLGGIGSLPGAMLGGLILGLSESFFAGFVNSDYKDV
FT                   FAFSILVLVLIFKPSGLLGRPAVEKV"
FT   gene            587397..588671
FT                   /locus_tag="Mmc1_0488"
FT   CDS_pept        587397..588671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0488"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   psb:Psyr_0599 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43013"
FT                   /db_xref="GOA:A0L4X0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X0"
FT                   /protein_id="ABK43013.1"
FT                   /translation="MQKVIKHAAMDALKVGLLGLLLFGPMTGMLLDGYGIHYAPSRAFW
FT                   LVGLLLLGRFMVVVVMNSPALSGVADLFKRKDRVEVVVSPMGQQHHKILVVLTLMVAMA
FT                   LPFLLSKYWLNVAILALIYILLGLGLNIVVGLAGLLDLGFVAFYAVGAYSYALGAEYLG
FT                   LSFWQAIPFAALLAASFGAVLGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWISLTGGPN
FT                   GLRTPLPTLFGMEFTKRATQGGTPYHEVLGQWMEIDYSRAARYVFIYVTLLVVVTLLVY
FT                   MVQRLKRMPIGRAWEALREDEIACRSLGINHVMVKLSAFSMGAMVGGVGGVFFAASQGF
FT                   VNPASFTFFESALILAIVVLGGLGSVVGVIVAAVVLTVLPELLRDFTEYRVLIFGCAMV
FT                   VMMVWRPRGLLRIHRPEFVVEKRVP"
FT   gene            588668..589531
FT                   /locus_tag="Mmc1_0489"
FT   CDS_pept        588668..589531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0489"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pae:PA4910 putative branched-chain amino acid
FT                   transport system ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43014"
FT                   /db_xref="GOA:A0L4X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X1"
FT                   /protein_id="ABK43014.1"
FT                   /translation="MSLLTVEDLTMCFGGLTALNQVSFGVERGSITSLIGPNGAGKTTL
FT                   FNCVTGFYRATAGEIWLHRPGQQGQDLVEMLGQPFRLGDWVDARAFTRRVWFKVFGGSH
FT                   RVARAGVARTFQNIRLFREMTVLENLLVAQHGRVNRNLVAGIVQTAAFRRSEREALERA
FT                   LYWLAEMGLEQSANQLAGALPYGYQRRLEIARALCTDPVLICLDEPAAGLNPRETAELS
FT                   GMMEGLRARHGLTIFLIEHDMGLVMEISDHVVVLDHGEVIARGTPQQVQKNPRVLEAYL
FT                   GVEEAA"
FT   gene            589528..590262
FT                   /locus_tag="Mmc1_0490"
FT   CDS_pept        589528..590262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0490"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pfo:Pfl_0556 ABC transporter-like; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43015"
FT                   /db_xref="GOA:A0L4X2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X2"
FT                   /protein_id="ABK43015.1"
FT                   /translation="MRQVEPRMVLELEGVAAGYGPVRVLHGVSLHVHAGEIVTLIGANG
FT                   AGKSTLLMSIFGNPRPLAGVIRLHGVDIVGESTYGIARRGIAQVPEGRRIFGEMTVWEN
FT                   LLMGVTPLGARDGEREGRDLGWVMSLFPRLGERREQRAGTLSGGEQQMLAIGRALMSRP
FT                   RLLLLDEPSLGLAPLMIKQIFAILRQIADEGVTIFLVEQNANQALQLADRGYVLVNGRI
FT                   TLSGSGQALLGDAEVRGAYLGG"
FT   gene            590955..591458
FT                   /locus_tag="Mmc1_0491"
FT   CDS_pept        590955..591458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0491"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   mag:amb2547 phosphatidylglycerophosphatase A and related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43016"
FT                   /db_xref="GOA:A0L4X3"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X3"
FT                   /protein_id="ABK43016.1"
FT                   /translation="MFWGTAPTHWKSWSTRDRITMLIATVGGSGWSPKAPGTMGTIASL
FT                   PIAWAAMSLGPNSHLAVLLLVCSIGWWSSHRAITLLGKKDPGAVVIDETAGLLLTLLFV
FT                   PLANLNLLLGFLLFRFFDILKPWPIRWLDQHVHGGLGIMLDDLLAGIFAGIPLLLLQSY
FT                   LPLH"
FT   gene            591601..592749
FT                   /locus_tag="Mmc1_0492"
FT   CDS_pept        591601..592749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0492"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="PFAM: CinA domain protein; KEGG: mbo:Mb1936 probable
FT                   cinA-like protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43017"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X4"
FT                   /protein_id="ABK43017.1"
FT                   /translation="MRALLVTPRWSELEGLLRPSNRPLLDLMLLSLGYDQLDTLEIDPA
FT                   EPFDPTSLDAAYAVVIIQAQGESPRLRRGVISRLGLSLGLDGETSSTLRVVGAKPLRNG
FT                   AGDSVGFLANRRGRVVAYCDHTVGEVMPALEYGLRVILTEEAHSLRRLPFSTCRLVECA
FT                   GEPDNITLHMDEQTAAAMHRRCKVMPMPNGDTAVLIPHEDVMAESLPRIWGNRVYAQGA
FT                   VALEQYVAELLWRRGWRVATAESCTAGLTAARLSAVPGSSDYLDGGWVVYSNGAKSRLV
FT                   EGIEPLIERCGAVSAEVALALARGALKGHAVDLAVAITGVAGPGGGSETKPVGTVFLAV
FT                   VSKEGNILEHRGFYHGNRDRIRYQASQTALHLLRRLAEKVGS"
FT   gene            592749..593837
FT                   /locus_tag="Mmc1_0493"
FT   CDS_pept        592749..593837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0493"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   ade:Adeh_2911 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43018"
FT                   /db_xref="GOA:A0L4X5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X5"
FT                   /protein_id="ABK43018.1"
FT                   /translation="MKKWHYQRSLLSMALLLFSSLSFGCASAFGNQNWKWFDGTEKDGL
FT                   KNLQLDSTLAHKNRPLPYANKNEVIGSGAFNYRIQGHETLLLLARTYDLGYNEVSLANP
FT                   KMDAWAPKKGQEVFLSMTHVLPTDIHQGTALVINLPEMRLYHRRADGRLETFPVGIGRE
FT                   GFDTPISRAKIIRKKSAPSWYVPASIREENPKLPAVIPPGASNPLGSHAIYLSLPGYLI
FT                   HGTNKPYGIGRRVSHGCIRMYPEDIPRLYTSARVGATVAIVNEPAKAGWFGDNLLLEIY
FT                   PGLPTRKKGEKETTPPQPMEEQAAMSIRKALERRSGYSAKIDWDLVRGMARAPDGIPRV
FT                   VGRMLVGDDVKQLVPVRLIEPR"
FT   sig_peptide     592749..592841
FT                   /locus_tag="Mmc1_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.581 at
FT                   residue 31"
FT   gene            complement(593978..597244)
FT                   /locus_tag="Mmc1_0494"
FT   CDS_pept        complement(593978..597244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0494"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mba:Mbar_A3708
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43019"
FT                   /db_xref="GOA:A0L4X6"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X6"
FT                   /protein_id="ABK43019.1"
FT                   /translation="MAIILPFGSTPQPSQTPPSEQKPRQGSSRWVKVLGGGMIGFFLLG
FT                   SLSFNYLDGWGSLPITGGLGLIIGAYTLWFWTQPWQVKLLGRLITIFISAVLLVLSSLF
FT                   YNPFWELVPQRLNIINLGRPTAINLSYAIIILMFIVAIILALIHAKSREDSTEVIPAQS
FT                   QKRYQHVFIDLNYIVVLLLGFMAFLVFMAMTPPKTPSTPSHTPVSGSIALLETALRPPA
FT                   PAPSFTGRQGELKQLKEHLLSPTGATVGMVVLTGEGGVGKSQIAKKFAQEHQKHFEKIV
FT                   WLPSENRSQIQKNLLQLADLLGLPPLSDSLRVRQVVSILSAQGGWLLIYDNADDGPSQL
FT                   EGLLPSTAMGGRILITSRNPNWGQLQIPTLEVKTFATQVSVRFLNKLTSRKGDDDTAAQ
FT                   LAEFLGNLPLALEQAAAYIEQTAISYRNYLSLLRGANTLLPILEKKTVPHNHNRHSIAS
FT                   TWKLSIDKLAEQQQQPAIQLLNLLAFLNPDGIPLTLLKQIPNTQPHDPLAKLPQNSLAL
FT                   NDAVAALRSYSLIKVENEALTIHRLLQEVIRHDMDQEAKTAWGSATARLLKPIFLYDVK
FT                   DSSTYPAALPWLPNLMAWFKQAQRLELHDPTALDIMDRSASLLRAMGNLKEAKSMAQTI
FT                   LTLKQKYLGADDLSIALSENNLASVLKTMGDLNGAKAGFERALIIDKKNFGDQHPNVAN
FT                   NQRYLALVLKAMGDLNGAKEMLKRALKIYKNAYGDHRSNIARVENALAGVHHNMGDLNE
FT                   AKAGYERALTISTEIFGDRHPEVSRYYNNIAWVLQDMGDLNEAKKLFERALQISTKNYG
FT                   DQHPSVALREDNIAGVLKEMGDLNGAKVRFERALQIDTKVYGDQHPNVARDESNLAKVL
FT                   QKMGDLNGAKDRFERALKIDTAIFGDQHYRIATRENNLSGVLREMKDLDGAKARIARAL
FT                   QIDTAVFGDQSHKVARDLNNLALIRKDIGDLDGAKANLEKALNIDSRVYGEHPNIARDE
FT                   NNLALVLQAMRDLKGAKAGFERALKIDTRIYGNQNPKVAIRENNLAGVLQDLGDLEGAK
FT                   AGFERALKILDNSYGPENPLTKKVRANLDKLLKQMASPAP"
FT   gene            complement(597437..598258)
FT                   /locus_tag="Mmc1_0495"
FT   CDS_pept        complement(597437..598258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0495"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rba:RB8612 probable 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43020"
FT                   /db_xref="GOA:A0L4X7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X7"
FT                   /protein_id="ABK43020.1"
FT                   /translation="MSSHQQDIQQGERFKFGENWSLFLSLVDEERIQSAEHSLQQLLGI
FT                   TDLTDKRFLDIGSGSGLFSLAARRLGAQVVSFDFDPHSVACTTELRRRYFCDDAHWQVM
FT                   EGSVLDPAFMEGLATFDVVYSWGVLHHTGQMWQAIDYASQRVAAGGLLSLAIYNHQGVR
FT                   SALWKKIKRFYCRGRLAALLVKFLCYPYYFTKTLAKGVLLHGGNPIGAFLDKSNRGMSE
FT                   LRAWDDWLGGYPFEVAKPEEIFHFLKARHFSLENLTTLNGHGCNEFLFIKR"
FT   gene            598504..599334
FT                   /locus_tag="Mmc1_0496"
FT   CDS_pept        598504..599334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0496"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mta:Moth_1083
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43021"
FT                   /db_xref="GOA:A0L4X8"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4X8"
FT                   /protein_id="ABK43021.1"
FT                   /translation="MSVAAKGAGQVRILILGDIVGRPGRNVVNEHLADLKKELELDLVV
FT                   ANAENATNGNGLTPKTADQLFNMGIDLITTGNHVWHYSELIDEIQQLRRVLRPANYPPG
FT                   APGHGHGIVTTRSGIKVGVINLIGRVFMNDVDCPFRAADALLDKIHRECDIILVDMHAE
FT                   ATSEKLALGIYLDGRVTAVVGTHTHVPTADHRVMPGGTGLQSDLGMCGVYINSVIGVKP
FT                   ESVVNRFVNGMPARHVTQEGPAMLCGALITAEAKNGRCVDIQPVRRGVGLTPAP"
FT   gene            599383..600111
FT                   /locus_tag="Mmc1_0497"
FT   CDS_pept        599383..600111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0497"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: mag:amb1539
FT                   phosphoribosylaminoimidazolesuccinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43022"
FT                   /db_xref="GOA:A0L4X9"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4X9"
FT                   /protein_id="ABK43022.1"
FT                   /translation="MQKGEKLYEGKAKVLFATDDPNMLIQYFKDDATAFNGIKKGTIAD
FT                   KGVVNSLISTRIYHILEKVGIPTHLEELLSPREQLVHKVEILPIEVVIRNRVAGSLARR
FT                   LGIEEGTELARPLVEFYYKNDELDDPMVTIDHAEVFGWAKHREIEEMIEMSLRINDILI
FT                   GFFANIGIDLIDYKLEYGRLAVSPSTLVLADEISPDGCRLWDMETGEKLDKDRFRRDLG
FT                   GVEEAYQEVARRMGLEVPGR"
FT   gene            600473..604360
FT                   /locus_tag="Mmc1_0498"
FT   CDS_pept        600473..604360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0498"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: mfa:Mfla_1031
FT                   phosphoribosylformylglycinamidine synthase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43023"
FT                   /db_xref="GOA:A0L4Y0"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Y0"
FT                   /protein_id="ABK43023.1"
FT                   /translation="MDATHVLTLNGSSAYSSFRLEKLLDACQGVVPQLQSVEAWFVHFA
FT                   HLQRPLQGDEQSTLEKLLTYGPKEQSLSQVAQPDLWIIPRFGTTSPWSSKATDIALHCG
FT                   LDAVIRLERGMAFRFGGLMAGDLEKLLPLIHDRMTQQVVVDAAALPGLFKSFSPGALRQ
FT                   VPTQQEGRTALERANADWGLALSEDEIDYLLEQYQRMGRNPTDVELMMFAQANSEHCRH
FT                   KIFNADWHIDGEARPHTLFGMIRNTHIRAPEGTVVAYTDNSSVIEGGAGQRFHPDTQDG
FT                   VYRFHDETTHILMKVETHNHPTAISPFPGAATGSGGEIRDEGATGRGSSPKAGLTGFSV
FT                   SNLNLPGAVRPWEQPYGKPERIVSALDIMLDGPLGGAAFNNEFGRPNLCGYFRTFEQSV
FT                   AGEVRGYHKPIMIAGGLGNINADHVEKKPLKAGDLIIQLGGPAMLIGLGGGAASSQTSG
FT                   SSHAELDFASVQRDNPEMERRCQEVINRCWQLGEANPIRSIHDVGAGGLSNAVPELIHD
FT                   GGVGGRFDLRQIDNADPGMSPMEIWCNEAQERYVLAIDAKDRARFEAICRRERCPFSVL
FT                   GEATTEEQLVLIDSMNGERCIDLSLNTLLGKPPRMSRDVSHHRRQVHPLSIPTGLSLSE
FT                   MCYRVLRLPTVADKSFLITIGDRSVTGMVTRDQMVGPWQVPVADVAVTARGYTGYVGEA
FT                   MAMGERTPIALLDSPAAGRMAVGEALTNMAAARVGDLSRVKLSANWMAPAGHPGEDANL
FT                   YETVEAVGLELCPALGISIPVGKDSLSMKTVWKDAQGNPRAVTAPVSLIISAFAPVVDV
FT                   RDTATPQLRTDLGETRLILVDLAGGKNRLGGSALAQVLGQMGDVPPDLDDADSLKQFFQ
FT                   TIQVLHEAKKILAYHDRSDGGLFVTLCEMAFAGHCGLDIQLAGLGAQREGVLFSEELGA
FT                   VVQVRADDAKKMLKLLNCCGIATDIGAPSESGRLRFRRGHETVLDLPRVELQRAWSETS
FT                   WRMQSLRDHPQCAQQAYDALLDVNDPGLHARLTFDPAHNVAAPYINSGVRPSVAILREQ
FT                   GVNGHVEMAAAFHRAGFEAVDVTMAALAKRERFLSDYQGLVACGGFSFGDVLGAGEGWA
FT                   KSILFDAALRESFAQFFGSSDSFALGVCNGCQMLSNLHTLIPGTELWPRFVRNRSEQFE
FT                   ARFSMVEVTKTPSMFLHGMQGSRMPVAVAHGEGRAEFAHLAHQDRALAEGLVALRFVDG
FT                   YGQATERYPANPNGSPQGITGLTTADGRVTIMMPHPERVFRTVQNSWHPDHWGEDGPWM
FT                   AMFRNARKWVG"
FT   gene            604463..605314
FT                   /locus_tag="Mmc1_0499"
FT   CDS_pept        604463..605314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43024"
FT                   /db_xref="GOA:A0L4Y1"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Y1"
FT                   /protein_id="ABK43024.1"
FT                   /translation="MVEPVKKNRLRHLLRKERRIQRLMMLLVVLVGLPGGFWIILHVRE
FT                   DVATDSPFVKERQKAEWKKKGESPVVVSGGVASSSAASGSRSGGAGGPENELARPPNQL
FT                   ISKDEMAQAKQEMQQFAAQPQPQQAQPQAQPQAQQAYETRTAIKEPENSEEQSINVVEL
FT                   GPIKVGNGRLGNSLLGQRRFFAEILNQGQSVVTQVAVVIAFTNGQGGVVEQRMLNPLAI
FT                   STGVFGDTIKPLRAGEIRTFGTSIDDVPSGWDGGVRLSIQGIQPLEPVVEAPLAPPATP
FT                   VP"
FT   gene            605440..606045
FT                   /locus_tag="Mmc1_0500"
FT   CDS_pept        605440..606045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0500"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: rfr:Rfer_1726 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43025"
FT                   /db_xref="GOA:A0L4Y2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Y2"
FT                   /protein_id="ABK43025.1"
FT                   /translation="MVQTELILASTSPYRAELLGRLRLPFRQQAPQCAEAALAGELPAA
FT                   MAGRLATCKAQAVAAGLQDGLVIGSDQVATLDGVTAVGKPGDFEQALAQLEAASGRSVT
FT                   FYTGVTVLDVASGRMQRAVEPFQVVFRPLSRAQISRYLALEQPYDCAGSFKVEGLGIVL
FT                   FERLVGEDPTALMGLPLIRLTRMLEAMGVAPLGGELVS"
FT   gene            606136..606993
FT                   /locus_tag="Mmc1_0501"
FT   CDS_pept        606136..606993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0501"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: noc:Noc_0191
FT                   thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43026"
FT                   /db_xref="GOA:A0L4Y3"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Y3"
FT                   /protein_id="ABK43026.1"
FT                   /translation="MSGTDNAGRGWPTGLFIQTDWLQSNLERENLRIIQVGGENFYSRM
FT                   HIPGAVMVGYQDITGYRDGIPGFRAETALLRKLFGRLGITPESHVVVYDASGGMDAARM
FT                   VWTLHCMGHTQCYILDGGMGAWYTEKRVCTDHMPQIAPVEYRVDEDLRWDADIELMQRV
FT                   VAGELEMKVLDTRSEAEYEGQTIRGPRGHIPGARHFEWMDALRTPQDPQLKDDEALREM
FT                   LAGRGVENPHTDEVVVYCQTAHRAAHTWAVLRHLGYAKVRLYDGSMAEWGISGQPVVAG
FT                   MVPR"
FT   gene            607054..607338
FT                   /locus_tag="Mmc1_0502"
FT   CDS_pept        607054..607338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43027"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Y4"
FT                   /protein_id="ABK43027.1"
FT                   /translation="MVAGGLRGAGTAPCPNPSPRIPPLGRLAFPLGDPLKKRTRKSEQV
FT                   KRAKAKLWGGENFSPLKLFLKVEALNKGYGECGKTKFKISASWPKPAIL"
FT   gene            607380..608768
FT                   /locus_tag="Mmc1_0503"
FT   CDS_pept        607380..608768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0503"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="KEGG: vpa:VP2534 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54, G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54, helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43028"
FT                   /db_xref="GOA:A0L4Y5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Y5"
FT                   /protein_id="ABK43028.1"
FT                   /translation="MFESLSDRLEITFKKLKGQGKLSEQNIKDALREVRIALLEADVNL
FT                   NVTKAFIRRVQEKAIGVEVLKSLTPGQQVIKIVHDELVAVMGAANESLNLANQPPVVVM
FT                   MAGLQGSGKTTSTAKLAKRLIDKERKKCLLASLDVYRPAAMKQLQTVGEQVGATVLPTE
FT                   PTENPREIAKRALEEAKKGGFDVLFLDTAGRLHIDEALMSELADVAALVNPHEILFVAD
FT                   AMTGQDAVSVAKNFDDRLNITGVLLSKTDGDARGGAALSIREVTGKPIKFLGTGEKLDG
FT                   LEPFHPDRVASRILGMGDVVSLVETAMEKVDLEETFKLQEKLANKKGFTLEDFLTQMQQ
FT                   VQKMGSISDLVGMIPGAKQAMKGKELDVDDKQIKRLEAIILSMTKKERQKHALINASRK
FT                   RRIAAGSGTSVQEVNKLLKQFVQTQTMMKKLGGMGGLGKMMKGMKGLPKIPGLGGGGFP
FT                   KLPF"
FT   gene            609096..609347
FT                   /locus_tag="Mmc1_0504"
FT   CDS_pept        609096..609347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0504"
FT                   /product="SSU ribosomal protein S16P"
FT                   /note="PFAM: ribosomal protein S16; KEGG: aci:ACIAD3313 30S
FT                   ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43029"
FT                   /db_xref="GOA:A0L4Y6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4Y6"
FT                   /protein_id="ABK43029.1"
FT                   /translation="MAVCIRLARGGKKKKPVYSVVVADKRMARDGRFLEKLGQYIPMKE
FT                   GGTFAINQERYAHWISQGAKPSETVGKLVAKQQNAAEA"
FT   gene            609374..609907
FT                   /locus_tag="Mmc1_0505"
FT   CDS_pept        609374..609907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0505"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: cvi:CV3674
FT                   16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43030"
FT                   /db_xref="GOA:A0L4Y7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4Y7"
FT                   /protein_id="ABK43030.1"
FT                   /translation="MSGTEEIRWVTLGYVMGAFGLKGEMRVRSLTERPDGIFDHPVWWL
FT                   FNPKQKTRQEMRLGSGRLHGKGVVATLAGVTTREAVQALFGTEIQVPRSMLPDGGDDPG
FT                   VDGIWADLIGCQVVEVDGTELGRVVEMMATGANDVLIVRGGPEGEKLLPYIEEVVVELD
FT                   LDRQIIKVKLMEGM"
FT   gene            609937..610695
FT                   /locus_tag="Mmc1_0506"
FT   CDS_pept        609937..610695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0506"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /note="KEGG: mta:Moth_0970 tRNA
FT                   (guanine-N1)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43031"
FT                   /db_xref="GOA:A0L4Y8"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4Y8"
FT                   /protein_id="ABK43031.1"
FT                   /translation="MRFSILTLFPEMFAPLQASILGRGQKSGRLDLNLVQIRDFATDRH
FT                   QNVDDTPFGGGPGMVLKPDILSHALRATLQGETAHVVYMSPQGSRFDQATAQRLAGYGH
FT                   VVLLCGRYEGVDERFIDAHVDEELSVGDFVLTGGELPAMMVVDAVSRMVPGVLGDLESA
FT                   QADSFQTGLLDHPHYTRPAHWVVDGDHYGAPEVLLSGNHGAIAEWRRRQALLRTLIRRP
FT                   DLLGKAPLSRVEKRLIEALAVDLDALENKH"
FT   gene            610791..611141
FT                   /locus_tag="Mmc1_0507"
FT   CDS_pept        610791..611141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0507"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="PFAM: ribosomal protein L19; KEGG: rru:Rru_A1188
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43032"
FT                   /db_xref="GOA:A0L4Y9"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4Y9"
FT                   /protein_id="ABK43032.1"
FT                   /translation="MNQVQAFEQSMIPETAVPKFGAGDTLKVHVKVVEGTRERIQVFEG
FT                   VCIGRMNAGLRSTFTVRKISFGEGVERTFPVYSPRVDKIEVIRHGDVRRAKLYYLRGRT
FT                   GKASRIKEKRDW"
FT   gene            611171..611812
FT                   /locus_tag="Mmc1_0508"
FT   CDS_pept        611171..611812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0508"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: sil:SPO3452
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43033"
FT                   /db_xref="GOA:A0L4Z0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4Z0"
FT                   /protein_id="ABK43033.1"
FT                   /translation="MRHKAHPGPDLELECALLRSNRAIKTLCGVDEAGRGPLCGPVVAA
FT                   AVVLDLDNLPVGLNDSKQLSAKKREQLFEQIYVTSQVGVGEASVAEIDALNILHASMLA
FT                   MVRAVTALQGRLVVDHALIDGNRVPATLPVPGQAVVKGDAKSLSIAAASIIAKVTRDRI
FT                   MAELDRDYPHYGWAKSQGYPTQAHLQALALHGVTPHHRRSFKPVKQLLPH"
FT   gene            612386..613018
FT                   /locus_tag="Mmc1_0509"
FT   CDS_pept        612386..613018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0509"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: sme:SMc01142 probable heat
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43034"
FT                   /db_xref="GOA:A0L4Z1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Z1"
FT                   /protein_id="ABK43034.1"
FT                   /translation="MSEAEEKKMSPEPESPEPENSESSKTESQAVEGEVVEEETESCTL
FT                   PEEENSTEPSLEAQLQMALDKAEEQQKNYLRSMADMDNLRKRNAREMEQARKFAVEGFA
FT                   RDMLSVADNLERAMSHMDQESDNEQIKAIVDGVKMVNSELAKSLEKHGIKRIEAMGQMF
FT                   DPNLHQAVMQVADDRVPPDTVVQEMQAGYTLNERLLRPSMVGVAKAP"
FT   gene            613174..615135
FT                   /locus_tag="Mmc1_0510"
FT   CDS_pept        613174..615135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0510"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: mag:amb4440 molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43035"
FT                   /db_xref="GOA:A0L4Z2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4Z2"
FT                   /protein_id="ABK43035.1"
FT                   /translation="MGKVVGIDLGTTNSCVSIMEGGEPKVIENSEGVRTTPSMVAFTNQ
FT                   GERLVGQAAKRQAVTNPTNTLYAIKRLIGRRFSDPLTAKDQGLVPYKIVKADNGDAWVE
FT                   ADGKKMSPSECSAMILQKMKQTAEDYLGESVSEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVLRIINEPTAAALAYGLDKKDGQTIAVFDLGGGTFDISILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMAIIDYLADQFKKENSIDLRKDSMALQRLKEAAEKAKIELSSSNQTDINLPFI
FT                   TADASGPKHLNLSLTRAKLESLVDELVQRTLAPCRTALKDAGMTAADIDEVILVGGMTR
FT                   MPKVQAVVGQFFGKEPHKGVNPDEVVAIGAAIQGGVLKGEVQDVLLLDVTPLSLGIETL
FT                   GGVFTKLIEKNTTVPTRKSQVFSTAADNQSAVTIRVAQGEREMFSDNKTLGQFDLVGIA
FT                   PAPRGMPQIEVTFDIDANGMVHVSAKDKGTGKEQSIHIEASGGLTSEEIDRMVHEAESH
FT                   AEEDAKKRALIEARNNADSLVYSSEKSLKEHSDKLDDALKNQITAAIEDLKAVMPKEDP
FT                   EAISSKTQALMELSMKMGEQIYKENPEAAGMDPEAAAHAAGMHGGAATGGGDGANKHGK
FT                   GAEDVVEAEFEEVNDDKK"
FT   gene            615267..616403
FT                   /locus_tag="Mmc1_0511"
FT   CDS_pept        615267..616403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0511"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: psb:Psyr_4194 DnaJ
FT                   central region:heat shock protein DnaJ,
FT                   N-terminal:chaperone DnaJ, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43036"
FT                   /db_xref="GOA:A0L4Z3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Z3"
FT                   /protein_id="ABK43036.1"
FT                   /translation="MSKDLYEILGVSKGANDAEIKAAYRKLAMKLHPDRNPGNDAAEAQ
FT                   FKEVNAAYEVLKDPQKRTIYDQYGHAGLGQGGPGGPGGFGGQGGAGFGDIFEEFFGDIF
FT                   GGGRQTRGGGRSGARQGEDYRYDLRVTLEEVARGVEKRVRIPSMSTCDTCHGSGARSGS
FT                   KPTTCTTCGGAGQIRTQQGFFQVQRACHVCHGKGQIISDPCPDCGGAGRQKKEKTLTVK
FT                   IPPGVDTGTRIRLSGEGGAGIQGGPAGDLYIITEVEPHSMFERYGVDLLCVVPITFPQA
FT                   ALGAKLEVPTLNGKARITLPAGSQTGKRLVLRSKGLPHLNRPGMLGDLVVEVRVETPVK
FT                   LTTKQKELLEEFDRCGDPDSQPDSVGFFDKVKEFLGGN"
FT   gene            616515..617321
FT                   /locus_tag="Mmc1_0512"
FT   CDS_pept        616515..617321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0512"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   tbd:Tbd_1125 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43037"
FT                   /db_xref="GOA:A0L4Z4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L4Z4"
FT                   /protein_id="ABK43037.1"
FT                   /translation="MTIKVGVTGVCGRMGRMLVEATHKAQGCMLGAASEYPGHTLIGAD
FT                   AGELAGVGKLGVLVGGDAETTFRDADVVIDFSVVEATLAHLRLALAQGTPIVIGTTGFS
FT                   AAERQQIALAAERIPVVFAPNYAVGVNLLFKIAAEVAAVLGGEYDIEIVEAHHRHKVDA
FT                   PSGTALGLGQAIAEAVERNLDEVAIYGRQGQTGARDPQTIGFSTIRGGDVVGDHTAMFM
FT                   TDGERLELTHRASSRMTFAKGAVRAAKWVVEQKPGLYDMRDILGFK"
FT   gene            617711..618064
FT                   /locus_tag="Mmc1_0513"
FT   CDS_pept        617711..618064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43038"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Z5"
FT                   /protein_id="ABK43038.1"
FT                   /translation="MEMEEGIIELDQVKPGTKITIEFGNLEPALTKLDEPKKFLMEDWG
FT                   EDEKEIYILEDRIEEDEPLHYALEPMTLEEGLKRNEGKFGLDRVMWDFLGREVGGFEVE
FT                   EPEEDEDEEEAAE"
FT   gene            618313..619044
FT                   /locus_tag="Mmc1_0514"
FT   CDS_pept        618313..619044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0514"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: mca:MCA1094 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43039"
FT                   /db_xref="GOA:A0L4Z6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Z6"
FT                   /protein_id="ABK43039.1"
FT                   /translation="MSKQPPISAIKNIPSRDRLMFAMDVPDSATAKNLAERLGGSVTVY
FT                   KLGLELFLSGDYFELVEWMLKRDKKVFADLKLFDIPKTVERATRQLAGRGIHYLTVHGN
FT                   DGILQAAASAKGDMKILGVTSLTSLDRGDLDDLGFQCDVEALVASRAKRALLHGCDGVI
FT                   SSGLEAARLRAELDHKLLVITPGIRPVENRPSDDQKRVVSVEQAFAFGADHIVVGRPIR
FT                   DAEEPAKAAEAIQQTIADLFS"
FT   gene            619433..620092
FT                   /locus_tag="Mmc1_0515"
FT   CDS_pept        619433..620092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0515"
FT                   /product="Thiopurine S-methyltransferase"
FT                   /EC_number="2.1.1.67"
FT                   /note="PFAM: thiopurine S-methyltransferase; KEGG:
FT                   dar:Daro_0514 thiopurine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43040"
FT                   /db_xref="GOA:A0L4Z7"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR022474"
FT                   /db_xref="InterPro:IPR025835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Z7"
FT                   /protein_id="ABK43040.1"
FT                   /translation="MSSLDSDLWLQAWQDDHICDFHQLRVNRLLMKHWPLLHMARGERV
FT                   MVPLCGKSLDMLWLAQQGYEVLGIELSALAVAAFFEENGLQPTHRKLGDFTLWQSGRVS
FT                   ILCGDFFDLTPLLCENVDWVYDRAALTALPEPLRRRYAAYIQQLTPANIVLMTIEEQED
FT                   GVSEACFLGIDPEIMALYGPLCHIGLSYVGREEEIDPNNPLGKPISVAYKIYQITR"
FT   gene            620213..620725
FT                   /locus_tag="Mmc1_0516"
FT   CDS_pept        620213..620725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43041"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Z8"
FT                   /protein_id="ABK43041.1"
FT                   /translation="MSHSPKIVLLLALLWITPAMAQEPVAPQPEEQATGWQEKLKQGWD
FT                   ATKQLVEEKVVPAGEKGWEKTKELSAKGLEKSKELGAEGWEKSKELGGQGLEKSKELGA
FT                   KGWEKSKEYGAKGWEKSKELGEKGLEKSKELLEQVTPSDAPVPAEPVEPPTLEPQQPIS
FT                   PQLSPTI"
FT   sig_peptide     620213..620278
FT                   /locus_tag="Mmc1_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.943 at
FT                   residue 22"
FT   gene            complement(620874..621569)
FT                   /locus_tag="Mmc1_0517"
FT   CDS_pept        complement(620874..621569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mag:amb3721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43042"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L4Z9"
FT                   /protein_id="ABK43042.1"
FT                   /translation="MSKPSLDLVKSIVGAGLFSEEQVKESGEATTAPLIAVSRTLGANG
FT                   TIIAQKLAEKLHVPYYDQGLIDRVLEEADQDKLLMQRIDERATNFMDDFIYSIFSDKQS
FT                   PKDAYFQALVKVLINISRNGGVVVGRGSHMLLPEKRTFRLRLECGRSHAIKRIASREGI
FT                   SESEAAKKIETVNAQRAKFIAKMPRRFPSLESEYDLVLHTDHFHDDDATVEAIICMMKA
FT                   GNYATSMPR"
FT   gene            complement(622158..623417)
FT                   /locus_tag="Mmc1_0518"
FT   CDS_pept        complement(622158..623417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0518"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: cpe:CPE0030 probable hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43043"
FT                   /db_xref="GOA:A0L500"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0L500"
FT                   /protein_id="ABK43043.1"
FT                   /translation="MDSFGQILLIGLFVLIKGFFSGSEIAMVNCDKLKLRHRAKLGDQG
FT                   ARMVVEMFKNPDIVLGTTQIGTNIATVSISTMAALMFIDLFGGHGDMISALVLTPFLLI
FT                   LGEIVPKSIYQQKADVIAPRIIYVLKFFSVLFYPVIFIFSRIARFVTRLVGGHSHQNGF
FT                   ITRDEIRMLLEMSDATPSGRRFDRDRVRRIIRFADTTVGEAMIPLVDVVGISEKAPLSE
FT                   AIERIYSQGFNRLPVYRGNLINIVGVCTINSWALMDPDLGLKTLKDFTDPPLYLSPNQT
FT                   IDQALPLLQARPSNHMGIVVDEFGSAAGILTMEDIFEEVVGEIDVGYDFDEYQPKRRLM
FT                   FQQLGEDDYVADGRMPLSQINDRIHILLPVGEVHTLAGWMMHRLKAIPKPDDDVVEQEY
FT                   HFRVLEANDRIVTKVRISRI"
FT   gene            complement(623420..625117)
FT                   /locus_tag="Mmc1_0519"
FT   CDS_pept        complement(623420..625117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0519"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: pca:Pcar_2212 probable hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43044"
FT                   /db_xref="GOA:A0L501"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0L501"
FT                   /protein_id="ABK43044.1"
FT                   /translation="MDGSTLLPVFTTQELEFALRILLQVFLMIAAAMFSGSETALFSLS
FT                   RLDLQKLRTTRNPYSDRIHEMLDEPRRLIISILCGNELLNIASSSNMAAILLLSFGSED
FT                   VGLLNVLVMVPLLLLVAEVTPKTFAVTFPIKFSTRISARILPKWIIFISPLRETIRLIA
FT                   DRITTLIVGEQVQQENILQKDEFRTLVEEGADHGALDASERVLIDNMLEASETEVLHIM
FT                   TPRTRLHLLNANDPLPKILKRFRKYRHPRVPVIRGHADNILGMLHSEDVLRLLRSQRPL
FT                   EEVRIEELLRPVHYVPPTKTVDEMFDYFQAHNTRAAIILGEYGGVTGIVTMKDVLTFIF
FT                   GEISGAGKSKAYYKEKDNNIYIIPGDMRLIDFEDLTAFGIDDSMMTTIGGVAFRLFDRL
FT                   PKVGDALVNDGLRFTVLEMDGLRIKTLRVGKSSVDNGLPDEQEAPHPLESPSTVEVDES
FT                   GHAPTDHGSADAEQQVLLRDDEEPEAASEVSLMEAARANPEETACEKPEETAREKPDES
FT                   PVAETPVVAAETQTPAPTKVKSKKRKAAALEKELHTPDAPTATPSGEV"
FT   gene            625472..626428
FT                   /locus_tag="Mmc1_0520"
FT   CDS_pept        625472..626428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0520"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   mag:amb1972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43045"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:A0L502"
FT                   /protein_id="ABK43045.1"
FT                   /translation="MERPQISKVSPVQVEQTVEEAFMAIIRSQFEQVLAWEPLALEGSD
FT                   SEGVHQMRVAYRRMRSALTTFRRAIPREVSRQIGSEMRWAASSLGPAREVDVFLEEGLP
FT                   QLHGHLNMAEGEQHLTAQSQRFRQQSYQQVQAVLESERYRQFKRHLDVWLKERGWRVEI
FT                   QEASKLERLDGPIAKFASKVLEKQMARVMSDGEEISRLSAEELHQLRIDCKKLRYATDF
FT                   FRELYPAKRVDAFIGELKQVQDLLGIMNDGAVMPALLDEILQGVEDAPARSYADAILGW
FT                   RAYALETQRGQLPERWGHFMAAPLPWAEPRKRKGQRG"
FT   gene            complement(626531..627472)
FT                   /locus_tag="Mmc1_0521"
FT   CDS_pept        complement(626531..627472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0521"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="KEGG: tcx:Tcr_1289
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43046"
FT                   /db_xref="GOA:A0L503"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A0L503"
FT                   /protein_id="ABK43046.1"
FT                   /translation="MCRITCPGSTVCDEYEETLYARLLRFEALIDLAWEEGMQHTPSAM
FT                   DSLLRDTIHETIQMLDDGIISVAAINPLRADARHNWAVNWWIKRALIIYDRLVPNRMLG
FT                   DSLESKSVMDPGRTFYWDNRHLKFSNWTETQFEAAKIIIAPPAIAQKGCFIGPKSIHKG
FT                   IRIEMGAYVSSDVFIDDGAMVGSCAHIGMGVQISKNATVGGAMRPVELVPAVIEDRAFI
FT                   GSFSKVSAGVLVSSEAILVGSVDLERETPIIDEIRGEVYRGYVPPRALVVTKRHAQSGL
FT                   NLPHIVYYRRDEESRYAARDILNTFYRNVRIE"
FT   gene            complement(627828..628790)
FT                   /locus_tag="Mmc1_0522"
FT   CDS_pept        complement(627828..628790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0522"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit; KEGG:
FT                   rru:Rru_A3078 electron transfer flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43047"
FT                   /db_xref="GOA:A0L504"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A0L504"
FT                   /protein_id="ABK43047.1"
FT                   /translation="MKDNRVLLVVELQGESLHPATAHGVTAALQCAASCTLLVIGAAQE
FT                   SALQQAASLQGVELVEHQPVALACMTAENLAPLIRDRFVALQASHLFMLETRWGKDLLP
FT                   RVAALLGRQPLTGVVAIQDARSFVRPTHAGNALVTLHSSAGAILATLRLTAFSPAPTGA
FT                   QPCPIVTAAECAPSHPTRLLERRHREDARPDLCQAEIVVCGGQALERAGNFALIEALAD
FT                   ALGGAVAATRSAVDAGLADNALQVGQTGQVVAPKLYIAVGLSGAIQHLAGMKDSGCIVS
FT                   INSDPGAPIHAVADYRLVADLYQALPAWLTLLAMQKGKV"
FT   gene            complement(628780..629535)
FT                   /locus_tag="Mmc1_0523"
FT   CDS_pept        complement(628780..629535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0523"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   KEGG: atc:AGR_L_2463 electron transfer flavoprotein
FT                   beta-subunit (beta-ETF) (electron transfer flavoprotein
FT                   small subunit) (ETFSS)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43048"
FT                   /db_xref="GOA:A0L505"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A0L505"
FT                   /protein_id="ABK43048.1"
FT                   /translation="MNILVPIKQVADPATPIRWYPDGGGVDASDSKAIINPFDEIALEA
FT                   ALQLKEAGHAQQVICCSIGPECWNDALRTALAIGADRAIRLHGPADLEPLVIARLLAQV
FT                   VNQQSCSLVIAGKQAVDQDDSQVGQLVAGLLGWSQATFAAHLAVADGELLVQRETDDGQ
FT                   ERLSLPLPAVITTDLRLNTPRYASLPNIVKAKRKPLEQLDAAAFGVDLTPQWQRLQQQP
FT                   PPMRPMGQWVDSVEALHAMLRKEGLLHEG"
FT   gene            complement(629532..630137)
FT                   /locus_tag="Mmc1_0524"
FT   CDS_pept        complement(629532..630137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0524"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: eba:ebA3617
FT                   thiol:disulfide interchange protein DsbA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43049"
FT                   /db_xref="GOA:A0L506"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0L506"
FT                   /protein_id="ABK43049.1"
FT                   /translation="MRFYLRLWLAFAITLGLASPVQAGDNEKLYHLINPPVALQGEAPE
FT                   VVEVFNFHCPHCNDFYPVLEKWAHGYQGKLNVHSLPVYWGSQPDTPVRAYFAAEYLGVG
FT                   EKMKRAIFAANFDDNRYKIDEEQDILKIASEAGIDAKKLEEAMDSFAVFGKVAQVNSLA
FT                   RQYGIQGTPSVVVNGRYRVVAHGDYGDVVKTIESLLQK"
FT   sig_peptide     complement(630066..630137)
FT                   /locus_tag="Mmc1_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(630164..630586)
FT                   /locus_tag="Mmc1_0525"
FT   CDS_pept        complement(630164..630586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0525"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mca:MCA1750
FT                   OsmC/Ohr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43050"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0L507"
FT                   /protein_id="ABK43050.1"
FT                   /translation="MATTARVKWIEGMQMLGESGSGHTVVMDAAEAVGGREMGIRPMEL
FT                   LLIGMGGCSSIDVLSILKKGRHQVTDCVAEITAERADSQPAVFTHIQLHFTVTGQQIPE
FT                   KAVQRAIDLSMESYCSASIMLGKTAKIETSFTLIEG"
FT   gene            630765..631946
FT                   /locus_tag="Mmc1_0526"
FT   CDS_pept        630765..631946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0526"
FT                   /product="phosphoesterase, RecJ domain protein"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein; KEGG:
FT                   gvi:glr0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43051"
FT                   /db_xref="GOA:A0L508"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A0L508"
FT                   /protein_id="ABK43051.1"
FT                   /translation="MLNVWRAWAWSWMACVVGSTWGRRGSCKGITKMSELSAEKTQELR
FT                   ELLSRCEGQRHAVVLQDFPDPDAISCGFAYAILADAFGIETELIFGGRVSHQENIALIN
FT                   LLDIELIQIVESSLLNQERFQGAVFVDSQGTTSNLTQPIKDAEIPILVVIDHHANQNFL
FT                   TPEFFDLRKVGACASILTSYFMDEMVVLKTTKPEHRRLATALMHGIISDTGAMIGAAQL
FT                   DFQAAAFLQPMCDGDMLTEIMHQQRSHRVMEVIRQALANRIAREGICLSGVGTIRAEDR
FT                   DAIPQAAEFLLTEETVHTAIVFGLVTYPDNRESVQGSLRTTKHSLNPDTFLKETLGQSH
FT                   TGEYYGGGKAMAGGFEIPLGFLSGADDPELAAMKWEAYNAKIRKKFFSKIGDD"
FT   gene            631939..632829
FT                   /locus_tag="Mmc1_0527"
FT   CDS_pept        631939..632829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0527"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: sal:Sala_1281 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43052"
FT                   /db_xref="GOA:A0L509"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L509"
FT                   /protein_id="ABK43052.1"
FT                   /translation="MISGVDPQTHLPSGKPRWLKVKAPTSPGYLKLKGMLRQGGLHTVC
FT                   EEATCPNIGQCWHEGSAAFMILGDTCTRRCAFCNVKTGKPLPPNPDEPQQLALTAQRME
FT                   LKHVVITSVDRDDLEDGGAGQFIACIQALRRVLPEASVEVLTPDFRHKQGALERLVAAR
FT                   PDVFNHNVETVPRLYANVRPVSSYAFSLEVLRRAKQLNPEGMTKSGIMLGLGEDEAEVL
FT                   AVFADLRAAGVDYLTVGQYLRPSPAHHAVVRYWEPERFEALGQQALQLGFKRVSSAPLA
FT                   RSSFHASELHGVDNA"
FT   gene            632822..633460
FT                   /locus_tag="Mmc1_0528"
FT   CDS_pept        632822..633460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0528"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: gvi:gll4414
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43053"
FT                   /db_xref="GOA:A0L510"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L510"
FT                   /protein_id="ABK43053.1"
FT                   /translation="MHEPRAVVVVHRDVWAYQQAWEQQLAWVQAIHEGQRQDTLILLEH
FT                   MPVYTLGKRATRADVLRQDIPAVYTDRGGQVTYHGPGQLVVYVLWNLRGQLHGVRAHVA
FT                   RLEEMVMEVLAHYGVVGQRDGAGPGIWVGDAKIASIGVRVTQGVTLHGLSLNRDPDLSH
FT                   FQGIIPCGQVGRPVTSLAALGVAVSRQALEQRMVEAFERQFNARCWEAS"
FT   gene            633464..633916
FT                   /locus_tag="Mmc1_0529"
FT   CDS_pept        633464..633916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0529"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mca:MCA0519 MutT/nudix
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43054"
FT                   /db_xref="GOA:A0L511"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0L511"
FT                   /protein_id="ABK43054.1"
FT                   /translation="MSWSPETPFLAVDILIELVDRPGRPVVLIERVNPPHGWAIPGGFV
FT                   DRGERAEQAAVREAQEETCLDVTLTGLLGVYSDPKRDARLHTCSLVYMAEATGQPRAAD
FT                   DAKNVRLVDPAAPGVALAFDHGLILRDLVAYRKQGRLAPLRMDESD"
FT   gene            633933..635306
FT                   /locus_tag="Mmc1_0530"
FT   CDS_pept        633933..635306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0530"
FT                   /product="protease Do"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6,
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; KEGG:
FT                   mca:MCA2343 protease DO"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43055"
FT                   /db_xref="GOA:A0L512"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0L512"
FT                   /protein_id="ABK43055.1"
FT                   /translation="MLGQKQKWRVVGGVLVGLALLLGSAPLHAGAWPVAVEGDKLPTLA
FT                   DMLERTTPGVVNIATSGSVEVAETPLLNDPFFRHFFDIPTMRRAKKIRSLGSGVVVDAA
FT                   HGYILTNHHVIDKAQVITVTLHDGRALKAVQVGADPETDVAVIKVEAKDLHALPLGNSD
FT                   ILRVGDFVVAIGNPFGLGQTVTSGIVSALGRSGLGIKGYEDFIQTDASINPGNSGGALV
FT                   NLRGELVGINTAILAKGGGNVGIGFAIPANMTKQLMAQLIEYGEVRRGLLGISSQDLTP
FT                   ELNQAFGLEHQHGSVVTRVTRGSAAQKAGLQAGDIITEVNGVAVRNAAHMRNLVGLLRV
FT                   GEAVQLTRLRDGHSRTVKAVVEASKREQIEGSRLSPRLEGAVLEKEEQDEKPGVVVRKV
FT                   VRGSMAARMGLQEGDRLLEVNQQSVKNLADMGKALAVDGRQMLLTLERGERRIRVMVR"
FT   sig_peptide     633933..634028
FT                   /locus_tag="Mmc1_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.787 at
FT                   residue 32"
FT   gene            635422..636531
FT                   /locus_tag="Mmc1_0531"
FT   CDS_pept        635422..636531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0531"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: ppr:PBPRA1402 hypothetical extracellular
FT                   solute-binding protein,family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43056"
FT                   /db_xref="GOA:A0L513"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A0L513"
FT                   /protein_id="ABK43056.1"
FT                   /translation="MQQKSTDKPAPLPRRQFIKGTLAATATAAVAAPAIVSSKARTRWQ
FT                   MVTAWPRNFPGLGTGANALANLITEMSGGRLEVQVFGAGELVGAFEIFDVVSRGTADMG
FT                   HGASYYWKGKHPATQFFSAVPFGLTAQEMNAWIYQGGGYELWQKLYAQFDLIPGAAGNT
FT                   GTQMGGWFNKEIHKVEDLQGLKMRMPGLGGEVLKRAGGTPVNIPGGEIFAALQAGTIDA
FT                   TEWVGPYNDLAFGLYKAAKYYYYPGWHEPGTTLECFVSRKSFEKLPKDLQSIVLNAIRV
FT                   ANLNMLSDFTARNNAALEILVNKHKVSLRRYPDEVLAKLKTLSDEVVAEIALEDPLSKE
FT                   VYDSFRRFRDQAVAWNRVSEQAYVNARQV"
FT   sig_peptide     635422..635544
FT                   /locus_tag="Mmc1_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.618 at
FT                   residue 41"
FT   gene            636694..638118
FT                   /locus_tag="Mmc1_0532"
FT   CDS_pept        636694..638118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43057"
FT                   /db_xref="UniProtKB/TrEMBL:A0L514"
FT                   /protein_id="ABK43057.1"
FT                   /translation="MQRTLILALLALLLCNHAGAEDLWDPEKAVLVQRLQLSQDNAELT
FT                   GKVYLHTLSPLKVELKIAHFKGHMESVIKLVSTWTRKQSGLEMWRQLGVTTINNGSLRV
FT                   NGTQWAELTAEQVQFQQGEINQLSVVAQGDRWRGSFEQLRLTDNVGRMRLPQGVFPLQL
FT                   TQLQGSGTPSHADITILAAQIPQLALQPVHLKASHADQRVMFVVNSRGGALFSQPLWQL
FT                   VRDHPPLSKRLLAQEQHLGIRSLTLAQGTLKLGKTELRGMWPPSGPKNPLKGWRGDAQL
FT                   SMEEGLLSWVGAEHLPLPFKGQQQATLHAMLARIGISDGQLLLQQGSGVVRLFDGEVKL
FT                   KSIRPATLYPSDSDTLGFRADLEGVHLSPWRWQGHLTRTGAGGMPYSLSATDQGSGRLE
FT                   SAGMVLPLWGKKQVGLSIDAAYLTLRDNQAPFVIESAPLPLKVEIKRLGCGQQRGTSTV
FT                   QWQSGQKPLKLCQPQP"
FT   sig_peptide     636694..636756
FT                   /locus_tag="Mmc1_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.932 at
FT                   residue 21"
FT   gene            complement(638474..640069)
FT                   /locus_tag="Mmc1_0533"
FT   CDS_pept        complement(638474..640069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:ZK84.1 Hypothetical protein ZK84.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43058"
FT                   /db_xref="UniProtKB/TrEMBL:A0L515"
FT                   /protein_id="ABK43058.1"
FT                   /translation="MRQLSYMVVCFSLLSSGPALAQNELEPPSLPSVAPPLHQELTSEQ
FT                   LRAAEGAASHLSPHRPPCAGKERCPLDKLLGANLYGTSYQSAPALLPMQLADAQTWKAR
FT                   KRRPFPTQKVVPQPFKVGQTWQRSWPVRYAPLGGPKSTRSTTETAEDEQTLADAETPEE
FT                   AAAQAPATPAPAAAQTATPATPAAQTPTAIKPATLPEGTVDAPSMAGQPARLAQPPAKV
FT                   KASQDRATSATPHPSTERRETAPLSASLPQRADRTATAAVKRAIPAPVPKAVVLSGQTV
FT                   LHQTPVPEATDKRRPESHLAATTSRPEQPQETPTQLPALLSQPSTAPAGEPAPTLANLG
FT                   LAGAAALLEQPAAAKPQTAPRLTSPEQPLSAGAWQLARPSHDGVAEEPMQLPNLATADF
FT                   VLNASPDLKSHAPSVTPDMEHPGFAMQLLLQADAALKEKALSRPAGRNALFYTEMALDL
FT                   YSWNPQIRVHALTMLRRIHRTFLVLAEEALEKGQKKKAKRLLQKSRQMFVKHMLRDPDG
FT                   SLQAYMDRLEKRLG"
FT   sig_peptide     complement(639965..640069)
FT                   /locus_tag="Mmc1_0533"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.282 at
FT                   residue 35"
FT   gene            complement(640077..642506)
FT                   /locus_tag="Mmc1_0534"
FT   CDS_pept        complement(640077..642506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0534"
FT                   /product="ATP dependent PIM1 peptidase, Serine peptidase,
FT                   MEROPS family S16"
FT                   /note="KEGG: tbd:Tbd_1252 peptidase S16, ATP-dependent
FT                   protease La; TIGRFAM: ATP-dependent protease La; PFAM:
FT                   peptidase S16, lon domain protein; AAA ATPase, central
FT                   domain protein; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43059"
FT                   /db_xref="GOA:A0L516"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0L516"
FT                   /protein_id="ABK43059.1"
FT                   /translation="MSEQRSDEPEVVDAIIEDQQGAQATTDATPPVRIENSLPTELVIY
FT                   PLGGRPFFPGMLTPIQVEGSPYYETIKKAMDSHGRLFGILASHAEDGQEVFDANQLFGI
FT                   GTVVRILEASVNEEAKQIKLLAEGLWRFEVRDVVSVGPPIVAQVTHHNNPVSVVDTDAL
FT                   KPYTMAVINTLKEILKYDSLYQEQVKMFLSRHNFSEPDRLADFVASMTSSSREELQEVL
FT                   ETLPIMARLEKVLTLLKKELEVVKLQNKIQRQVEEGIAEHQRQFFLREQLKEIQKELGI
FT                   TKDDRTAEIDRFRERLEKLTLSEEAEQKIEEELDKLAILETGSSEYGVTRNYVDWLTSL
FT                   PWGVHSTDKLNIARARRILDRDHDGLEDVKERILEFLAVGKLKGEIGGSIILLVGPPGV
FT                   GKTSIGRSVATAVGREFYRFSVGGMRDEAEIKGHRRTYVGAMPGKFVQAIKHTKVANPL
FT                   IMLDEVDKIGASYQGDPASALLEVLDPEQNSEFLDHYMDVRFDLSKVLFICTANQLDTI
FT                   PRPLLDRMEVIRLSGYITSEKVRIARNHLLPKQLEKNGLDKSQLRVSNGALREIIEGYA
FT                   REAGVRRLEQKIGAIARKVAVKVLEEAELPISVGQNDLDSYLGKPDFREEKPLTGVGIV
FT                   TGLAWTALGGATLDIESAQTSTEGNTLLLTGQLGDVMKESARIAFSFLQSNVEKLGGKS
FT                   ERLKGNIHLHVPEGATPKDGPSAGITIATALLSLARTQPLPRRLAMTGEITLTGSVLAV
FT                   GGVREKVIAARRVGIRELIIPEACRKDYDEVPEHIREGFTVHFVKKYAEVAKLVFG"
FT   gene            complement(642756..643121)
FT                   /locus_tag="Mmc1_0535"
FT   CDS_pept        complement(642756..643121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0535"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   tcx:Tcr_0349 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43060"
FT                   /db_xref="GOA:A0L517"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A0L517"
FT                   /protein_id="ABK43060.1"
FT                   /translation="MSITLTENATSKLTSLIAEENNPNLKLRIFVSGGGCSGFQYGFTF
FT                   DENQEDTDLVVESGSVKVLVDPTSINYLRGAEIDFVEDLNGASFQIKNPNAQSTCGCGN
FT                   SFTPAATGGGGCGHAAS"
FT   gene            643560..644717
FT                   /locus_tag="Mmc1_0536"
FT   CDS_pept        643560..644717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0536"
FT                   /product="putative zinc protease protein"
FT                   /note="KEGG: rme:Rmet_3150 putative zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43061"
FT                   /db_xref="GOA:A0L518"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:A0L518"
FT                   /protein_id="ABK43061.1"
FT                   /translation="MPCAPPVWIMRRSSPAPSGMVAPGRVLSVVWPIWAKTVKMRWLGL
FT                   LLPLLLTGCLSPGYLWQASQGQWQLMTQARPVAELLADAQTDAPLKQRLAMSQRIRQFA
FT                   KQQLLLPSEASYATYVALDRPYVVWSVTAAPPLGLTPKQWCFPVVGCLSYRGYFSAQGA
FT                   EDFARELRAEGWDVAVSPVAAYSTLGWFSDPLLSTTLFWPPGELAHLLFHELAHQRLYI
FT                   AGDTAFNESYAEWVAQQGVRSWLAQQGSPAAAQRYQQHQEGRQQFEQRLLELRAQLQGL
FT                   YESTLSETAKGYQKRQALARFRYDYAQRKKELGLNYDAWVYKDLNNARLALLGLYRQWL
FT                   PAFARLFAQAEGDWARFHAAAAALGQLPYAQRQQALQQLNGSHDG"
FT   gene            644710..645891
FT                   /locus_tag="Mmc1_0537"
FT   CDS_pept        644710..645891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0537"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: neu:NE0634 ATP:corrinoid adenosyltransferase
FT                   BtuR/CobO/CobP; TIGRFAM: cob(I)alamin adenosyltransferase;
FT                   PFAM: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43062"
FT                   /db_xref="GOA:A0L519"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0L519"
FT                   /protein_id="ABK43062.1"
FT                   /translation="MAEQVLCVHGLLMKGGEMLQLAYRLEQAGFEPHYFNYPTRTRSVD
FT                   ENADALAQRVRQMAAPVHLVCHSLGGVVALRMLQRHSDLSMGRVVALGSPFLGSHAAHT
FT                   TFEKWWGRSLLGESYSSGLDGESMGELPKDCELGVVAGDWPYSLTRLLIPDLPGQNDGV
FT                   VRLDETRLAGAQWCCVHTNHMGLLFNPQAAQQVVSFLQQGCFERGQSVPRAAPKENPHK
FT                   PGLILVHTGEGKGKSSSAFGVVFRAAGWGKRVCVIQFIKGKWQTGEEHAASRFENIDWH
FT                   ALGDGFTWDTQNPEKDRHTSREIWAFSQAIMRSGEYDLVVLDEINYCCGYGWISGQEIA
FT                   EFLEQEKPHAMHVILTGRNAPAALIEVAHTVTEMGMLKHAYKQGIQAAKGIEF"
FT   gene            complement(645902..647140)
FT                   /locus_tag="Mmc1_0538"
FT   CDS_pept        complement(645902..647140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L520"
FT                   /protein_id="ABK43063.1"
FT                   /translation="MKLFSSMIPQLTGMTAATVLGWVIGSPPAWADDAPRSEWSGYMAG
FT                   ELRLFPEAPLRGGQVVLYPALSAQGEYFRAWDQGHKQLRFTPFVRLDAQDHARSHVDLR
FT                   ELAVTHLDDANWEVSVGLRKLYWGVTESRHLVDILNQTDAVEGIDGEDKLGQPMLSAGF
FT                   FQDWGTLNLYWMPYFRERTLPGWQGRPGYFYRVRQNEASYESPAQAWHQDFAVRYSHTV
FT                   DMWDFSLSHFSGTAREPQLRSKTEASGALVLYPYYYQLEQTGLTVQATTDAWLWKFEGV
FT                   TRHDLQGRSLAAVGGFEYTFVGILESDADLGLISEYMWEEQGNNSLSPFQNDLMVGGRV
FT                   TLNDTQSTEFLAGAIADLESHALYLSVEASRRLGEQWKLSLDGWSNLNLKSSDPLYSRR
FT                   RDSMLQLELARYF"
FT   sig_peptide     complement(647045..647140)
FT                   /locus_tag="Mmc1_0538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(647143..647952)
FT                   /locus_tag="Mmc1_0539"
FT   CDS_pept        complement(647143..647952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43064"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:A0L521"
FT                   /protein_id="ABK43064.1"
FT                   /translation="MRKTPRLFPRLLLGTLLLLPALGSPQAQAETSQEKGLRLVQEADK
FT                   QDFGYVDLTAQLEMVLTNRQGDSSSRKIRIKMKEVADDGDMSLSVFDTPADVKGTVMLT
FT                   HSHAVKPDDQWMFLPAVKRVKRIASRNKSGPFMGSEFAFEDLASQEVAKYTYNYLRDEV
FT                   IDGRDSWVIERRPAYAYSGYTRQEVWLDKVRLQPNQVIYYDRKNDLLKTQTFSGYQQYL
FT                   GRYWRPSLMLMVNHQTHKQTTLSWLDYRFKNGFSDREFHKDGMQRTR"
FT   sig_peptide     complement(647863..647952)
FT                   /locus_tag="Mmc1_0539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            complement(647945..650239)
FT                   /locus_tag="Mmc1_0540"
FT   CDS_pept        complement(647945..650239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1652 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43065"
FT                   /db_xref="GOA:A0L522"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0L522"
FT                   /protein_id="ABK43065.1"
FT                   /translation="MIRNYANWLLRYRLLVILLTVGVMLAAGSGVRFLKFDTDYRIFFG
FT                   KDNPQLLAFDELQNSYTKDDNVMFVLTPKSGQVFDAQSMSVIKDLTKQAWQIPYSIRVD
FT                   SLTNYQHTWVEEDDLVVGDLVDDPTAITAQGWQAIQNIATTEPLLLHRLVNPQSTVTAV
FT                   NVTIQLPDDNTQTAVPEIAAFVRNMAAQLQAAHPEMEVRLTGMVMMNNSFPELSKRDMS
FT                   TLVPMMFGVVILTFLMLLHSPWATLGTLLVILFSIITGMGLAGWSGIVLTGPSASAPTI
FT                   ILTMAVADAVHLLVSFFVVYGYKHVDKHGAMVEALRINFAPIFLTSLTTAIGFLSMNFS
FT                   DAPPFRDLGNIVSMGVVAAFVYAVTFLPVFMAMVPVKPHKKRPRTSHAMEMLANWVIAK
FT                   RTPLFYIMTAVSIGFIAFIPRNQLNDEFVKYFSKNVDFRNATDYTAANLTGIYNIGFSI
FT                   DSGENSGIADPDFLARVEQLAIWLRTQPEVTHVSTITDIFKRLNRNMHGDQPQWYALPD
FT                   ERNLAAQYLLLYEMSLPYGLDLNNQINVNKSKTRLSVTLQSISSNEVLAFADRVRGWMQ
FT                   KNWPAQMVVEGASPTVMFAHIGKRNIVSMLGGTTVALFLISLSMIIALRSVKLGLLSLI
FT                   PNLVPAGIAFGLWGMINGQVGLALSVVTGMTLGIIVDDTVHFLSKYLRARREYHHTAEE
FT                   AVRYAFSTVGTALWVTTLVLVAGFLVLTLSDFKLNAEMGLMTAIAIAIALIVDFLLLPV
FT                   LLLKMEGKNHA"
FT   sig_peptide     complement(650153..650239)
FT                   /locus_tag="Mmc1_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.726) with cleavage site probability 0.265 at
FT                   residue 29"
FT   gene            complement(650276..650938)
FT                   /locus_tag="Mmc1_0541"
FT   CDS_pept        complement(650276..650938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0541"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: tbd:Tbd_0482
FT                   possible transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43066"
FT                   /db_xref="GOA:A0L523"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0L523"
FT                   /protein_id="ABK43066.1"
FT                   /translation="MNKPIGMFIPFWNGFMTDTRDPATTRRRLLEAALGEIHRKGFQAA
FT                   SLSAILERAEMTKGAMYHHFPNKKALGLAVIDELLPAIFQDEFNIHMDEKKGFVEGFIH
FT                   AHQTFIRNRGASFIELGCPVANLAQEMSPIDEDFRVRIDALFQWGLKTMAQQIRTAQQH
FT                   GELRQELDADATALFIFAAREGCESVAKTAQDKQLFFRCFEQLFIYIRTLSPNNARG"
FT   gene            complement(651055..654963)
FT                   /locus_tag="Mmc1_0542"
FT   CDS_pept        complement(651055..654963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0542"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; KEGG: cvi:CV3248
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43067"
FT                   /db_xref="GOA:A0L524"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0L524"
FT                   /protein_id="ABK43067.1"
FT                   /translation="MLPFSLPIRYAFYAFVLMGGGLLSIASYGFQQASALLALQTAQMV
FT                   TSHVTNEISFLRDTIVQMRQDMDILLHSPVLLDYLDNPQGSPAPLSEQMIGIMQNRPSY
FT                   AQFRLICIEDEGKEKIRIERRIGNIIATLVPAQLQTKGNRPYYKTALELPRGRDTISPI
FT                   ELNQEHGQVEHPIRPVMRLSTPVYDSHNLIRGVMVINLDFSQVVKRLATLDNRVSIRLI
FT                   YPNGEYLYHPDATRMFTLSQGGPAGLFQEYPQLTWPDFNTLIEGEPFLIPLKAQHKLIA
FT                   GQLIHLDSQQRSPPLIVLGVTSDRMLQLLTNQLAHKLTLIVLALVTLLTLLTAWMAYRL
FT                   WAPLRDLTESAHMLAKSLHEGSIPHQNRQDEVGTLARAIHLLLQRLQHIHQRTQRFNEQ
FT                   LQTEVAQRTTALQETIALADERRSLLAEVQSMARIGGCAWDPTHDQLSVTEAFLQLTNS
FT                   YGAPPTTLQDLLDLYGIEDRERLQHMLEIALQSGLKGDMVASLGGHNQLWLRTLLQPIR
FT                   QGPATIKIHIVIQDITREHLIQEAHTREERRNTWLLKLNEVAYASGDALMELALQGAIT
FT                   LSASPQAFFIWMDSSLNHICQERLYPAPRDPAAVDRYRPARFAPSQQAFISKESVLHHA
FT                   QAATDQPALVLPLFEDRQVIALLGVLGASTPYDNRDIQHLHYFAQGLWRVLQRRRDQEM
FT                   VKQATAEAQRANAVKGRFLANMSHEIRTPMNAIMGFTELSLTQHPPAPHDRHLQAIRTA
FT                   SQTLLALLNDVLDFSKIDAEQLALEQIPFSPTEQLQQIAQMLAPQAQAKGLHFHTFQQG
FT                   SMPTLLLGDALRLRQVLINLVSNAIKFTHQGKVVLGMYGNEPTPEGRCLLRFEVIDSGI
FT                   GIEASQQERLFQPFVQGDLSTTRTYGGSGLGLAISKRLVHLMGGEMQLESTLGAGSKFS
FT                   CLLPFSLCKDDLAKSLTPSAQTLSIPHWPDVTLLVAEDNRLNREMLQELLARAQIGCLH
FT                   AVNGTEAVAMLERDNFPLHGVLMDMQMPQMDGLTATQLIRLHHPKGTLPIIAMTANGTA
FT                   ADRQRCLEAGMDDCLIKPIDMQTLYSTLRLWLPEPQGEEDPYQQPLLASQQRWQQWQPD
FT                   PQLIDKQDLFLRLGGDFDRLMNRLGYFATECERYFTPLTHAYTERDTTTVLSAAHAMKG
FT                   IAKNLSLLQLADYLERLEAMVQQHGCDAPGLSSLWQHLLTCQQATCLAMPAQLPPATTP
FT                   PSPQLEADMTQFMALLNDNDLQAKALLQQLFPLLQQRGQGQLAADLENALAQFDFAQAR
FT                   ALLQNPNPSYNPLKPAVP"
FT   sig_peptide     complement(654847..654963)
FT                   /locus_tag="Mmc1_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.620) with cleavage site probability 0.310 at
FT                   residue 39"
FT   gene            complement(655233..657599)
FT                   /locus_tag="Mmc1_0543"
FT   CDS_pept        complement(655233..657599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0543"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   mag:amb1538 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43068"
FT                   /db_xref="GOA:A0L525"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:A0L525"
FT                   /protein_id="ABK43068.1"
FT                   /translation="MFNLSLWKFKTLIRLLILVPTLTMLGTGLVIWSASNSSQQRIHHV
FT                   QSRVVPLNQLALSMKYEVAQVNLWLTDVSATQALNGLDDGFNEAANHANLFKKQLHEFR
FT                   KVSAAEGKDKNFLDLLESHFDAYYAQARQMAQSYVSGGPTEGNALMGDVDEKAKALEND
FT                   LIILEKKYVAGMLKALEIVETQMGHLVTRSVLIFIVSIIVILAMGTFVARLVLDKLGAD
FT                   PIELSQVMERLGRGDLTHRVIFKNAKPHSLAQHVMQMSRDLFQMAATLKLQALTMRATV
FT                   LEQKEAQNDLKRDSGESYGLAQEVVSINDGIDAMTQSLRVDLEQADNNMASLTATADDL
FT                   SGSVSSIAAASEQASQNVNTMAAAAEQMTGNITAVNSSLEQVNLSVGHVSGALDELNHS
FT                   LDQVRNRCIQADRKSNEAQQFTQQTQTTMEALTESAREIVKVVGLIKTIADQTNMLALN
FT                   ASIEAAGAGEAGAGFAVVANEVKDLAKQTADATKQIEQRTQEIQNNTQEAAKVSFNVNE
FT                   MIQQIGKTTAQITEAVEEQSGAVARINDSMHDVTIAGQEVGRNAMELEAASTEVARAAL
FT                   EAAAGTNEIAASASQVARSAEQVAQNSSQASQRLNVIKNNSGEIYEASANVQKKMLQSM
FT                   DFANFLDGAIAHAGMLSEMSDESCDALNKAAEAFNIGTPALDIQSVKKAHIGWLGKLVG
FT                   VIRGRSSIKPEDVATARDCAFGQWYYNEAQSTMGDNPLFIEIATPHQKVHETAREVVKL
FT                   MNEFNQEGAEQGLHRFNELRKDLFKRLDRLYLDTL"
FT   sig_peptide     complement(657498..657599)
FT                   /locus_tag="Mmc1_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.864 at
FT                   residue 34"
FT   gene            658105..658392
FT                   /locus_tag="Mmc1_0544"
FT   CDS_pept        658105..658392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43069"
FT                   /db_xref="GOA:A0L526"
FT                   /db_xref="UniProtKB/TrEMBL:A0L526"
FT                   /protein_id="ABK43069.1"
FT                   /translation="MRLNRQALPTRSVRRVKMRQAVILGAGVALMWLVSALCILGWQGL
FT                   SQDMGWAVSIIALLVASGTLMHYLVQFMSGGWESVDEAMQRSNRISSQLR"
FT   sig_peptide     658105..658263
FT                   /locus_tag="Mmc1_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.735 at
FT                   residue 53"
FT   gene            complement(658591..659343)
FT                   /locus_tag="Mmc1_0545"
FT   CDS_pept        complement(658591..659343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0545"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cps:CPS_2473 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43070"
FT                   /db_xref="GOA:A0L527"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0L527"
FT                   /protein_id="ABK43070.1"
FT                   /translation="MPQRHEILIVEDDKVTRALLSGYFNNAGYRTHAAEDARSMQRVLN
FT                   GGGIDLVLLDINLPGRDGLSITQNLRAESAELGIILVSSRSEEVDRIIGLELGADDYVV
FT                   KPFNERELLARVKVLLRRIDLIKHYANSCRDLDELGSYRFDHWTLSHSARQVYHRDGRQ
FT                   VELTNGEFRLLLAFVNRAGRAQSRDQLLDAVSNREWSPNDRTIDVMVNRLRRKLEVDAR
FT                   DPKLLITIHGVGYQFTPEVVQLTSPLQE"
FT   gene            complement(659979..661313)
FT                   /locus_tag="Mmc1_0546"
FT   CDS_pept        complement(659979..661313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0546"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   sdn:Sden_0381 type I secretion outer membrane protein,
FT                   TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43071"
FT                   /db_xref="GOA:A0L528"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A0L528"
FT                   /protein_id="ABK43071.1"
FT                   /translation="MLKHRSTQLLTLLSLTWGMGSAWAQEGAPLTLQDAVLKALSSNPE
FT                   VLASWENKQANTQLVRQARAGYFPTLDLAAGYGKEVTDNTTTRAANKGTTTMNRGESSA
FT                   TVSQKLFDGLSTYTNVKRAKASDQSSLHAFDRTAEKVGRQAMEAFMERAKQQQILALTA
FT                   ENVQDHEETLKKLKALAAGGQGKKADVQQTESRLFSAKDTLVQAKGKINIAGATYERVI
FT                   GESPGMLATPALPKENLPETLDQALEIAAQMHPLLLGSQQDLNAATFAKLKSRSSFMPS
FT                   ITLDLTASNNGNVSGTRGYAQAMSAMLNMKYNIFNGGSDLAAYRESDHRINQTRETLSL
FT                   NQRTVREQVITAWEQMEMAKHSVALVEKQVKAQQDTVKSYLQEFELDKRTHLDVLNAKN
FT                   ELYRARVQQVSGNFDYIMRVYQLWSAMGVMRENMGLHQTPVMAKH"
FT   sig_peptide     complement(661239..661313)
FT                   /locus_tag="Mmc1_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.977 at
FT                   residue 25"
FT   gene            complement(661725..663044)
FT                   /locus_tag="Mmc1_0547"
FT   CDS_pept        complement(661725..663044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0547"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: eca:ECA3269 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43072"
FT                   /db_xref="GOA:A0L529"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0L529"
FT                   /protein_id="ABK43072.1"
FT                   /translation="MSQWNSESFADARITARSARIGVVSHVLLWCSTLFFAVALLWAAY
FT                   AEVVEATTGMGKVIPSGQVQRIQSLEPGRLTERLVREGDEVKTGDILLRIDDTQFQATY
FT                   NESAARILALQARIARLTAEAQGASVFEVPGAILEQDPELAASEQSLFKSRRQSLLNNI
FT                   QIREQQIVQRQQELAEAESAILQFQERLHLTRKEIKLTQPLVEKGLVGEVTLLHAQREE
FT                   ANLKGEITSLQHAIPRARSALIESKSKLEEATLAFKSQVQEDLNTASSELTRIQQSSSA
FT                   LEDRVTRSAIRSPVNGTVIRVHVNTIGQVVQSGATLMEIMPTEDSLLVEARIDPKDIAF
FT                   LHPGQPATVKFTAYDFSIYGGLEGELTHISADAITDENGQAAYLVQVRTKDKSMRRNGK
FT                   VLPIIPGMVASVDVITGQKTILNYLLKPIFKARDNALRER"
FT   gene            complement(663044..665212)
FT                   /locus_tag="Mmc1_0548"
FT   CDS_pept        complement(663044..665212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0548"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; peptidase C39,
FT                   bacteriocin processing; SMART: AAA ATPase; KEGG:
FT                   reu:Reut_C5973 ABC transporter, transmembrane region:ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43073"
FT                   /db_xref="GOA:A0L530"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0L530"
FT                   /protein_id="ABK43073.1"
FT                   /translation="MDQTTPQQPPHWTLEGHDPRSEDPLLGTLLFLAHHWHLPATVQSL
FT                   TANLPLTEAGLTPELFLRAAEQAGLKAHIRKQPLHALHTEHLPAVLLLHGRMAVVLLGW
FT                   DEDEAHLLLPESGRETRLDRQALDERYEGHAILVSPMFKHDARTSFIGNPTTGHWFWSA
FT                   LFRYWPIYSEVAVASLLINLFTVASSLFVMNVYDRVVPNKAMETLWVLALGVAIVYCFD
FT                   FLLRTLRAHFLDTAGKRVDIVLASNIYRHVSGMQLSYQPQSTGAMARNLQEFEPLRDFF
FT                   TSATLTAIIDLPFTLIFVVLVAQLGGLNVAMVPLVCMPVVILVGLLLQAPLNRVMNRAL
FT                   KESAQKNAMLVETLGRLETIKLNNAEGHLAGKWENCIIETAKTAQQSRFLSTLGVNFAM
FT                   LVQQFSSVAVVVVGVYAINAGEITMGALIACTILTGRALAPLSQVAGLMVRIQQTMISL
FT                   RTLNQIMNTPQERPEGRTFLSRPRLSGKIQLKDLSFQYPNAKTAALQKLNLLIEPGEKV
FT                   GFIGRVGSGKSTLLKLLQGLYPPTEGLVLVDDMDARQIDPADLRRNMGCVTQDAGLLYG
FT                   TIRENITLGAPFADDSTLRRAVEQGGVAAFTDRHPDGLDLVIGEQGQGLSGGQRQCVSI
FT                   ARALIHNPPILLLDEPTSAMDSGSEERFKKVIEDTLPGKTLLLVTHRASLLSLVDRVVI
FT                   IEDGQILADGPKEAILWQLKEGKFRVKS"
FT   gene            665502..666755
FT                   /locus_tag="Mmc1_0549"
FT   CDS_pept        665502..666755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0549"
FT                   /product="Heme NO binding domain protein"
FT                   /note="PFAM: Heme NO binding domain protein; KEGG:
FT                   ccr:CC2992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43074"
FT                   /db_xref="GOA:A0L531"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR038158"
FT                   /db_xref="UniProtKB/TrEMBL:A0L531"
FT                   /protein_id="ABK43074.1"
FT                   /translation="MMHGVIFLALEEYLDERLGDDAWEKVVETAGIADTEFTPDRMYDA
FT                   QDWEALLLAAAQVMEMERAALLEDFGAYIVPGLMEMGEAMNLLDHRWRTMDYLENGKEL
FT                   IQAAIRMQIPGFIPPDIRTLRLRQGEAAVAYMAKNRMGPLLKGVAKGLGEHFEEPLDIW
FT                   VAEPRAGSHFYRINVRLADHEKLRAVDMVREFNTVRTQGGKVKFYNQFMGVPFTNEGTV
FT                   LDVNEDGIQLLTTRDQLLAMRRTNETFLALQHLMVGVHAHVRKMDVNKGMVVLDRMLLT
FT                   DGAVGQRQETRVEPPAEIRLQMGVAGKRFQGFLKDISANGASCRFSRSGLSEHFLFLNC
FT                   KLEFLVPLSAFENQDSLANTNQYFIAEGNILDVIMDEKEVIVRLIFDVLTDNAKKLITL
FT                   FVAERKQSVIRHMSQISA"
FT   gene            667332..668795
FT                   /locus_tag="Mmc1_0550"
FT   CDS_pept        667332..668795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43075"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A0L532"
FT                   /protein_id="ABK43075.1"
FT                   /translation="MKCTMKKRAHTFLRGLFSVIGVLLLVASQPAMAEDKELPAEVVNP
FT                   LDRPLKALKAFASMSKESATCATCHREDNIGLYNQWGRSKHYGANVGCYECHQANPNDP
FT                   DAYRHKGKVISTIVSPKDCGRCHEKESIEFQSSAHAGAADFEGSTEHAMAMMAQGAHEG
FT                   KDVDKAAGSQACVQCHGAKIKVNMSGKLLPETWPNSGIGRLNPDGSRGACSACHQRHEF
FT                   SRAQARRPEACGKCHLGPGHLQKEIYNQSKHGVSYYSNIDRMNLTSPKWIPGEDYDAAP
FT                   TCTTCHMSATKEQPLTHNTSLRVSWNLRSPVSETVNDMMERTGAKGPDGDERRDAMANV
FT                   CISCHSERIVKNFYEQFDSAVELYNKKFANPGKEIMESLAEAGLITSKQLDDTIEWTWF
FT                   RLWHHAGRAMRHGAAMNAPSVQQWEGMYELSNLFYTQLIPQARELADKAEAAGNKAAAD
FT                   KVRGVLDAIATRPEHLWMSEKQVAATTDK"
FT   sig_peptide     667332..667433
FT                   /locus_tag="Mmc1_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            668806..670872
FT                   /locus_tag="Mmc1_0551"
FT   CDS_pept        668806..670872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0551"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: rfr:Rfer_4073 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43076"
FT                   /db_xref="GOA:A0L533"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A0L533"
FT                   /protein_id="ABK43076.1"
FT                   /translation="MFRYLLLLMLLLSPLGGEAQAYTIGKGDQDPGYQIPVIDSAAQML
FT                   ERATLANPVAVTQETTNNHCLECHGVPGFGVPLKPDAFGKQQIRHLDVKVEAFKNSVHG
FT                   VRRCTECHTDIQQIPHKPGVKRTVNCESCHLKQLHQLETTADASKRATLEKAVGNANNF
FT                   LASTHAQPSKTDPSRPRAYCHDCHDAHAVFPLRSAQGINFRLTTPQKCGTCHEKQLMDY
FT                   EDSYHASLVLQKGDRTAAVCSDCHTAHQISSPKDGKAKVAITENCGTCHAKALKTYRQT
FT                   YHGQVNELGYGYTAKCYDCHDAHKLRQVKDPISPAHPDNRLATCKKCHANAPPGFTTFH
FT                   AHGDMHDKEKYPLMYWVATSMLGLVFGVFAFFWTHSLLWYLREYKEVGSYRYTAENHPH
FT                   HGHGHDLIQSDDPYAGKYIRRFTKGWVIAHGVLAVGVMILSLTGLAVLYSETLWAYYVM
FT                   KLLGGPQNAAILHRIGAVMFAVIFFGHIGYMLYRIIFVRSYKLQWFGPYSLLPRWQDLR
FT                   DVIAMFKWFFHRGPKPTFDHWTYWEKFDYWAPFWGMFIIGVSGLMMWFPNVAATYLPGW
FT                   VFNIAIIVHADEAFLATVFLFSVHYFNCHYRPTRFPQDIVMFTGTIPLSEFKDERRHEY
FT                   DRLVAEGKLEKYLVDPPSCRAEKNAKKLGALLIIMGIILCIFALHGFAATFGG"
FT   sig_peptide     668806..668871
FT                   /locus_tag="Mmc1_0551"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            complement(671650..672609)
FT                   /locus_tag="Mmc1_0552"
FT   CDS_pept        complement(671650..672609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0552"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: mca:MCA2523 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE, N-terminal domain protein;
FT                   Ketopantoate reductase ApbA/PanE, C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43077"
FT                   /db_xref="GOA:A0L534"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L534"
FT                   /protein_id="ABK43077.1"
FT                   /translation="MTDSTTPPQTPHTPTVLVVGTGAVGGFYAARLAAAGAQVSVVCRS
FT                   DYATIAQQGITIHSFKFGEQHFHPYSVHEQPETFPGTPDYMLITLKVLPQIDLAAMVAP
FT                   KIGPNTTLLLIQNGIEIEEKLHQAFPNTPMISALAFVCVSRTQPGHIDHLCFGHLSMGH
FT                   YPPQPVQPALTQLVQLFKHAQIDAHATDNVVTARWRKLVWNAPFNGVSVLAGGLNTREI
FT                   MDDAPLQQLCRDVMAEVVDLAAAAGHALADDVIEVNMQATERMQPYRTSMLLDHEAGRE
FT                   MEVEAIFGNALQRAQQLGRSYPHLQSFYALLRAIGRKR"
FT   gene            672631..672930
FT                   /locus_tag="Mmc1_0553"
FT   CDS_pept        672631..672930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43078"
FT                   /db_xref="GOA:A0L535"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0L535"
FT                   /protein_id="ABK43078.1"
FT                   /translation="MKVKIFMAVAMLGLLSGQTAAADEGKVLHDESCIACHASRFNGQA
FT                   EQMYTRAERKKNSYASLKQMVAFCNNQVGTGWFDEEVGLVTDHLNRTYYKFPKP"
FT   sig_peptide     672631..672699
FT                   /locus_tag="Mmc1_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            complement(673097..673639)
FT                   /locus_tag="Mmc1_0554"
FT   CDS_pept        complement(673097..673639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0554"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   csa:Csal_0319 Appr-1-p processing"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43079"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A0L536"
FT                   /protein_id="ABK43079.1"
FT                   /translation="MTTLEIILTDITQLPIDGVVNAANNSLLGGMGVDGAIHRVGGTAL
FT                   TQACQALRHTHYPDGLATGAAVATCAGELPAKRVIHTVGPVYAKDPDPQARLADCYRNS
FT                   LRCAQEEGLRSIAFPAISTGVYGFPKQQAANIAVATLLQALREGVALERVVLVAFSEED
FT                   AQILRHALNQAQHSIIL"
FT   gene            673958..674923
FT                   /locus_tag="Mmc1_0555"
FT   CDS_pept        673958..674923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0555"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   pca:Pcar_2486 soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43080"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0L537"
FT                   /protein_id="ABK43080.1"
FT                   /translation="MFPTSITPAAWQQQNRVANTTTTVGGDAEAFQQALQRASDTGLRP
FT                   AALNNTMVEYLTRAVQGSLNSQTPAQGGAAVQTRPHLVDRSAANWIYQSVPNGGVVLVN
FT                   PKHVNAVYMQQRVESHVAPGQVNRSSVGQVAKSAFGATHQNGGGMADEQHRREVPRIAL
FT                   NHSPAARLAEVTGGRRVAAQTVTTSPNIPFAGLIERASVSSGVDERLLRSVIYVGSHFD
FT                   PRAVSAEGAQGLVQLKPQVWSDMGVTDPFEAEQNVMGGSRYLRTLLDRYQGQRDLALAA
FT                   MHWGVNQLERNPDAIPDRTADFIHKVAKLLDADEGSQVMV"
FT   gene            complement(674988..675974)
FT                   /locus_tag="Mmc1_0556"
FT   CDS_pept        complement(674988..675974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0556"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   vpa:VP0028 zinc-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43081"
FT                   /db_xref="GOA:A0L538"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0L538"
FT                   /protein_id="ABK43081.1"
FT                   /translation="MSDTFKALVLRQDAQQTLAAIEQLSLDQLPEGEVLVAVEHSSLNY
FT                   KDGLAITGTGKIVRHFPHVPGIDLAGEVISSESALFKPGDRVVLTGWGVGERHWGGHAQ
FT                   RARVKAKWLNHLPTGFSSARAMAVGTAGLTAMLCMMALQTSGITPHDGPILVTGAAGGV
FT                   GSIAVALLAAAGYEVHASSGRAALEPYLKELGAHHIIPREQLSRESRPLESEQWAGAID
FT                   TVGSQTLATLLSQMRYNGAVAACGLAGGMDLHTTVFPFILRGVRLLGIDSVYAPAPHRQ
FT                   QAWQQLAQQLPMALLDSLTRHIPLEACPEAANQIMAGQIQGRVVVDL"
FT   gene            676164..676901
FT                   /locus_tag="Mmc1_0557"
FT   CDS_pept        676164..676901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0557"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43082"
FT                   /db_xref="GOA:A0L539"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0L539"
FT                   /protein_id="ABK43082.1"
FT                   /translation="MNRAGKSLGLSGLLLLMLLVGCAENPQPLSPELEAQRQSAMARGG
FT                   RLYDNWFAEKQAGAPATSHRLYPTQGSYRGSITWRCSSCHGWDGYGRNGVFRSGPDYTF
FT                   IKGIEDVDALSDAQVRQTLQQEHRFNALLLPQDEDDLIRFMREGQINMRRYIDPSNGRL
FT                   RRGDAQQGAAHYQALCQSCHGERGMLSASAPLGLVAQRNPWRTLHRILNGSPGVSGKPF
FT                   MRPYGEQVVADLLAYLASLPNQR"
FT   sig_peptide     676164..676235
FT                   /locus_tag="Mmc1_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.391 at
FT                   residue 24"
FT   gene            677128..678234
FT                   /locus_tag="Mmc1_0558"
FT   CDS_pept        677128..678234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0558"
FT                   /product="DegP2 peptidase, Serine peptidase, MEROPS family
FT                   S01B"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: mca:MCA1725 serine
FT                   protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43083"
FT                   /db_xref="GOA:A0L540"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0L540"
FT                   /protein_id="ABK43083.1"
FT                   /translation="MSVHPLSLRHWIVWALLFLLAGMLFGPAVERVFIAFSTEPRAVTA
FT                   RGNLAEDERNTIDIFKTAKPSVVYITTLKHVRDFWTRNILKTPQGTGSGFVWDNQGHIV
FT                   TNWHVVKKATEAIVRLSDQTSYNAVLVGASPEHDLAVLRIKTSASHVQPLPIGESHNLQ
FT                   VGQKVYAIGNPFGLDHTLTTGVISALERSIDSEAGAVMEDLIQTDAAINPGNSGGPLLD
FT                   SAGRLIGINTAIYSPSGAYAGIGFAVPVDEVNRVVPQLIAQGRYQRPSLGIQASDRSSA
FT                   QILSRFEITGVLVLGVASGSAAQRAGIQASRLDERGIVLGDVIVAIADQPTENIDQLQK
FT                   ALAKYRVGDTVKITLWRQGENQQLEVVL"
FT   sig_peptide     677128..677265
FT                   /locus_tag="Mmc1_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.298 at
FT                   residue 46"
FT   gene            complement(678329..679018)
FT                   /locus_tag="Mmc1_0559"
FT   CDS_pept        complement(678329..679018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0559"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   sru:SRU_0608 CMP-N-acetlyneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43084"
FT                   /db_xref="GOA:A0L541"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0L541"
FT                   /protein_id="ABK43084.1"
FT                   /translation="MVAGKRVLALIPARGGSKGIPGKNLVELGGKPLLAWSIETALACS
FT                   GIDRVVLSSDDASIMACGRAYGCDVPFVRPAALSTDAAPAADAIMHALESLEEAYDYLV
FT                   ILQPTSPFRRVEDVEACLALSIKQGAPVVSVMEPRHPPQWMFSLGETGEMQPLLSGEIP
FT                   YQRQKVRPYYALNGAVYVAEVAYFREHRSFLGERTLAHLMPAAFSVDIDTPDDLICARA
FT                   RLHALPG"
FT   gene            complement(679018..680073)
FT                   /locus_tag="Mmc1_0560"
FT   CDS_pept        complement(679018..680073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0560"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: CBS domain containing protein; Nucleotidyl
FT                   transferase; KEGG: sru:SRU_0607 putative
FT                   mannose-1-phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43085"
FT                   /db_xref="GOA:A0L542"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0L542"
FT                   /protein_id="ABK43085.1"
FT                   /translation="MLTISWKSVRVAPEAPLMRALEIISEGALGVALVVDADDKLLGLV
FT                   TDGDVRRGLLRHISLDVPVREVMCTTPTVARDSDTQEHIMTLMRTRTLHHIPVVDDQGR
FT                   VVGLEWLKDMTLPTPRDNWVVLMAGGLGSRLGELTRDCPKPLLHVGKQPILEMIIENFV
FT                   SYGFHKFYLAVNYKKEMIKAYFGDGSRLGVRIEYLEEEQRLGTAGPLSLMPEAPKDPFF
FT                   VMNGDLLTRIHFGRVLDYHRQQQADATMCVRQVEETLPYGVVDLGENHRLNGITEKPVN
FT                   RYFVNTGIYLLEPHVLPIIPKGQFFDMPDLFRSLADEGKHPVAFPFLEYWMDIGQVGDF
FT                   HQACRDVKDSF"
FT   gene            complement(680245..681399)
FT                   /locus_tag="Mmc1_0561"
FT   CDS_pept        complement(680245..681399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0561"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   ilo:IL0550 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43086"
FT                   /db_xref="GOA:A0L543"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A0L543"
FT                   /protein_id="ABK43086.1"
FT                   /translation="MKLLGITCSRAEYDLMSGLYMRLHADPDVELKLLVAGSHLSPTFG
FT                   RSVQAIRQDGLDILLTLETLLDADSRVSRLKSASLLLQNSIDLVAHYDPDLILYAGDRE
FT                   EVIIGGLLGAYLEIPTCHFFGGDHSQDGHVDHMVRHATSKLSTVHMVSLPQHAQRLLKM
FT                   GEAPQRVHQIGSIALDKFVRHQPAELAAIHAQLGIQEGFTRYALVIFHPVAEEKAQAHH
FT                   YFENILLSLKKRNIPALVSAPNADEGFSRLLEVVEHYRGDPHFHFYRNLERALFLSVYK
FT                   RCDFLIGNSSSGIIEAASIPIPVINVGLRQRGRLAGANVHFCDPHPEALDHALEQVAKP
FT                   AFQNSLKGLKNPYGDGQSEVKAHQLIRSLDFKALRLKREDILSL"
FT   gene            complement(681489..682490)
FT                   /locus_tag="Mmc1_0562"
FT   CDS_pept        complement(681489..682490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0562"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="PFAM: N-acetylneuraminic acid synthase, N-terminal
FT                   domain; SAF domain; KEGG: syw:SYNW0448 putative
FT                   N-acetylneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43087"
FT                   /db_xref="GOA:A0L544"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A0L544"
FT                   /protein_id="ABK43087.1"
FT                   /translation="MATLVIAEAGVNHNGSLSMALELVDAAAHCGADVVKFQSFDPQQI
FT                   ASRHAGKAAYQKRTTDATESQQAMLARLALSVEDHHQLLQRCQQRGIGFLSSPFDLPSL
FT                   ALLVGLGCRPFKIPSGEITNLPLLRGIGATGEAVLLSTGMATLGEVEAAINVLVMAGTP
FT                   RAQITLLHCTTEYPAPLQEVNLRAMLSMGQSFALPYGYSDHTEGIAIAIAAAALGATVI
FT                   EKHFTLDRQLPGPDHKASLEPAALGEMVQGIRQVEQAMGDGIKRPTPTELANRPIARKS
FT                   IVARCAIRAGEPLTAENLTTKRPGDGLSPMYWDELVGRPAQRDYAEDDPIER"
FT   gene            complement(682496..683641)
FT                   /locus_tag="Mmc1_0563"
FT   CDS_pept        complement(682496..683641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0563"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   mag:amb0078 predicted pyridoxal phosphate-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43088"
FT                   /db_xref="GOA:A0L545"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0L545"
FT                   /protein_id="ABK43088.1"
FT                   /translation="MIPLAIPHLGGREADYLQQCIESTFVSSVGPFVDRFEQQVAQAAG
FT                   VAHGVAVATGTAGLHAALAALHVQRDDLVILPALTFIASANAIAYLGATPWIMDVDPLS
FT                   WTLDPHVVEQALAQHSHWQGDRLIHTPSGRRIAAMMPVHVLGTPADMQRLIPIAQRYKL
FT                   PVVADGAAALGAMAHGQAIGALGAELTVFSFNGNKTVTCGGGGAVVSHDAALIQRVRHL
FT                   TTTARQGPGYDHDEVGFNYRMTNLQAAVGCAQMERLTELVGAKRRIRDRYADALGDLPG
FT                   VTPFQAPSWAKSAWWFSGVVVDRPPQRQEHLRAQLRQLGVDARPFWKPIHQQAPYRNAP
FT                   VSATPVVDGLWWQILTLPCSCGLTEQDQQRVIDGVRQVLKG"
FT   gene            683758..685275
FT                   /locus_tag="Mmc1_0564"
FT   CDS_pept        683758..685275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0564"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bxe:Bxe_A0190 TPR
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43089"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0L546"
FT                   /protein_id="ABK43089.1"
FT                   /translation="MAAVDTIRESLEKAITLQQQGHAEEALLLYHALLQHYPKQADLYY
FT                   LTGLAHQDLQQWPQACERLEQAVALDGQRSDFLLALGMVLQELELPEQAKQRYAQAALL
FT                   DPQDYQAYYHIGDSCIDLGQNRQAIEAFTQAIKCKPDLQEAWLNLGLCLKAAGELPGAL
FT                   QAFTTALQLNPDDAKAKVDYAMALLAMGDYANGWRYYTARFQFSHVFNDMQRIPANVEA
FT                   WNGEPLQDKTLLVLCEQGYGDNLQFARYLPMLRARGVKKLIVESKGHLIELFRYNELAD
FT                   AYCNVMEVKEQQADYYVPLLELPRLLETRVENIPADLPLYRVSAALMHKLAAQIPSGGF
FT                   KVGLVWSGKPLHPRDPARRRSCPFAELAPLATVAGVDFYSLQTGLEEDHMPSKLAGDTP
FT                   LIDLNPYLDDFHHTAAAMQQLDLIITIDTAAAHLAGSLKRPTWLLTPYAADWRWGVTGN
FT                   STPWYPGMRLYRQPAPGAWQPVIAQVTAQLRQLVAYSTGYAATAPSL"
FT   gene            685275..685937
FT                   /locus_tag="Mmc1_0565"
FT   CDS_pept        685275..685937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0565"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   pae:PA1191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43090"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021059"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0L547"
FT                   /protein_id="ABK43090.1"
FT                   /translation="MLRPWAAHFPPVGASVPAWHKANVMQQAVEEILTLLENLLRQHPE
FT                   GLKEFTLYQILKERQIEPFAVENLQDPEVLFRVHFLLFHHLYRLRERLWQQGQGMLHIH
FT                   CLCIKISPTPAPTVPPASPIPYDALAGYYLDLQQLEQTTRAQVEQLLNDFWARFERFEG
FT                   LPARSEALAVLDLPGDADAARIKRRYRELAKQHHPDRGGAVERFREIAQAAESLRNH"
FT   gene            686012..686245
FT                   /pseudo
FT                   /locus_tag="Mmc1_0566"
FT   gene            complement(686598..687140)
FT                   /locus_tag="Mmc1_0567"
FT   CDS_pept        complement(686598..687140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eli:ELI_14740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43091"
FT                   /db_xref="UniProtKB/TrEMBL:A0L548"
FT                   /protein_id="ABK43091.1"
FT                   /translation="MTVPNQEWMEGELYFDFSQALSVISLDGHGQGHGMSHLMKAVDFV
FT                   VEWEQELWLIEIKDPEKSTIPKQHRVAQLESFHQKLSSQSLLHAELFPKLIDSLIYLGL
FT                   NQGISKKPMRYLTLIGMSSLQPPFLTVLKDALLNLHGGCLLGRPTKGWEKGFDVHLFNL
FT                   ELWNEWFPHCPASRIEK"
FT   gene            complement(687137..688159)
FT                   /locus_tag="Mmc1_0568"
FT   CDS_pept        complement(687137..688159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0568"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: psp:PSPPH_4785 probable ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43092"
FT                   /db_xref="GOA:A0L549"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0L549"
FT                   /protein_id="ABK43092.1"
FT                   /translation="MFTRLTLSNFTVFESLDLTFSPGINVFVGANGTGKTHLMKLLYAL
FT                   QCNYQQDSAAISTKIANVFCPKDRMIARLIHRATPVPISKIAARWNNSTKLILEILPHP
FT                   QNMLLSERVVDVDFGSAVFIPPKEILSWAAKFRTLYVKYEMEFEETYNDILVHAYGPPL
FT                   KEPPQGVYAEIMESIQEIIGGSVTEEGEHFYIQRDDDPDQSYPMEMHLVAEGHRKLALI
FT                   WQLIRNGTLMEAKTLYWDEPEANLNPVLVQHVARILLMLADQGVQIFIASHHFALLKEL
FT                   ELQKKKTPITYFALDDAGEHGVTANVCSNYAAITPNKIAEEYLHIYDQELAQTFGESES
FT                   "
FT   gene            688594..688773
FT                   /pseudo
FT                   /locus_tag="Mmc1_0569"
FT   gene            complement(689534..689884)
FT                   /pseudo
FT                   /locus_tag="Mmc1_0570"
FT   gene            complement(690622..691059)
FT                   /locus_tag="Mmc1_0571"
FT   CDS_pept        complement(690622..691059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0571"
FT                   /product="Serum amyloid A protein"
FT                   /note="PFAM: Serum amyloid A protein; KEGG: sdn:Sden_2438
FT                   serum amyloid A protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43093"
FT                   /db_xref="GOA:A0L550"
FT                   /db_xref="InterPro:IPR000096"
FT                   /db_xref="UniProtKB/TrEMBL:A0L550"
FT                   /protein_id="ABK43093.1"
FT                   /translation="MGRNWYPGAPWRLQSAYVAEATDRVGQAFNQVGQAVKHMGQAALG
FT                   AADMAHEYGKMRHDNVQLSDKYHHCMANCRATSRGPGGHQAAETISHVRELYGTHVKGD
FT                   PLWDRRADEAANQHGRSGAGQGQSCKQVCSPYRVRGINPKY"
FT   gene            691994..692251
FT                   /pseudo
FT                   /locus_tag="Mmc1_0572"
FT   gene            complement(692547..694376)
FT                   /locus_tag="Mmc1_0573"
FT   CDS_pept        complement(692547..694376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0573"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="KEGG: rru:Rru_A3121 asparagine synthase,
FT                   glutamine-hydrolyzing; TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase,
FT                   class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43094"
FT                   /db_xref="GOA:A0L551"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0L551"
FT                   /protein_id="ABK43094.1"
FT                   /translation="MCGILAEVGQQSPAAARQRALDRLRHRGPDHGGQWSAQQPVPVWL
FT                   GHRRLAIVDTSSAGNQPLHLHAADLHLVGNGEIYNAPALQKTLEALGHVFHSHSDNEAI
FT                   LHAYREWGSDCLAHLEGMFAFVLWDARQQTLLAARDRMGIKPLFYAATPAGGLVLASEA
FT                   SALVGLDGVAQQGYEPQALSHVLAYGHIPDPYAIWRGVNKLSPGQFLRWTPQQGLRLHT
FT                   YWSPPSQSDAPSDDQAWGQRFEQVLQEHLLSDVPLSLFLSGGLDSTSVAVGVKRLGHQL
FT                   KAFSLGFPGHPRDESALAQATAERLGHPFEAVVMDGRDLLQQVDAALLQQDEPHLFGSY
FT                   LTMLNICSAVAKEYKVVLSGDGGDELFAGYNWYRDIPTALPTLAPWKAALAKPLLRHSP
FT                   LPAALLERARLAFACCSPLHRHAWRTSQRFLPAEVEALLRPAAIRYDDEAFLAPLQRWF
FT                   TPELPLVRALQRIDLMSFCSNHVCAKVDRASMAHALEVRVPYLDRRLVEWAISRPADPR
FT                   EAQGSKPLIRDYIAPHVPAQVLEQRKQGFSLRTTPPANLESTFVAWIEQSPLISQSILR
FT                   RDWPRFLRADDRLRAQKLWHLALLARWMHHHPA"
FT   gene            complement(694376..695398)
FT                   /locus_tag="Mmc1_0574"
FT   CDS_pept        complement(694376..695398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43095"
FT                   /db_xref="UniProtKB/TrEMBL:A0L552"
FT                   /protein_id="ABK43095.1"
FT                   /translation="MKLLVTLKPEGYEKPTASYGVVAEIDWERRCVLRQLRLPSASFRC
FT                   GEAFMAPLIGGLCLTGHRLFVAMWNHIVEIDYPSFEVVNAFSTPQMGDLHGLTTDGTTL
FT                   WVTATATEMVLGFDLNTMELIWQWGADAPILASYPQLYRPPRWRQNWRKRLAYHLQGGP
FT                   QHPPLAAGEHRHRHKSCSPTYHHHLNDVTYHKGKLYVTTSGWYGSQNPGAVIELDPNSH
FT                   AAHFVAPPGSFDGTHDTVFVDDTLFVTESRRNSLAWLNSDGRTGRHTLQPSPYFVRGLC
FT                   WSNHLFIVGYTRMRGTQDPALLVAFNRHFAPMGQMALDQFHPPALGSAIHAVIPVPETL
FT                   "
FT   gene            complement(695395..696594)
FT                   /locus_tag="Mmc1_0575"
FT   CDS_pept        complement(695395..696594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0575"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mca:MCA0625 carbohydrate ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43096"
FT                   /db_xref="GOA:A0L553"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L553"
FT                   /protein_id="ABK43096.1"
FT                   /translation="MSSTPLIDVQGVWKRYGLPLLPTLKRGINRVRGVETQESGGLPWA
FT                   LQDISFQAFPGETLGIVGRNGSGKSTLLKVLAGVTPPTQGSVHMRGSLFPMIELNAGIH
FT                   MELTGRENIQMLGAVLGLTHSQIQQQMPAIEAFCELGEWLDRPVRMYSSGMMVRLGFGT
FT                   GVHVNADVLLMDEVMAVGDVNFFNKCLGYLENLRERGKCTLFVSHNLHRMRRMCDRVLV
FT                   LDKGVPLFVGPTEEGMMVYEEVIRRDGDAAGRGNLGQFDHIHAKLTHPHFLPSGSDKIE
FT                   IEVGEDVTFRFDMNFAHALHDTSLHVALESVDAVDVVFDQRIFDELPAGTHQFGLTWQD
FT                   MRLKPGKYRIRIGIGVGKMQGKGFRVSDVAQLHIKGSSVVRGVYLPETHFTHHTETETP
FT                   "
FT   gene            complement(696594..697400)
FT                   /locus_tag="Mmc1_0576"
FT   CDS_pept        complement(696594..697400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0576"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: dde:Dde_0841
FT                   polysaccharide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43097"
FT                   /db_xref="GOA:A0L554"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0L554"
FT                   /protein_id="ABK43097.1"
FT                   /translation="MTWFRGRYIHLNRQTHEQLVSLVRALVVREFKGQYRRSLLGPAWA
FT                   FLQPMAYMVVFIFLRGVLNIPSDEGVPYALFTFVALVPWTFMSNAVIRCAPSVYANAPI
FT                   LKKSAVPREIFPLASMLTSFIDFLIAALILSLMLIWYQHPVGWTLLWIPLLALLTGLLA
FT                   LGLGLGLAAIGTFKRDVIFAIPFGMQFWLLATPIMYPANQVPERWRSLFDLNPMVGITE
FT                   SFRSVLLHNQSPDLTLLGGSALTIAVIWLIAWPLFRSVSQYFADVL"
FT   gene            complement(697534..698445)
FT                   /locus_tag="Mmc1_0577"
FT   CDS_pept        complement(697534..698445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0577"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: ilo:IL2112
FT                   possible malate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43098"
FT                   /db_xref="GOA:A0L555"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0L555"
FT                   /protein_id="ABK43098.1"
FT                   /translation="MENLILVFLLVVAGYGFQRLPAFPAPQAAAILNQYVIHVSLPALV
FT                   LWKVPTLPISSDLLAPILMPWLMLLASAALVLLVAKLLHWQRPLVGGMLMVVPLGNTSF
FT                   VGVPMIEALYGSHGLPYAILYDQTGSFLALATYGSIILASYHGQGMPGFHPLIRKVVTF
FT                   PPFLALVAALILRFTHNPPFLEFYLQRLAETLVPVVMVAVGLSFKLRPPPGESLALAVG
FT                   LTLKLLVTPLLALALCLLLGWQGVAAQVSVLEAGMPSMITAGALAMAAGFAPQVMAAMV
FT                   GWGILLAFASLLLIKQLLYLLV"
FT   sig_peptide     complement(698353..698445)
FT                   /locus_tag="Mmc1_0577"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.586 at
FT                   residue 31"
FT   gene            complement(698454..699668)
FT                   /locus_tag="Mmc1_0578"
FT   CDS_pept        complement(698454..699668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_5006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43099"
FT                   /db_xref="GOA:A0L556"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:A0L556"
FT                   /protein_id="ABK43099.1"
FT                   /translation="MVDRASLTQRVGKTLYHHWRNSFLFDGAARRELKDEGDLSQRQAG
FT                   SDEDHLRGALAWLCRAHDSTAQRGVARGYAAAWNFHFDARGWQPAYPETTGYLIPTFMD
FT                   VALQQGQDALMQRALGMADWEIEVQLPSGAVMGGTVEQPPSPAVFNTGQVILGWERAYR
FT                   QSGQQRYLLAACRAADYLLAVQQAEGQWRVGNSRFADAKTTTYNVRVGWALILLGQTAN
FT                   RPDYIAAGRRNVDATLAMQNDNGWFRCNCLSDPGAPLLHTICYAIEGIAGAALALQHDV
FT                   YLQRAQLALDHLLPLIDHRGFIPGRLDGNWQGRVEWACLTGSAQLAGQLLLLAHPLQRP
FT                   DYKEGAARLLAFVKRTQNLHSADPGIRGGIKGSYPFSGGYGRYELLNWAAKFFIDALLL
FT                   QQQNR"
FT   gene            complement(699661..700680)
FT                   /locus_tag="Mmc1_0579"
FT   CDS_pept        complement(699661..700680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0579"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: protein of unknown function DUF343;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   mbu:Mbur_1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43100"
FT                   /db_xref="GOA:A0L557"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L557"
FT                   /protein_id="ABK43100.1"
FT                   /translation="MCAKDESHTLSPQRLAMLCCPDCRGELTHQPEVPRLWCPACNHRY
FT                   PIVEGIPVLLPGDVEATIEARFHRYWDTEEKSQLYNQKVEGDGDPFGIYNHESEIYGME
FT                   KLLRPQQQGRILDAGCGNGRMLARFSAQTDAVGIDASLNLLRIVKRAGRGSFHVCCELE
FT                   QIPFKDGLFDTVFSCRVLQHLTQQQQAVQEMSRVTKPGGDLVLELYNSWNLKALYKNLR
FT                   MSKTWAPRLNAPFRAIFRSMSPFQDWGIDYDRYNHWFQVKRWLQQADMHQIQGRGVGFG
FT                   YHKYLLQPFYIDAVLRDHAPRLLSGYYAFCFRLERLLGHLPPFRWGWEKFVIRGTRHG"
FT   gene            700886..702139
FT                   /locus_tag="Mmc1_0580"
FT   CDS_pept        700886..702139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0580"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   rru:Rru_A3096 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43101"
FT                   /db_xref="GOA:A0L558"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0L558"
FT                   /protein_id="ABK43101.1"
FT                   /translation="MWRVCEGQPLSIQAVEWHCETMRILTFSTLFPNPQMPYHGIFVAR
FT                   RLAQLQSYAQATGLALESRVVAPVPWFPVASPRFGRYGRWGAVAAQSEWQGFAVQHPRY
FT                   LLLPKIGMSSAPWMLARGAYAPLKRLEQSWPFDLIDAHYMYPDGVAAILLGRWLNKPVV
FT                   ITSRGTDLNLIPNYTLPRRWITWAAAEAAGLVTVCAALKASLVGLGVAPSRVTVLRNGV
FT                   DLQTFTPPLDRQALRDKLAMHHPTLLSVGHLIPRKGHELVIAALPQLPQVQLVVCGEGP
FT                   MLAELKATAKRLGVAPRVRFAGALAAASLKDYYGAADALVLASDREGWANVLLESMACG
FT                   TPVVASSVWGTPEVVASPAAGRLFTPRTAQALATEVQALLADPPPRSATRHYAEGFAWH
FT                   STSAGQFQMFQAILPHQP"
FT   gene            702153..703370
FT                   /locus_tag="Mmc1_0581"
FT   CDS_pept        702153..703370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0581"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   neu:NE0794 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43102"
FT                   /db_xref="GOA:A0L559"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR024004"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0L559"
FT                   /protein_id="ABK43102.1"
FT                   /translation="MRVLHILDHGLPLHSGYTFRTRALVRAQRSMGWQPLLLTGPKQGV
FT                   VESLEEDFEDLHYYRTLPLQGRWVQRGPLHQLGVIQALKQRLRGLIPHLKPDLLHAHSP
FT                   ALNGWAALWAARHFKVPLVYEVRAFWEDAAVSHGQTQAGSLRYRLSRAMESHVLRQANA
FT                   VTTLCEGLKGDMLARGIAAEKITLIPNAVDVQLFNPLPAQGSAILRQELAFPPGLVLGF
FT                   AGSFYGYEGLALLVEAVAQLAHTGQACNLLLVGGGPETQRLQRLIEQLGCGARVRMTGR
FT                   VDHALVEDYYGVCDWMVYPRLSHRITETVTPLKPLESMALGRPVLASDVGGHRELIQHG
FT                   VTGLLFPAGDLSGLVTVLQQLPQGTARQGLIDAGRDFVTTQRTWLRSAQAYAAAYGMAL
FT                   GREVSK"
FT   gene            703662..705026
FT                   /locus_tag="Mmc1_0582"
FT   CDS_pept        703662..705026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0582"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: tbd:Tbd_0297
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43103"
FT                   /db_xref="GOA:A0L560"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR017528"
FT                   /db_xref="UniProtKB/TrEMBL:A0L560"
FT                   /protein_id="ABK43103.1"
FT                   /translation="MRDLILTLFIVGSLPYAFMRPSYGLLMWALLSYMNPHRLTWSYAY
FT                   DFRFNFLVAFVTLAGVFFNKEVKFRIPIHGTTIFWMFFCLWTVVTSFNSFDPDRAFSEF
FT                   DRFLKIQLMVLITFFLIKDRKWMDWLIWVIVLSIGVWVMKGGLFTLTSGGNFRVYGPAR
FT                   SFITDNNALALAVLMGLPLTFYIRQFAKRLWQKQLALVLIIFSVITVVGSYSRGGMLGL
FT                   VVVLGVLFGRSRRGMIVFLLGVVLVALSYTSMPKHWQERMDDFFAISTAYELREDASMM
FT                   GRLNSWVLAWELAKDRPFVGGGFNTFTAERFQTYAPVPFERHDAHSIYFEVMAEHGFFG
FT                   FALFIGMHLFAVLLGFKVKHLARGKPELDWAVTLATMLQISLLGYYVAGVFLGLAYFDL
FT                   PYHLISILVMLHHIVLKHSDKKVVPSATAWQEPTYGMTTWSRKTDYSIFGRSAGQ"
FT   gene            705219..706631
FT                   /locus_tag="Mmc1_0583"
FT   CDS_pept        705219..706631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0583"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: tbd:Tbd_0199 putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43104"
FT                   /db_xref="GOA:A0L561"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017464"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A0L561"
FT                   /protein_id="ABK43104.1"
FT                   /translation="MIRIFKHYISRWSLLLVLCETSAFLASVYFGVELRFFWAAELDEV
FT                   HRAELLPRALFFAAVMLISMTATGRYQRLMRQGMTEEALSIGLSFIIGLVATSVLFYAL
FT                   PDLFIGRGAFIYAWFIALGLVLLIRVAFYQFIIEPSALQRRILIYGSGQKAGMVERMID
FT                   QDPGDRVIVGFWSPHNSPNVVANHLIYSDERLLVWCQEHHISEVVVAADHGVSMEEMQQ
FT                   LLDCKSNRILVLDLPQFFEREERLILMEALGTEWWIAHSDGIASNLVQEVMKKSFDILI
FT                   SLLLLFTLWPIMLVTALLIVIEGRGKEPVFYRQARVGYGGKIFHVIKFRSMRADAEKDG
FT                   PVWAQKNDNRVTRVGRVIRNTRIDELPQFINVLRGEMSLVGPRPERPEFVELLQQQIPY
FT                   YSERHRVKPGITGWAQIKYGYGASVEDAVEKLKYDLYYIKNHTLFFDLLVLIHSVEVVL
FT                   FGKGADAPRKDV"
FT   gene            706689..707396
FT                   /locus_tag="Mmc1_0584"
FT   CDS_pept        706689..707396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0584"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gvi:gll4302 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43105"
FT                   /db_xref="GOA:A0L562"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0L562"
FT                   /protein_id="ABK43105.1"
FT                   /translation="MSQALLAWLKKFYHALPRPPSSNYHYRDFSLNPYDHVGAGGVILD
FT                   IGGKDARGCYAFGQPPAESRLICLDIMPGPGVDMVADAHDLSQLGEASVDLVIAVSALE
FT                   HMQAPWQVVAEIYRVLKPGGMLYVNTPFVFPFHGDPDDFYRFSHHGLGKLCGAFECLES
FT                   GFNRGPASTMVHVLIHFLAILCSFNRKVLYGLWVDVWSWLLFWIKYLDRWIATYGQAYV
FT                   VHSGAYFIGRKPQ"
FT   gene            707742..709355
FT                   /locus_tag="Mmc1_0585"
FT   CDS_pept        707742..709355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0585"
FT                   /product="lipopolysaccharide biosynthesis"
FT                   /note="PFAM: lipopolysaccharide biosynthesis; KEGG:
FT                   neu:NE1804 chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43106"
FT                   /db_xref="GOA:A0L563"
FT                   /db_xref="InterPro:IPR014345"
FT                   /db_xref="UniProtKB/TrEMBL:A0L563"
FT                   /protein_id="ABK43106.1"
FT                   /translation="MQEYSLRNLQYQLLVQLHGMWRYRWHIVLVSWTVCILGWTGTFMM
FT                   EDQYKAFTKVSIENPQGDLNEYLTGVAKMRFDVTSEAQRIVHNLLNQKNRERVVLSTKL
FT                   REEVRDERSLEETIAKLGQQLTITSRSSSTQSVYTLTHHHSDPEVAKQVVEGFLTILME
FT                   HSVEGVKNRRQEKAQRFLSEQVQKFEDKFAKSDLAWQEFKRSNPLIRPDQGQGYYARLA
FT                   DFKQRAEDERLKLSALSKERDALAEQLAQRQRATLASTPLQAPRAVVAPLNEEIDRNLE
FT                   QLEERILEMLETHYVVGGEKRYLYDEAHPEIRSLRNQILELQRRKEEEMARLKSLSEMP
FT                   QQAFNDEKDPVAQQILLDLRKVEVDLASAQGRLQEYNAQLADLRRREATVPAKEAEYLR
FT                   LKQNRDTALSKLNSILTTQGEAEFSGDVAEGLSKRVHIKVLQKPRLPFAPEGPNRPLFL
FT                   VVTLLAGLGAGMTMSLFMSIMRPVYDSPSALKKDLGLPVLGTVSMADETAVVGLGARTL
FT                   FMLLMISLLVIFAITMYIAR"
FT   gene            709440..710306
FT                   /locus_tag="Mmc1_0586"
FT   CDS_pept        709440..710306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0586"
FT                   /product="putative exopolysaccharide biosynthesis protein"
FT                   /EC_number="2.7.10.1"
FT                   /note="KEGG: eba:ebA4250 probable exopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43107"
FT                   /db_xref="GOA:A0L564"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0L564"
FT                   /protein_id="ABK43107.1"
FT                   /translation="MTFDDRVRKKVVLDFEKLKVRGILTPDVGRSFRAEEFRVVKRPLL
FT                   LNAQQGIDAHTKRNNNMIMVTSAFPKEGKTFTAINLAMSLAAEMDKTVLLVDGDVAKPS
FT                   VSRILGFKSKEGLIDHLLGNVEDYHQILIRTNVPKLMLLPSGRRHHHATELLASENMRL
FT                   LLLELAKDPNRIIVFDSPPLLVTTEARELARNMGQIVMVVEADNTPRYAVKDALNYLDN
FT                   MEIVGLVLNKARMRSGGGYGGYGGYGGYGGYGGYGGYGGYGGYGGYGGYGSETKKKKGF
FT                   FQRLLGG"
FT   gene            710374..711513
FT                   /locus_tag="Mmc1_0587"
FT   CDS_pept        710374..711513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0587"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   dar:Daro_2402 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43108"
FT                   /db_xref="GOA:A0L565"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A0L565"
FT                   /protein_id="ABK43108.1"
FT                   /translation="MGEDKPIVCVVGARPNFMKMAAVLPALGAGAQPVPTLLVHTGQHY
FT                   DAAMKQAFFEQLSIPEPQVDLGVGSGSHAVQTGLVMQRFEPVLDHYGAAAVLVVGDVNS
FT                   TIATALVAVKKGIPVIHVEAGLRSQDRSMPEEINRILTDQIADFLFTTERQAEANLKRE
FT                   GIAADKIHFVGNVMIDTLRRLLPQAATVEALAQRFSLPEGVSLAAGGYGLLTLHRPANV
FT                   DDPQVLAELLQAVCAISHELPLLFPVHPRTLARVQAAGLQGLLESAPQLVTLPPVGYLE
FT                   MLGLMSRARVVLTDSGGIQEETTALGIPCMTLRENTERPITVSHGTNTLVGRDGDKLRT
FT                   TFAQIMQNGGKAGRIPELWDGQAAPRIAQQLQQWYHRQG"
FT   gene            711525..712373
FT                   /locus_tag="Mmc1_0588"
FT   CDS_pept        711525..712373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0588"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: tbd:Tbd_0287
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43109"
FT                   /db_xref="GOA:A0L566"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014344"
FT                   /db_xref="InterPro:IPR022560"
FT                   /db_xref="UniProtKB/TrEMBL:A0L566"
FT                   /protein_id="ABK43109.1"
FT                   /translation="MSPHSNAFSVDVEDYFQVCGFEPWIGPEQWSSFTPRVEANTERLL
FT                   GLLDEAGVQGTFFTLGWVAERFPQLVRRIVAQGHELASHGYSHVRVDRQDAAHFRQDVL
FT                   RTKHLLEDVGGVPVVGYRASTYSIHAQTLWALPILKETGHHYSSSIYPIAHDLYGMPEA
FT                   PRFAHKPHPQGVVEIPPATVVWGGRRFPCGGGGWFRLLPYGVSRWALQRVNGHDQQSVV
FT                   FYCHPWEVDPQQPRVAGVGWRSRFRHYLNLHRTEPRLKALLQDFSWDRMDRVFAQEIAH
FT                   G"
FT   gene            712366..713409
FT                   /locus_tag="Mmc1_0589"
FT   CDS_pept        712366..713409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A2523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43110"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017469"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:A0L567"
FT                   /protein_id="ABK43110.1"
FT                   /translation="MARGLQLYWLREDEPQQAQAWDRFVEAAAGGSFFHLAGWQRLLSG
FT                   LYKHPTYYLYGQRDGQVVGVLPLARVRSRLFGDALISTPFCVYGGVVAQDLQVQEALLD
FT                   EARWLTARLNVAHLELRSVTPLDDGWINKPLYATFRKPIVAEPAANLREIPRKQRAEVR
FT                   RGIQAGLVTRLLQNPDPCYRIYAESLRNLGTPVFARAHFQTLKQIFAERCEVAVVEQHG
FT                   VAVSGVLSFYFRDQVLPYYGGALPHGRQVGAYPYMYYDLMNRAAAQGCRWFDFGRSKRG
FT                   TGAYDFKRFYGFSPQPLHYGYYLYERRELPDLNPLNPKYQRFIALWRRLPLAVANGLGP
FT                   LLARNLG"
FT   gene            713416..714615
FT                   /locus_tag="Mmc1_0590"
FT   CDS_pept        713416..714615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0590"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   tbd:Tbd_0289 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43111"
FT                   /db_xref="GOA:A0L568"
FT                   /db_xref="InterPro:IPR017521"
FT                   /db_xref="UniProtKB/TrEMBL:A0L568"
FT                   /protein_id="ABK43111.1"
FT                   /translation="MANILFLVHRIPYPPNKGDKVRAYHLLLELAARHRVAVGAFVDDP
FT                   HDLQYAQELAALVEGPCHLVPLDPKRAKPASLRGLLKGEALSMPYYRSRRMRRWVEARF
FT                   AAGLVDATVCYSSPMAQYVAHHNQPIIMDFVDVDSDKWRQYAQQQRGVMRWLYQREGTL
FT                   LEWQEKAIADRVEAAYFVNAQEAEHFRSLHPARRGMVHHYDNGVDLEKFNPQLAFPNPY
FT                   RGAPVLVFTGMMDYWPNIQAVVWFSKRVLPALRAHHGDLQLAIVGAKPTDEVKQLAALP
FT                   GVMVTGRVADVRPYVAHAAFAIAPLLTARGTQNKVLEAMAMGKAVLATPQAMEGLASCA
FT                   GVGRWVAAETATMVAHGLALLAEPELAAQSGAAGRRCVESHYHWPANIAPLLTTLEQLL
FT                   "
FT   gene            714612..715733
FT                   /locus_tag="Mmc1_0591"
FT   CDS_pept        714612..715733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0591"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   dar:Daro_2407 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43112"
FT                   /db_xref="GOA:A0L569"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017522"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0L569"
FT                   /protein_id="ABK43112.1"
FT                   /translation="MRRRHLCHLVYRFDVGGLESVLVELMQRLPAERYRHSLVALTEVG
FT                   VLQQRLQGYGVAFYALHKQPGKDLAVWWRLYRLLRQLRPDLLHSCNLATIEGQLPAFLA
FT                   GVPRRIHAEHGRDSYDLDGSNRKYRWLRRLLNPLIHHWVAVSGELHDWLAGPLKIQPAK
FT                   IVTIANGVDLERFHPARADRAQLLAKSGFADEQVIALCVGRLWPVKDQANLLTALALLQ
FT                   QQGRLGGLRLVLVGDGPQRGALEQQVSASGLATVVRFLGTQFDVAPLMAAADLLVLPSL
FT                   AEGTPLTVLEAMACGVPVVATAVGGVPALLQAGQQGALLPPGDAPALAEALQPYGVVSA
FT                   KAWRRAQGAQGRARAEAQFGWARTVAAYEGLFQ"
FT   gene            715830..716363
FT                   /locus_tag="Mmc1_0592"
FT   CDS_pept        715830..716363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43113"
FT                   /db_xref="UniProtKB/TrEMBL:A0L570"
FT                   /protein_id="ABK43113.1"
FT                   /translation="MVVRAPVRVGEGIEMSEQNLSDESTQATVTSEEQQRARRRKLIKG
FT                   LALCAPMVVTLRPGAALAGGSNSPECFMEGDPKQTLNFGGNAFGGNRCTSDATNDTAVN
FT                   DNTWSGYIVKDRSEFSGDTSFMTGGTNIATDDCLVFVDGTGTVNNTATGDATGWGNDGA
FT                   HYLVKSSCWSSLAT"
FT   gene            716447..716719
FT                   /locus_tag="Mmc1_0593"
FT   CDS_pept        716447..716719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43114"
FT                   /db_xref="InterPro:IPR027599"
FT                   /db_xref="UniProtKB/TrEMBL:A0L571"
FT                   /protein_id="ABK43114.1"
FT                   /translation="MPLGSPPRWCRVGQQYALYNPLNGATHFLQESAYETVQALVQQPM
FT                   TMTALMACLGLDEAREEAEAQVVQSGLLRLLWELDNLGIIAPLPC"
FT   gene            716713..717636
FT                   /locus_tag="Mmc1_0594"
FT   CDS_pept        716713..717636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0594"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="KEGG: tbd:Tbd_2497 HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43115"
FT                   /db_xref="GOA:A0L572"
FT                   /db_xref="InterPro:IPR027600"
FT                   /db_xref="UniProtKB/TrEMBL:A0L572"
FT                   /protein_id="ABK43115.1"
FT                   /translation="MLRLADLPHAEVVRRLAQEGLRWRLGPALYHLHSDVAAIGVWLQT
FT                   LYADAPVMEAGQGVTGCHAALLREPGLRRWFRPQVRLWVDGPTPFLPFPLDHAPPHLEW
FT                   GLNFLFTTRHAHKLLLHAGVVERHGRALILPGFPGYGKSTLTAALSLRGWRLFSDEFGL
FT                   FEPGQGLAKPMPKAIALKNEAIEVIRAWAPQAPLGPLFPKTRKGTVCHLYPAREAVQRM
FT                   DEGAVARWIVFPRYQAGVPLQLYPLTPEQLFPRLAGGAFNYETLGEAAFTTVAQLCQSC
FT                   TAFEMPYSQLSEAVQVLTQMADEGIA"
FT   gene            717633..718745
FT                   /locus_tag="Mmc1_0595"
FT   CDS_pept        717633..718745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43116"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:A0L573"
FT                   /protein_id="ABK43116.1"
FT                   /translation="MSWGDALLAVLREPRYLLSLPPAEQEPLLRMLRVEGLLAHVGARL
FT                   QASPHWQNMPEDLQGVFLPAMVYAQDRRRMLLWEVNRIRRAVRHLACPILLLKGAAYAI
FT                   LALPNARGRLVADVDIMLRREDLAQVEQALLEQGWEAVKLDAYDQHYYRQWMHELPPLI
FT                   HSKRQVELDIHHTIVPLTSRLKPDVQALWQAAEPLQAPVEGQYQGLLVLAPTDMVLHAI
FT                   VHLFQEDLHHGLRGLMDIHLLLQAFAQPSFWESLVPRAQQLKVTRPLYYALYQCHHRLG
FT                   SAIPAPVLQASAAHAPRAPLRWFMNGLMTRLFTPRLRPVGREDGLDLPARFFMYIRAHW
FT                   LRMPVGLLLKHLSRKSARRWGPDVWTQRNP"
FT   gene            718720..720612
FT                   /locus_tag="Mmc1_0596"
FT   CDS_pept        718720..720612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmc1_0596"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase,
FT                   class-II; asparagine synthase; KEGG: noc:Noc_1975
FT                   asparagine synthase, glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:Mmc1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK43117"
FT                   /db_xref="GOA:A0L574"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017539"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0L574"
FT                   /protein_id="ABK43117