(data stored in ACNUC7421 zone)

EMBL: CP000474

ID   CP000474; SV 1; circular; genomic DNA; STD; PRO; 4597686 BP.
XX
AC   CP000474;
XX
PR   Project:PRJNA12512;
XX
DT   27-DEC-2006 (Rel. 90, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 8)
XX
DE   Paenarthrobacter aurescens TC1 chromosome, complete genome.
XX
KW   .
XX
OS   Paenarthrobacter aurescens TC1
OC   Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Paenarthrobacter.
XX
RN   [1]
RP   1-4597686
RX   PUBMED; 17194220.
RA   Mongodin E.F., Shapir N., Daugherty S.C., DeBoy R.T., Emerson J.B.,
RA   Shvartzbeyn A., Radune D., Vamathevan J., Riggs F., Grinberg V., Khouri H.,
RA   Wackett L.P., Nelson K.E., Sadowsky M.J.;
RT   "Secrets of soil survival revealed by the genome sequence of Arthrobacter
RT   aurescens TC1";
RL   PloS Genet. 2(12):E214-E214(2006).
XX
RN   [2]
RP   1-4597686
RA   Mongodin E.F., Shapir N., Daugherty S.C., DeBoy R.T., Emerson J.B.,
RA   Shvartsbeyn A., Radune D., Vamathevan J., Riggs F., Grinberg V.,
RA   Khouri H.M., Wackett L.P., Nelson K.E., Sadowsky M.J.;
RT   ;
RL   Submitted (11-OCT-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; c1b2af1b43f9d348316e084b43ad6254.
DR   BioSample; SAMN02604022.
DR   EnsemblGenomes-Gn; AAur_0009.
DR   EnsemblGenomes-Gn; AAur_0011.
DR   EnsemblGenomes-Gn; AAur_0035.
DR   EnsemblGenomes-Gn; AAur_0150.
DR   EnsemblGenomes-Gn; AAur_0151.
DR   EnsemblGenomes-Gn; AAur_0152.
DR   EnsemblGenomes-Gn; AAur_0155.
DR   EnsemblGenomes-Gn; AAur_0156.
DR   EnsemblGenomes-Gn; AAur_0157.
DR   EnsemblGenomes-Gn; AAur_0203.
DR   EnsemblGenomes-Gn; AAur_0403.
DR   EnsemblGenomes-Gn; AAur_0416.
DR   EnsemblGenomes-Gn; AAur_0417.
DR   EnsemblGenomes-Gn; AAur_0418.
DR   EnsemblGenomes-Gn; AAur_0668.
DR   EnsemblGenomes-Gn; AAur_0788.
DR   EnsemblGenomes-Gn; AAur_0831.
DR   EnsemblGenomes-Gn; AAur_0839.
DR   EnsemblGenomes-Gn; AAur_0845.
DR   EnsemblGenomes-Gn; AAur_0884.
DR   EnsemblGenomes-Gn; AAur_0911.
DR   EnsemblGenomes-Gn; AAur_0912.
DR   EnsemblGenomes-Gn; AAur_0913.
DR   EnsemblGenomes-Gn; AAur_0933.
DR   EnsemblGenomes-Gn; AAur_1037.
DR   EnsemblGenomes-Gn; AAur_1270.
DR   EnsemblGenomes-Gn; AAur_1342.
DR   EnsemblGenomes-Gn; AAur_1489.
DR   EnsemblGenomes-Gn; AAur_1490.
DR   EnsemblGenomes-Gn; AAur_1500.
DR   EnsemblGenomes-Gn; AAur_1646.
DR   EnsemblGenomes-Gn; AAur_1647.
DR   EnsemblGenomes-Gn; AAur_1648.
DR   EnsemblGenomes-Gn; AAur_1677.
DR   EnsemblGenomes-Gn; AAur_1812.
DR   EnsemblGenomes-Gn; AAur_1813.
DR   EnsemblGenomes-Gn; AAur_1814.
DR   EnsemblGenomes-Gn; AAur_1815.
DR   EnsemblGenomes-Gn; AAur_1816.
DR   EnsemblGenomes-Gn; AAur_1817.
DR   EnsemblGenomes-Gn; AAur_1818.
DR   EnsemblGenomes-Gn; AAur_1846.
DR   EnsemblGenomes-Gn; AAur_2143.
DR   EnsemblGenomes-Gn; AAur_2356.
DR   EnsemblGenomes-Gn; AAur_2358.
DR   EnsemblGenomes-Gn; AAur_2384.
DR   EnsemblGenomes-Gn; AAur_2385.
DR   EnsemblGenomes-Gn; AAur_2398.
DR   EnsemblGenomes-Gn; AAur_2406.
DR   EnsemblGenomes-Gn; AAur_2429.
DR   EnsemblGenomes-Gn; AAur_2491.
DR   EnsemblGenomes-Gn; AAur_2492.
DR   EnsemblGenomes-Gn; AAur_2514.
DR   EnsemblGenomes-Gn; AAur_2515.
DR   EnsemblGenomes-Gn; AAur_2518.
DR   EnsemblGenomes-Gn; AAur_2618.
DR   EnsemblGenomes-Gn; AAur_2730.
DR   EnsemblGenomes-Gn; AAur_2731.
DR   EnsemblGenomes-Gn; AAur_2848.
DR   EnsemblGenomes-Gn; AAur_2968.
DR   EnsemblGenomes-Gn; AAur_3018.
DR   EnsemblGenomes-Gn; AAur_3019.
DR   EnsemblGenomes-Gn; AAur_3052.
DR   EnsemblGenomes-Gn; AAur_3380.
DR   EnsemblGenomes-Gn; AAur_3690.
DR   EnsemblGenomes-Gn; AAur_3746.
DR   EnsemblGenomes-Gn; AAur_3747.
DR   EnsemblGenomes-Gn; AAur_3748.
DR   EnsemblGenomes-Gn; AAur_3751.
DR   EnsemblGenomes-Gn; AAur_3752.
DR   EnsemblGenomes-Gn; AAur_3753.
DR   EnsemblGenomes-Gn; AAur_4167.
DR   EnsemblGenomes-Gn; EBG00001065369.
DR   EnsemblGenomes-Gn; EBG00001065370.
DR   EnsemblGenomes-Gn; EBG00001065371.
DR   EnsemblGenomes-Gn; EBG00001065372.
DR   EnsemblGenomes-Gn; EBG00001065373.
DR   EnsemblGenomes-Gn; EBG00001065374.
DR   EnsemblGenomes-Gn; EBG00001065375.
DR   EnsemblGenomes-Gn; EBG00001065376.
DR   EnsemblGenomes-Gn; EBG00001065377.
DR   EnsemblGenomes-Gn; EBG00001065378.
DR   EnsemblGenomes-Gn; EBG00001065379.
DR   EnsemblGenomes-Gn; EBG00001065380.
DR   EnsemblGenomes-Gn; EBG00001065381.
DR   EnsemblGenomes-Gn; EBG00001065382.
DR   EnsemblGenomes-Gn; EBG00001065383.
DR   EnsemblGenomes-Gn; EBG00001065384.
DR   EnsemblGenomes-Gn; EBG00001065385.
DR   EnsemblGenomes-Gn; EBG00001065386.
DR   EnsemblGenomes-Gn; EBG00001065387.
DR   EnsemblGenomes-Gn; EBG00001065388.
DR   EnsemblGenomes-Gn; EBG00001065389.
DR   EnsemblGenomes-Gn; EBG00001065390.
DR   EnsemblGenomes-Gn; EBG00001065391.
DR   EnsemblGenomes-Gn; EBG00001065392.
DR   EnsemblGenomes-Gn; EBG00001065393.
DR   EnsemblGenomes-Gn; EBG00001065394.
DR   EnsemblGenomes-Gn; EBG00001065395.
DR   EnsemblGenomes-Gn; EBG00001065396.
DR   EnsemblGenomes-Gn; EBG00001065397.
DR   EnsemblGenomes-Gn; EBG00001065398.
DR   EnsemblGenomes-Gn; EBG00001065399.
DR   EnsemblGenomes-Gn; EBG00001065400.
DR   EnsemblGenomes-Gn; EBG00001065401.
DR   EnsemblGenomes-Gn; EBG00001065402.
DR   EnsemblGenomes-Gn; EBG00001065403.
DR   EnsemblGenomes-Gn; EBG00001065404.
DR   EnsemblGenomes-Gn; EBG00001065405.
DR   EnsemblGenomes-Gn; EBG00001065406.
DR   EnsemblGenomes-Gn; EBG00001065407.
DR   EnsemblGenomes-Gn; EBG00001065408.
DR   EnsemblGenomes-Gn; EBG00001065409.
DR   EnsemblGenomes-Gn; EBG00001065410.
DR   EnsemblGenomes-Gn; EBG00001065411.
DR   EnsemblGenomes-Gn; EBG00001065412.
DR   EnsemblGenomes-Gn; EBG00001065413.
DR   EnsemblGenomes-Gn; EBG00001065414.
DR   EnsemblGenomes-Gn; EBG00001065415.
DR   EnsemblGenomes-Gn; EBG00001065416.
DR   EnsemblGenomes-Gn; EBG00001065417.
DR   EnsemblGenomes-Gn; EBG00001065418.
DR   EnsemblGenomes-Gn; EBG00001065419.
DR   EnsemblGenomes-Gn; EBG00001065420.
DR   EnsemblGenomes-Gn; EBG00001065421.
DR   EnsemblGenomes-Gn; EBG00001065422.
DR   EnsemblGenomes-Gn; EBG00001065423.
DR   EnsemblGenomes-Gn; EBG00001065424.
DR   EnsemblGenomes-Gn; EBG00001065425.
DR   EnsemblGenomes-Gn; EBG00001065426.
DR   EnsemblGenomes-Gn; EBG00001065427.
DR   EnsemblGenomes-Gn; EBG00001065428.
DR   EnsemblGenomes-Gn; EBG00001065429.
DR   EnsemblGenomes-Gn; EBG00001065430.
DR   EnsemblGenomes-Gn; EBG00001065431.
DR   EnsemblGenomes-Gn; EBG00001065432.
DR   EnsemblGenomes-Gn; EBG00001065433.
DR   EnsemblGenomes-Gn; EBG00001065434.
DR   EnsemblGenomes-Gn; EBG00001065435.
DR   EnsemblGenomes-Gn; EBG00001065436.
DR   EnsemblGenomes-Gn; EBG00001065437.
DR   EnsemblGenomes-Gn; EBG00001065438.
DR   EnsemblGenomes-Gn; EBG00001065439.
DR   EnsemblGenomes-Gn; EBG00001065440.
DR   EnsemblGenomes-Gn; EBG00001065441.
DR   EnsemblGenomes-Gn; EBG00001065442.
DR   EnsemblGenomes-Gn; EBG00001065443.
DR   EnsemblGenomes-Gn; EBG00001065444.
DR   EnsemblGenomes-Gn; EBG00001065445.
DR   EnsemblGenomes-Gn; EBG00001065446.
DR   EnsemblGenomes-Gn; EBG00001065447.
DR   EnsemblGenomes-Gn; EBG00001065448.
DR   EnsemblGenomes-Gn; EBG00001065449.
DR   EnsemblGenomes-Gn; EBG00001065450.
DR   EnsemblGenomes-Tr; AAur_0009-1.
DR   EnsemblGenomes-Tr; AAur_0011-1.
DR   EnsemblGenomes-Tr; AAur_0035-1.
DR   EnsemblGenomes-Tr; AAur_0150-1.
DR   EnsemblGenomes-Tr; AAur_0151-1.
DR   EnsemblGenomes-Tr; AAur_0152-1.
DR   EnsemblGenomes-Tr; AAur_0155-1.
DR   EnsemblGenomes-Tr; AAur_0156-1.
DR   EnsemblGenomes-Tr; AAur_0157-1.
DR   EnsemblGenomes-Tr; AAur_0203-1.
DR   EnsemblGenomes-Tr; AAur_0403-1.
DR   EnsemblGenomes-Tr; AAur_0416-1.
DR   EnsemblGenomes-Tr; AAur_0417-1.
DR   EnsemblGenomes-Tr; AAur_0418-1.
DR   EnsemblGenomes-Tr; AAur_0668-1.
DR   EnsemblGenomes-Tr; AAur_0788-1.
DR   EnsemblGenomes-Tr; AAur_0831-1.
DR   EnsemblGenomes-Tr; AAur_0839-1.
DR   EnsemblGenomes-Tr; AAur_0845-1.
DR   EnsemblGenomes-Tr; AAur_0884-1.
DR   EnsemblGenomes-Tr; AAur_0911-1.
DR   EnsemblGenomes-Tr; AAur_0912-1.
DR   EnsemblGenomes-Tr; AAur_0913-1.
DR   EnsemblGenomes-Tr; AAur_0933-1.
DR   EnsemblGenomes-Tr; AAur_1037-1.
DR   EnsemblGenomes-Tr; AAur_1270-1.
DR   EnsemblGenomes-Tr; AAur_1342-1.
DR   EnsemblGenomes-Tr; AAur_1489-1.
DR   EnsemblGenomes-Tr; AAur_1490-1.
DR   EnsemblGenomes-Tr; AAur_1500-1.
DR   EnsemblGenomes-Tr; AAur_1646-1.
DR   EnsemblGenomes-Tr; AAur_1647-1.
DR   EnsemblGenomes-Tr; AAur_1648-1.
DR   EnsemblGenomes-Tr; AAur_1677-1.
DR   EnsemblGenomes-Tr; AAur_1812-1.
DR   EnsemblGenomes-Tr; AAur_1813-1.
DR   EnsemblGenomes-Tr; AAur_1814-1.
DR   EnsemblGenomes-Tr; AAur_1815-1.
DR   EnsemblGenomes-Tr; AAur_1816-1.
DR   EnsemblGenomes-Tr; AAur_1817-1.
DR   EnsemblGenomes-Tr; AAur_1818-1.
DR   EnsemblGenomes-Tr; AAur_1846-1.
DR   EnsemblGenomes-Tr; AAur_2143-1.
DR   EnsemblGenomes-Tr; AAur_2356-1.
DR   EnsemblGenomes-Tr; AAur_2358-1.
DR   EnsemblGenomes-Tr; AAur_2384-1.
DR   EnsemblGenomes-Tr; AAur_2385-1.
DR   EnsemblGenomes-Tr; AAur_2398-1.
DR   EnsemblGenomes-Tr; AAur_2406-1.
DR   EnsemblGenomes-Tr; AAur_2429-1.
DR   EnsemblGenomes-Tr; AAur_2491-1.
DR   EnsemblGenomes-Tr; AAur_2492-1.
DR   EnsemblGenomes-Tr; AAur_2514-1.
DR   EnsemblGenomes-Tr; AAur_2515-1.
DR   EnsemblGenomes-Tr; AAur_2518-1.
DR   EnsemblGenomes-Tr; AAur_2618-1.
DR   EnsemblGenomes-Tr; AAur_2730-1.
DR   EnsemblGenomes-Tr; AAur_2731-1.
DR   EnsemblGenomes-Tr; AAur_2848-1.
DR   EnsemblGenomes-Tr; AAur_2968-1.
DR   EnsemblGenomes-Tr; AAur_3018-1.
DR   EnsemblGenomes-Tr; AAur_3019-1.
DR   EnsemblGenomes-Tr; AAur_3052-1.
DR   EnsemblGenomes-Tr; AAur_3380-1.
DR   EnsemblGenomes-Tr; AAur_3690-1.
DR   EnsemblGenomes-Tr; AAur_3746-1.
DR   EnsemblGenomes-Tr; AAur_3747-1.
DR   EnsemblGenomes-Tr; AAur_3748-1.
DR   EnsemblGenomes-Tr; AAur_3751-1.
DR   EnsemblGenomes-Tr; AAur_3752-1.
DR   EnsemblGenomes-Tr; AAur_3753-1.
DR   EnsemblGenomes-Tr; AAur_4167-1.
DR   EnsemblGenomes-Tr; EBT00001667950.
DR   EnsemblGenomes-Tr; EBT00001667951.
DR   EnsemblGenomes-Tr; EBT00001667952.
DR   EnsemblGenomes-Tr; EBT00001667953.
DR   EnsemblGenomes-Tr; EBT00001667954.
DR   EnsemblGenomes-Tr; EBT00001667955.
DR   EnsemblGenomes-Tr; EBT00001667956.
DR   EnsemblGenomes-Tr; EBT00001667957.
DR   EnsemblGenomes-Tr; EBT00001667958.
DR   EnsemblGenomes-Tr; EBT00001667959.
DR   EnsemblGenomes-Tr; EBT00001667960.
DR   EnsemblGenomes-Tr; EBT00001667961.
DR   EnsemblGenomes-Tr; EBT00001667962.
DR   EnsemblGenomes-Tr; EBT00001667963.
DR   EnsemblGenomes-Tr; EBT00001667964.
DR   EnsemblGenomes-Tr; EBT00001667965.
DR   EnsemblGenomes-Tr; EBT00001667966.
DR   EnsemblGenomes-Tr; EBT00001667967.
DR   EnsemblGenomes-Tr; EBT00001667968.
DR   EnsemblGenomes-Tr; EBT00001667969.
DR   EnsemblGenomes-Tr; EBT00001667970.
DR   EnsemblGenomes-Tr; EBT00001667971.
DR   EnsemblGenomes-Tr; EBT00001667972.
DR   EnsemblGenomes-Tr; EBT00001667973.
DR   EnsemblGenomes-Tr; EBT00001667974.
DR   EnsemblGenomes-Tr; EBT00001667975.
DR   EnsemblGenomes-Tr; EBT00001667976.
DR   EnsemblGenomes-Tr; EBT00001667977.
DR   EnsemblGenomes-Tr; EBT00001667978.
DR   EnsemblGenomes-Tr; EBT00001667979.
DR   EnsemblGenomes-Tr; EBT00001667980.
DR   EnsemblGenomes-Tr; EBT00001667981.
DR   EnsemblGenomes-Tr; EBT00001667982.
DR   EnsemblGenomes-Tr; EBT00001667983.
DR   EnsemblGenomes-Tr; EBT00001667984.
DR   EnsemblGenomes-Tr; EBT00001667985.
DR   EnsemblGenomes-Tr; EBT00001667986.
DR   EnsemblGenomes-Tr; EBT00001667987.
DR   EnsemblGenomes-Tr; EBT00001667988.
DR   EnsemblGenomes-Tr; EBT00001667989.
DR   EnsemblGenomes-Tr; EBT00001667990.
DR   EnsemblGenomes-Tr; EBT00001667991.
DR   EnsemblGenomes-Tr; EBT00001667992.
DR   EnsemblGenomes-Tr; EBT00001667993.
DR   EnsemblGenomes-Tr; EBT00001667994.
DR   EnsemblGenomes-Tr; EBT00001667995.
DR   EnsemblGenomes-Tr; EBT00001667996.
DR   EnsemblGenomes-Tr; EBT00001667997.
DR   EnsemblGenomes-Tr; EBT00001667998.
DR   EnsemblGenomes-Tr; EBT00001667999.
DR   EnsemblGenomes-Tr; EBT00001668000.
DR   EnsemblGenomes-Tr; EBT00001668001.
DR   EnsemblGenomes-Tr; EBT00001668002.
DR   EnsemblGenomes-Tr; EBT00001668003.
DR   EnsemblGenomes-Tr; EBT00001668004.
DR   EnsemblGenomes-Tr; EBT00001668005.
DR   EnsemblGenomes-Tr; EBT00001668006.
DR   EnsemblGenomes-Tr; EBT00001668007.
DR   EnsemblGenomes-Tr; EBT00001668008.
DR   EnsemblGenomes-Tr; EBT00001668009.
DR   EnsemblGenomes-Tr; EBT00001668010.
DR   EnsemblGenomes-Tr; EBT00001668011.
DR   EnsemblGenomes-Tr; EBT00001668012.
DR   EnsemblGenomes-Tr; EBT00001668013.
DR   EnsemblGenomes-Tr; EBT00001668014.
DR   EnsemblGenomes-Tr; EBT00001668015.
DR   EnsemblGenomes-Tr; EBT00001668016.
DR   EnsemblGenomes-Tr; EBT00001668017.
DR   EnsemblGenomes-Tr; EBT00001668018.
DR   EnsemblGenomes-Tr; EBT00001668019.
DR   EnsemblGenomes-Tr; EBT00001668020.
DR   EnsemblGenomes-Tr; EBT00001668021.
DR   EnsemblGenomes-Tr; EBT00001668022.
DR   EnsemblGenomes-Tr; EBT00001668023.
DR   EnsemblGenomes-Tr; EBT00001668024.
DR   EnsemblGenomes-Tr; EBT00001668025.
DR   EnsemblGenomes-Tr; EBT00001668026.
DR   EnsemblGenomes-Tr; EBT00001668027.
DR   EnsemblGenomes-Tr; EBT00001668028.
DR   EnsemblGenomes-Tr; EBT00001668029.
DR   EnsemblGenomes-Tr; EBT00001668030.
DR   EnsemblGenomes-Tr; EBT00001668031.
DR   EuropePMC; PMC1797303; 17114259.
DR   EuropePMC; PMC2944519; 20675469.
DR   EuropePMC; PMC2991359; 21124797.
DR   EuropePMC; PMC4640833; 26555784.
DR   EuropePMC; PMC5640789; 29062941.
DR   GOA; P0CG90.
DR   InterPro; IPR008515; Ubiquitin-like_Pup.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000474.
DR   SILVA-SSU; CP000474.
DR   UniProtKB/Swiss-Prot; P0CG90; PUP_PAEAT.
XX
CC   Source bacteria available from American Type Culture Collection
CC   (http://www.atcc.org) under the accession number BAA-1386.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4597686
FT                   /organism="Paenarthrobacter aurescens TC1"
FT                   /strain="TC1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:290340"
FT   gene            1..1419
FT                   /gene="dnaA"
FT                   /locus_tag="AAur_0001"
FT   CDS_pept        1..1419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="AAur_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09896"
FT                   /db_xref="GOA:A1R0S2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0S2"
FT                   /protein_id="ABM09896.1"
FT                   /translation="MTVDEANHANTVGSSWRRVLSLMEQDDRVSPRQRGFVILAQAQGL
FT                   IGSTLLVAVPNELTREVLQTQVKDALDDALRNVFSDDIRCAIDVDTDLVPVHAEPEPAV
FT                   ELSSVSDFAEPKPQPTPPSTSHEFGRLNPKYIFDTFVIGSSNRFAHAAAVAVAEAPAKA
FT                   YNPLFIYGDSGLGKTHLLHAIGHYARRLYSGIRVRYVNSEEFTNDFINSIRDDEGTSFK
FT                   TTYRNVDVLLIDDIQFLAGKDRTQEEFFHTFNALHNANKQVVITSDQPPKMLAGFEDRM
FT                   TSRFEWGLLTDIQPPELETRIAILRKKGLSEGLSAPDDALEYIASKISSNIRELEGALI
FT                   RVTAFASLNRQPVDVALAEMVLKDLITDDGAQEITAKQILDQTADYFKLSMEELCSKSR
FT                   TRTLVTARQIAMYLCRELTDMSLPKIGQELGGRDHTTVIHADRKIRELMAERRVIYNQV
FT                   TELTNRIKQQQRDS"
FT   gene            1995..3119
FT                   /gene="dnaN"
FT                   /locus_tag="AAur_0002"
FT   CDS_pept        1995..3119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="AAur_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09818"
FT                   /db_xref="GOA:A1R0S3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0S3"
FT                   /protein_id="ABM09818.1"
FT                   /translation="MKFRVDRDVLAEAVTWTARSLSPRPPVPVLSGLLLKAEAGTVSLS
FT                   SFDYETSARLEIPADIAVEGTILVSGRLLADICRSLPSAPVEVETDGSKVTLTCRRSSF
FT                   HLATMPESEYPALPALPAISGTLPGDAFAQAVSQVIIAASKDDTLPILTGVRMEIEDDL
FT                   ITLLATDRYRLAMREVPWKPVTPGISTSALVKSKTLNEVAKTLGGSGDINLALADDDSR
FT                   LIGFESGGRTTTSLLVDGDYPKIRSLFPDSTPIHATVQTQELVEAVRRVSLVAERNTPV
FT                   RLAFTQGLLNLDAGTGEDAQASEELEAQLSGEDITVAFNPHYLVEGLSVIETKYVRFSF
FT                   TTAPKPAMITAQAEADGEDQDDYRYLVMPVRLPN"
FT   gene            3161..4108
FT                   /locus_tag="AAur_0003"
FT   CDS_pept        3161..4108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM PF03807; match to protein family HMM TIGR00872"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08972"
FT                   /db_xref="GOA:A1R0S4"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0S4"
FT                   /protein_id="ABM08972.1"
FT                   /translation="MQATWASPYRLPPPSQKRVHTVHIGLIGLGKMGFNMRERMRNGGI
FT                   EVTGFDRNPDVTDVASVDDLIAALPTPRLVWVMVPSGAITDAVVTELGEKLSPGDMVID
FT                   GGNSRFTEDQKHAAALAEKSIRFADCGVSGGVWGLQNGYGLMAGGADEDIELAMPVFDA
FT                   LRPEGERADSFVHVGGVGAGHYAKMVHNGIEYGLMQAYAEGYELLAAKDIVKDLPGTFR
FT                   AWQKGTVVRSWLLDLMVKALDEDPGLASIDDYVEDSGEGRWTVEEAIANAVPAPAITAA
FT                   LFARFASREDNSPAMKMVSALRHQFGGHATRPAN"
FT   gene            4132..5331
FT                   /locus_tag="AAur_0004"
FT   CDS_pept        4132..5331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0004"
FT                   /product="putative DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07246"
FT                   /db_xref="GOA:A1R0S5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R0S5"
FT                   /protein_id="ABM07246.1"
FT                   /translation="MYLEHLSLTDFRSYAQVDLKLGPGVTVLVGSNGIGKTNLMEAIGY
FT                   LATLSSHRVSTDAPLLRFGTERALIRAKLVRGEQSTVIELEINAGRANRGRINRSNPVR
FT                   ARDILGICQTVLFAPEDLALVKGDPSNRRRFLDELLVSLVPRHAATRSDYDRVLKQRNA
FT                   LLKSARTGKFTAGHEATLDVWDQHMARAGAELLHARLELVERLRPHLNSAYAQLTDASK
FT                   DAGAVYRSTIQGVLDDDGGPTDHGTEPSPSVDDLRLLSVDELTERYVQAFAASRKKELE
FT                   RGISLVGPHRDELELVLGQAPAKGYASHGETWSMCLSLRLASYYVMLDDARTGGTAPIL
FT                   ILILDDVFAELDVHRRRKLAAIVAGAEQVLVTAAVDADIPEELAGRRVTVVPGGIDGEG
FT                   "
FT   gene            5318..5872
FT                   /locus_tag="AAur_0005"
FT   CDS_pept        5318..5872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0005"
FT                   /product="putative protein of unknown function (DUF721)"
FT                   /note="identified by match to protein family HMM PF05258"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10034"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0S6"
FT                   /protein_id="ABM10034.1"
FT                   /translation="MAKDSRDGLQPGREPDEIDAAQAALNRMREAAAARGEVRQRAPRP
FT                   GSAPKRQGLRDTRGFAQFHGSGRDPLGLGKVVGRLVAERGWTSPVAVGSVMAEWETLVG
FT                   PDISSHCTPESFTDTTLHVRCDSTAWATQLRLLSTSLLEMFRNELGEGVVTSIHVLGPS
FT                   APSWRKGGRSVNGRGPRDTYG"
FT   gene            6210..8288
FT                   /gene="gyrB"
FT                   /locus_tag="AAur_0006"
FT   CDS_pept        6210..8288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="AAur_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09523"
FT                   /db_xref="GOA:A1R0S7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0S7"
FT                   /protein_id="ABM09523.1"
FT                   /translation="MANDNAETLAVEPEEETVPKPDTPAEAPREYGASDITVLEGLEAV
FT                   RKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCSHIEVTLRADGGVRVVDDGRGIP
FT                   VDIHPTEGKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSRRVDTEVRRQG
FT                   HVWRMTFADGGKPQGELVKGEATDVTGTSQTFYPDGTIFESTEFDFETLRARFQQMAFL
FT                   NKGLRITLTDERPVNRDGDDDLDLDAVATEGEVAAEHRTVVYQYPDGLLDYVKHLNSSK
FT                   KVEIVHEDVIAFETEDTERHIAVEVAMQWTTAYSESVHTYANTINTHEGGTHEEGFRAA
FT                   MTSLINRYAREKSIIKEKEDNLTGDDIREGLTAVISVKLSEPQFEGQTKTKLGNSEVKG
FT                   FVQRVVTDQLGDWLERNPGPARDVIRKAISAAQARMAARKARDNARRKSPLESFGMPGK
FT                   LSDCSSKDPSRCEVYLVEGDSAGGSAKRGRNPETQAILPLRGKILNVERARLDKALGNA
FT                   EVQSMITAFGTGIGEDFDIAKLRYHKIVLMADADVDGQHITTLLMTLLFRYMRPLIENG
FT                   YVYLAQPPLYRIKWSNAAHDYVYSDRERDETIRKGAAMNKRLPKDNGIQRYKGLGEMDY
FT                   TELWDTTMDPDRRTLLQVTMDDALAADQTFSVLMGEDVESRRNFIQQNAKDVRFLDI"
FT   gene            8351..11020
FT                   /gene="gyrA"
FT                   /locus_tag="AAur_0007"
FT   CDS_pept        8351..11020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="AAur_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07057"
FT                   /db_xref="GOA:A1R0S8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0S8"
FT                   /protein_id="ABM07057.1"
FT                   /translation="MSDETPEVPEPNDVEDVVLEGDVLTDRVEQVDLQTEMQRSYLDYA
FT                   MAVIVGRALPDVRDGLKPVHRRVLYAMFDGGYRPDRSFNKCARVVGDVMGTYHPHGDMA
FT                   IYDALVRLIQDWTMRYPLALGQGNFGSPGNDGAAAPRYTETKMAQLAMEMVRDIDEETV
FT                   DFQDNYDGKNQEPTILPARFPNLLVNGSSGIAVGMATNIPPHNLREVAEGVQWALDNPT
FT                   ATREELLEALLLRIKGPDFPTGATILGHKGIEDAYRTGRGSITMRAVVNVEELQGRTCL
FT                   VVTELPYQANPDNLAIKIAELVKDGKIQGIADLRDETSGRTGQRLVIVLKRDAVAKVVL
FT                   NNLYKHTQLQDNFSANMLAIVDGVPRTLSLDAFIRHWVAHQMDVIARRTRYRLRKAEEE
FT                   AHILRALLKALDMLDEVIALIRASNTTEAAREGLMELLEIDELQARAILDMQLRRLAAL
FT                   ERQKIQDRHSELEAMIQEYNAILASEERQRQIISEELAEIVAKHGDDRRTHILMGFDGD
FT                   MSMEDLIPEEEMVVTITRGGYVKRTRSDNYRSQQRGGKGIKGAQLRGDDVVEHFFVTTT
FT                   HHWLLFFTNLGRVYRAKAYELAEAGRDAKGQHVANLLAFQPDEHIAQVLDLRDYQQAPY
FT                   LVLATKNGLVKKTRLEDYDTNRTAGVIAINLRDEDELVSAQLVSETDDLLLVSRKGQSI
FT                   RFTATDDALRPMGRATSGVTGMKFREDDELLAADVVQDGSFVFIVTEGGYAKRTAVDEY
FT                   RLQGRGGLGIKVAKLAEDRGDLVGALIVQEEDEVLVVMEGGKVVRSAVTGVPAKGRDTM
FT                   GVIFAKPDKNDRIIEVARNSERGLEVEESEDGLDDDVTLAANDGASEATVTAETENDAD
FT                   PEFETGAELNEDNTGGNE"
FT   gene            11017..11736
FT                   /locus_tag="AAur_0008"
FT   CDS_pept        11017..11736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0008"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08148"
FT                   /db_xref="GOA:A1R0S9"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0S9"
FT                   /protein_id="ABM08148.1"
FT                   /translation="MSNSDSYPKPSTGVPGGLRQPAGSAQAGTPARPQQRPGTGAPGTG
FT                   ASGSGAAGARPASGTNSAQRPAGAPGQRPATGAQRPAGAPGQRPVQPGQRPAGTAPQRP
FT                   AQGAPGLVKPAPKAKVRRARLLVSKVDPWSVLKMAFLLSVALGIVTVVAAIVLWTVLDL
FT                   TGIFDQVDSLLGTLAGSEGGGFELKKIASLGQVASFATIIAVVNVVLLTALSMLSAVLY
FT                   NISATLVGGVGVTLTDD"
FT   gene            11850..11923
FT                   /locus_tag="AAur_0009"
FT   tRNA            11850..11923
FT                   /locus_tag="AAur_0009"
FT                   /product="tRNA-Ile"
FT   gene            11965..12090
FT                   /locus_tag="AAur_0010"
FT   CDS_pept        11965..12090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07332"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T0"
FT                   /protein_id="ABM07332.1"
FT                   /translation="MLVKKLLVVVAAVVAGVLAYKKAQESEARKDVWSKSTDTVD"
FT   gene            12161..12236
FT                   /locus_tag="AAur_0011"
FT   tRNA            12161..12236
FT                   /locus_tag="AAur_0011"
FT                   /product="tRNA-Ala"
FT   gene            12349..13290
FT                   /locus_tag="AAur_0012"
FT   CDS_pept        12349..13290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0012"
FT                   /product="Integral membrane protein DUF6 domain protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08819"
FT                   /db_xref="GOA:A1R0T1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T1"
FT                   /protein_id="ABM08819.1"
FT                   /translation="MGNLPPHYGGSVNLLIAALGVLGVASSGPLIAGTLGATSVTALAI
FT                   AFWRNAIGAVVMAGPVVIREPKAFGRITRREFGWSAVAAVALAFHFACFITALQLTSVA
FT                   AATALVCLQSGWIAVFQLFRGTRHRWPVLVGLGIAFGGVVAITGFDMGSSPEALLGDLL
FT                   ALAGGALAGLYTLAGGKARQSMGTGTYTTLCYGMCAAIVAVMALFSGQPLAGFDAGGWL
FT                   GIIAITVCAQLVGHTAFNHLLATMSPLLVSMIILLEIPGAAILAAIFLNETLPAGTYAG
FT                   LALILVGLAVVVSGQRRGRPVADRREAELGAD"
FT   gene            complement(13309..14184)
FT                   /locus_tag="AAur_0013"
FT   CDS_pept        complement(13309..14184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0013"
FT                   /product="glycosyl transferase domain, group 2 family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09288"
FT                   /db_xref="GOA:A1R0T2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T2"
FT                   /protein_id="ABM09288.1"
FT                   /translation="MSADRPLAGALQDAPEPPGVSIVIPAYNEESVIRQCLIAAIYQSV
FT                   PAEEIIVVDNLSTDRTARIVLQMQQEYPESPIILLSQESTQGLIPTRNHGLNNATGDVV
FT                   GRIDADSVLEPDWVEQVQKAFMDPSVAAATGPVVYYDMPMRRFGLKADDKMRQLMLRLA
FT                   KHQYHFLFGSNMALRRSAWETIRDETCLDPKDEMHEDIDLSLHLFEHDLKVQYLPQMVS
FT                   GMSARRLEDSPRDYRYYVQRFDRTYKAHNVKKMALKAPMVVFFSVYFPAKLLRAIHTAN
FT                   SAQGARRGGV"
FT   gene            complement(14329..15300)
FT                   /locus_tag="AAur_0014"
FT   CDS_pept        complement(14329..15300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10238"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T3"
FT                   /protein_id="ABM10238.1"
FT                   /translation="MKKSDRIARELEQSVTAGVDNARDWAAPRVEAAVNWAVPRIQHGI
FT                   DSASPKIQEGLKSAAHNLADGVAVVTPRIQDGLAHLAPKIHDVVEDATPRIQETLNRAT
FT                   PALGHARDKVVDEYLPRLSEQLGQASVAVHHALENAPAQVDAVAQKLVDSGVVHSVQEQ
FT                   AHATGKQIKAVADQASKAVSTTLVKEPKPKKRGWLIVTVIAAAAAAGVAAWKASKPVED
FT                   PWKTPSPVTPTPAPVPATSSTPAPAGASVSATAAVAEPKASDITPEEAAAEAEQATKDA
FT                   FKNVEDSTEKVATDAKTAVKNIAASLQKDTEGKDSDAKGAQS"
FT   gene            15455..15997
FT                   /locus_tag="AAur_0015"
FT   CDS_pept        15455..15997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0015"
FT                   /product="putative peptidylprolyl cis-trans isomerase"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09306"
FT                   /db_xref="GOA:A1R0T4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T4"
FT                   /protein_id="ABM09306.1"
FT                   /translation="MTIATAKATIHTSLGDIKVDLFGNHAPKTVANFVGLATGEKSWNH
FT                   PETGEDKTGTPLYNGTIFHRIIKDFMIQAGDPLGRGVGGPGYQFDDEIHPELTFNAPYK
FT                   LAMANAGIQMGKGTNGSQFFITTVNTDWLFGKHSIFGEVTDEESRKVVDAIESVRTGMG
FT                   DRPVEDVVINSIDIEQL"
FT   gene            16019..16873
FT                   /locus_tag="AAur_0017"
FT   CDS_pept        16019..16873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0017"
FT                   /product="putative rhomboid family membrane protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08661"
FT                   /db_xref="GOA:A1R0T5"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T5"
FT                   /protein_id="ABM08661.1"
FT                   /translation="MSYGIPSAEPSADIPVCPRHPDRPSYVRCQRCGRPACPECQRAAA
FT                   VGFQCVDCVNEQKRTTPTYRSPYGGALAVGRPLVTFVIIGLCALVYVLQWIVPGDAVFE
FT                   DFAFANIFAVSEPWRMVTAAFLHSQGFLLHIVLNMYTLWIFGQALEPLLGRIRFLAVYL
FT                   ISAIGGSVGFLALTPTLPPVGVVGASGAIFGLFGAMLVVQRHRGGETKQLWVLIAINGA
FT                   IGFFVPSIAWQAHLGGLITGGLAAAAIAYAPRGKNQALLQAGGLVLVAGLLAVVTWFRV
FT                   TAG"
FT   gene            complement(16860..17255)
FT                   /locus_tag="AAur_0016"
FT   CDS_pept        complement(16860..17255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07700"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T6"
FT                   /protein_id="ABM07700.1"
FT                   /translation="MVVRRYGVLTSARDKSRWDWTLMNMVPEWITQEHVDMARETVAKK
FT                   GEAPLLEALRLEPLNEGLCVQTLHVGPYDDEGPVLEEMHTKFIPEQSLTMTGRHHEIYL
FT                   GDPRRTAAEKLKTILRQPVLNEPAIQR"
FT   gene            17533..17943
FT                   /locus_tag="AAur_0018"
FT   CDS_pept        17533..17943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08103"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T7"
FT                   /protein_id="ABM08103.1"
FT                   /translation="MCVTYMRVVSLRNRPYARQDGRYPPKGMRFSTSVDNFVPVEREYV
FT                   DKRPIFLAAVDNPVNTAVGSHISTGLSTVLITYTRVVQPVGRAVKPGKAVIWIWKPTRF
FT                   PQLWITCGYGVVVKWVSPQPLSVTRTSLWAGR"
FT   gene            complement(18212..18811)
FT                   /locus_tag="AAur_0019"
FT   CDS_pept        complement(18212..18811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0019"
FT                   /product="putative DNA-3-methyladenine glycosylase I"
FT                   /note="identified by match to protein family HMM PF03352"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09676"
FT                   /db_xref="GOA:A1R0T8"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T8"
FT                   /protein_id="ABM09676.1"
FT                   /translation="MTPDNGTVLGEDGLARPLWAASDTLMQAYYDHEWGMPVRDEQGMY
FT                   ERISLEAFQAGLSWATILRKRDAFRKVFLDFHPESVAAFTEADVERLMLDAGIVRNRLK
FT                   IKAAITNAKATIALRDEGGLVDFVWSFQPENTPTPSTMADIPTTSPESIALSKALRKKG
FT                   FAFVGPTTMYALMEAVGIIDTHLMDSHRRGASGVWT"
FT   gene            complement(18916..19650)
FT                   /locus_tag="AAur_0020"
FT   CDS_pept        complement(18916..19650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0020"
FT                   /product="putative DNA repair protein"
FT                   /note="identified by similarity to SP:P05050; match to
FT                   protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09140"
FT                   /db_xref="GOA:A1R0T9"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0T9"
FT                   /protein_id="ABM09140.1"
FT                   /translation="MSDDALFPLELLQPEGHDAGPRLIAPGAIHVPGWLTLEQQRWIVA
FT                   RFGEWTQGPVPLRAATLPGGHQMSVRTVCLGWHWQPYRYTREATDVNGRPVLDFPDWMV
FT                   RLGRKALEAAYSPGDEGVELDEVTSSLSGLANQYTPDAALVNFYNDGAAMGMHQDKDER
FT                   SSAPVVSLSIGETCVFRFGNTKTRTKPYTDVELRSGDLFVFGGPARFSYHGIPKVLPGT
FT                   APDGCGLSEGRINITMRVTGLS"
FT   gene            complement(19647..20198)
FT                   /locus_tag="AAur_0021"
FT   CDS_pept        complement(19647..20198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0021"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM PF02870; match to protein
FT                   family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08575"
FT                   /db_xref="GOA:A1R0U0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U0"
FT                   /protein_id="ABM08575.1"
FT                   /translation="MASLHARLESDAQLTHTLDIAYRIVDSPLGKLLLAATDRGIIRVA
FT                   FEVEDHQSVLQLLANTVSPRILEAPARLDDAARELDEYFTGARKEFDLTLDFRLSRGFR
FT                   LNVLRHLPRIPYGNTASYAQVAQAAGSPNAVRAVGTACATNPLPLIVPCHRVVKSDGSF
FT                   GGYLGGSEAKRALLRLEAAA"
FT   gene            complement(20276..20788)
FT                   /locus_tag="AAur_0022"
FT   CDS_pept        complement(20276..20788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0022"
FT                   /product="putative RNA polymerase sigma (70) factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07812"
FT                   /db_xref="GOA:A1R0U1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U1"
FT                   /protein_id="ABM07812.1"
FT                   /translation="MVNKKPFEAVVREQGATVLRLCRAILGVHDADDAWSDTFLAALQA
FT                   YPALPAEANVEAWLVTIAHRKCIDHVRAGTRRAMPVDNPPEQPSSLGIPGDGHEELLDA
FT                   VTSLPPKQRQAVAYHYLAGLPYGDIAALLGGTAEAARRAGADGVKSLRSALAIHPSLAH
FT                   TSSKGDI"
FT   gene            complement(20803..21312)
FT                   /locus_tag="AAur_0023"
FT   CDS_pept        complement(20803..21312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0023"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM PF02870; match to protein
FT                   family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07492"
FT                   /db_xref="GOA:A1R0U2"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U2"
FT                   /protein_id="ABM07492.1"
FT                   /translation="MSSRHTTLDSPLGQLTLTARGEVLTGIFYDGHWHMPPPDYFGDPA
FT                   GIEDPVFARTRTELAEYLDGHRTVFDVPFQALGNPFQEKVWERLQHIPFGETVSYGQLA
FT                   AEFGDPHLAQAVGSAVGRNPISIIIPCHRVVGRNGQLTGYAGGLRNKRFLLELEEPAEV
FT                   REGKLF"
FT   gene            complement(21358..21792)
FT                   /locus_tag="AAur_0024"
FT   CDS_pept        complement(21358..21792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0024"
FT                   /product="hypothetical UPF0233 membrane protein"
FT                   /note="identified by match to protein family HMM PF06781"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06685"
FT                   /db_xref="GOA:A1R0U3"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U3"
FT                   /protein_id="ABM06685.1"
FT                   /translation="MRHKVSLHRARAAWADPRLRLDLTARTNPERRVAVNRWKFPSCRI
FT                   SRLAGRVLTEQPGGSVPESKPRKRPARQAQQTSAAQQYKPNPVWYKAVMFGLMILGLIW
FT                   IITFYITEGQLPIREWASWNIVAGFGIAIVGFLMTTRWRS"
FT   gene            21769..22599
FT                   /locus_tag="AAur_0025"
FT   CDS_pept        21769..22599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0025"
FT                   /product="putative sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06375"
FT                   /db_xref="GOA:A1R0U4"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U4"
FT                   /protein_id="ABM06375.1"
FT                   /translation="MQGDLVAHQQQTAVSAVPSARHGQELRPRKRLRASDVIRKISQIL
FT                   GELLITAGIVLLLFVGWELWWTNVEADAKQTEAVKSFAQDFSGPITPAAPAAAPVDYGP
FT                   PVVTPAPAYAGMIGIIYIPRFGPDYTRPIIEGTGSDVLDTLGLGHYGSTTMPGAPGNFA
FT                   VAGHRQTHGAVLDNIHTLVPGDKIYIQTADGYYTYVFRNNQIVLPDRTDVLMPVPTQPG
FT                   VQPTESILTMTSCNPRFGAQERIIAYSMLDSWQPASAGPPSEIAAQVARAHGKG"
FT   gene            22603..22773
FT                   /locus_tag="AAur_0026"
FT   CDS_pept        22603..22773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09636"
FT                   /db_xref="GOA:A1R0U5"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U5"
FT                   /protein_id="ABM09636.1"
FT                   /translation="MYAWIFRNLPGPLWVRILTSLVLVGVALVLMVEFLFPWFSQFTTL
FT                   TDSTIGSVQQP"
FT   gene            22770..23411
FT                   /locus_tag="AAur_0027"
FT   CDS_pept        22770..23411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0027"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09097"
FT                   /db_xref="GOA:A1R0U6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U6"
FT                   /protein_id="ABM09097.1"
FT                   /translation="MSTTKILVVDNYDSFVYTLVGYLQELGAETTVVRNDDVTLAEATE
FT                   LAATRDGVLVSPGPGTPAEAGVCIELIKWCGEAAKPMFGVCLGHQALAEAYGGVVTHAP
FT                   ELMHGKTSPVRHEGKSVFAGLPSPVTATRYHSLAAVRDSIPDVLEITAETTNGVVMGLQ
FT                   HKTAPLCGVQFHPESVLTEGGYQMLGNWLESLGMTGAAERASKLSPLIKQ"
FT   gene            complement(23514..25427)
FT                   /locus_tag="AAur_0028"
FT   CDS_pept        complement(23514..25427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0028"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08627"
FT                   /db_xref="GOA:A1R0U7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U7"
FT                   /protein_id="ABM08627.1"
FT                   /translation="MSTSRPGPAHREESTPVSSQRILNSRYELGELIGRGGMADVYRGT
FT                   DTLLGRTIAVKVLRADLARDPQFQARFKREAQAVAALNHPSIVAIFDTGEYSVPGGPGE
FT                   DVRVPYIVMEYVAGRTLRDMIKANELGVEDSVGFTLGVLGALEYSHRAGIVHRDIKPAN
FT                   VMVCADTGDVKVMDFGIARAMADSAATMTQTQAVVGTAQYLSPEQARGETVDARSDLYS
FT                   AGCLLFELLTSRPPFIGDSPVSVAYQHVRETPDLASAHNPEVSEALDSVLVKALQKSRT
FT                   DRFQDAAAFRRALRAASNGIPVPAVAASEAPTDPNDLVDPEDPATELLSTTAVGFLDAD
FT                   QFKDEPTDQPQEEPLPLGLPPEREVPERQKSRRRAWVATLVIFTVLVLAGGGFWLYSLM
FT                   NMQPPPPAKIAVPVVTNMSESQAIQALYSAKLKPTSVREPSDTVAKDMTIGTSPIAGAM
FT                   LEQDAEVVLKISSGPSSVTIPADIVGRTEPDAREALRRLGITGEVVTALTHSPTVPAGV
FT                   VLGTAPAPGGAIAVESKVELQVSTGKVLMPQLIALPAAEAEAALKANGLNIAIVEQENS
FT                   QVAAGTVTAQSDAFNTEVAQGKVVTVTVAKAPAPVPTPTPTPTPTETEKPTPKPTPTPT
FT                   KK"
FT   gene            complement(25438..27279)
FT                   /locus_tag="AAur_0029"
FT   CDS_pept        complement(25438..27279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0029"
FT                   /product="putative serine/threonine kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09017"
FT                   /db_xref="GOA:A1R0U8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U8"
FT                   /protein_id="ABM09017.1"
FT                   /translation="MRPTSGITLGGRFQLTSRIAIGGMGEVWKAKDQILGRIVAIKVLK
FT                   EEYTGDPGFLQRFRAEARHTALLNHVGIANVFDYGEEAGSAYLVMELVPGHPLSGILER
FT                   EQVLSPDMTLSIISQTARALAVAHAQGLVHRDIKPGNLLITPDNRVKVTDFGIARLADQ
FT                   VPLTQTGQVMGTAQYLAPEQATGQTATGSSDIYSLGVIGYECLTGHRPFSGESQIAIAL
FT                   AQVNDAPPPLPETLPTPVRALLMSMLAKDPKNRPANAIKLAEAAEAIRNGDIATAHAAV
FT                   PGMLLFESTTGPITAPVDTATAPTGVVTSPYGKEQSTTATSALPVLGAGAAGAALGAAA
FT                   ASDNPLTRANALEAERQLSDDEEVVYTDDENYDDAEPERKKRSPWTWPLVALILLVLFA
FT                   LVGFLISQSGFFSPSPAPSESTTTSASRSASPTSASATPTPRPTETSEAPQPTQSVPQK
FT                   INVIPEQYQGQPFETVSAQLRALGLGVDGQEVFDDTAPVGIVTGLNPTGPVNPGETITV
FT                   TYSKGPELVAVPAIAPGVDEARVQQAIEGAGLQWVAGEPVNGAIGQQPGTFVRSSPAAG
FT                   SQVAAGSTVTYYLSKELVPIDPGTSTATPTGTGSPSR"
FT   gene            complement(27276..28733)
FT                   /locus_tag="AAur_0030"
FT   CDS_pept        complement(27276..28733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0030"
FT                   /product="penicillin binding protein transpeptidase domain"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08431"
FT                   /db_xref="GOA:A1R0U9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0U9"
FT                   /protein_id="ABM08431.1"
FT                   /translation="MNQAIRSSWMAAVAMFALIFGAISYVQVIGADDLNANPWNQRAVL
FT                   ASFCNERGSIIVGGKPVAESVPGTESCAFQRKYNQPELYAGITGYFSKFFGSTGLEQSM
FT                   GETLAGNSDQLFLDRMSQMFLGKEPKGASVELTLDPAIQQLAMDLIPEGQRGSIVVTNP
FT                   KTGAILAMASKPTYDPNLIATHDRTTAEANYAQLNQIPGINLNQNVSGPTGNLLSPGSV
FT                   FKIIDTAAALNSGKYNKDSELPNPSSLPLPGSSASLPNYAGGNCNVRETASFAFALEQS
FT                   CNTPFASIALDLGQDAIREQAQKFGFGQDFGDQLKLQQATSIFPEDLDQAQLAQSSVGQ
FT                   RDVKATPLQINLMTAAIANGGVQMKPNLVEAIRAPDLRVINEPKPEALRTSTTQPIASQ
FT                   ITEWMTSAVDNGIAKGAAVPGVKVAGKTGTAELGDSGLNNSWFTGFAPANDPQVAVTIV
FT                   MESVDVQTGAQLTSPNAKKIFEAVLNK"
FT   gene            complement(28730..30160)
FT                   /locus_tag="AAur_0031"
FT   CDS_pept        complement(28730..30160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0031"
FT                   /product="putative cell division protein FtsW"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06271"
FT                   /db_xref="GOA:A1R0V0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V0"
FT                   /protein_id="ABM06271.1"
FT                   /translation="MMQTEIAPKPRRNVELVLIVLALAVGIGASALVSINSEVGLDSDF
FT                   WFQSSLLAVAAFAFHIVLRLRAKYADPVILPIVVALNGLGLALIHRMDGPGDDTGNNQL
FT                   RWTLIAMAVSIAVIWFLKDHRILRRFTYISLAASAFLLVLPLIPGISAGEILGARVWIR
FT                   VGPMTFQPGEIAKITLAIFFAGYLSSNRDLILLAGRKIGPMQFPRFKDLGPMITAWLVS
FT                   IGVLVFQRDLGSSILFFGLFIVMIYVATSRISWVVIGLLLILGGGFIASQIFSHVAFRI
FT                   DSWINAFTPEVFGRSPGGSGQIVEGLFGMADGGLVGTGLGQGRPDLVPFANSDMIVALI
FT                   GEELGLIGLFAVVMLYLLLFTRGFRAALGTRDAFGKLLACGLSFAIALQCFVVIGGVTR
FT                   LIPLTGLTTPFLAAGGSSLLANWIIVGLLLMISNTARGPVDTTPMVNKPPASSSTPGSR
FT                   KPATGQTPSAPTEAVKQQ"
FT   gene            complement(30157..31809)
FT                   /locus_tag="AAur_0032"
FT   CDS_pept        complement(30157..31809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0032"
FT                   /product="Protein phosphatase-domain"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07710"
FT                   /db_xref="GOA:A1R0V1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V1"
FT                   /protein_id="ABM07710.1"
FT                   /translation="MRYAARSDVGRIRSKNDDSAYVGRHLAVVADGMGGHAGGDVASAS
FT                   TVLDMIHLDHDDYPEGAETVLADEIQTANSLLSELVHQNPKLSGMGTTVTALLLEGRKL
FT                   HFAHIGDSRAYRLRNNKFEQVSIDHTFVQRLIDEGRLRPEEAETHPHKNVLMRVLGDVD
FT                   ASPELDLDVLDVEPGERWLLCSDGLNYVAGHVVERMVRETKDLHECAEILVALTLEAGA
FT                   PDNVTVVMLEIAEETDDDVNTAAVDIVPAAALAAVDEPEAVTATKSADDLSADKAAEDT
FT                   KADSQAKAAREADAGSSFSAGDPGDSKDDAASSDESKEPPATTDPHLGEHLSAEVLREE
FT                   LASRPHELVGAAATAAETGSIPTVAGRTVARRAATVLTHKAEQDRVEVEEPARRRVRWL
FT                   MPAVAAVVVLGVVVGLWLGYAWTQTRYYVGEYDQRVAIFNGISQRLGPIQLSRLEAVTD
FT                   IRVDSLPEYGQQSVRQTVPAGDLNGAQGIVENLRNTGSASANCPSPSPTASASGSATTT
FT                   PTPTPTATVPIPSTAAVASPTPSPVPTPCEAAK"
FT   gene            complement(31870..32358)
FT                   /locus_tag="AAur_0033"
FT   CDS_pept        complement(31870..32358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0033"
FT                   /product="putative FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06842"
FT                   /db_xref="GOA:A1R0V2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V2"
FT                   /protein_id="ABM06842.1"
FT                   /translation="MNDISELTITALRFGFLLLLWVLIFSIVTTMRRDFQIGRKAVTGV
FT                   PTAREVRKHPELAASPPPAIQHARTLVVTEGPLKGTTVPLAASPILLGRAQEATLVLED
FT                   DYASGRHARLFPQGSRWFIEDLGSTNGTYLADQQLTRALPVELGVPVRIGKTVIELRP"
FT   gene            complement(32355..33098)
FT                   /locus_tag="AAur_0034"
FT   CDS_pept        complement(32355..33098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0034"
FT                   /product="putative FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09078"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V3"
FT                   /protein_id="ABM09078.1"
FT                   /translation="MGLLDKVERGIEKAVRNVFSTGSRARVEPVEIASKLRRELDNKSI
FT                   TIAAGRTLAPNVFDVLLSDEDFARAQEWGTPLAEELCDVVIQHVRSQGYTLQGAVRISF
FT                   RRNDEERAGHFEINSRTEKSSDDAAPQAPRAHVPAAPARKPTRLQPVLDIGGQRYSLNA
FT                   LSVVLGRSSEADILVDDTGVSRKHLEVRTENGSTWAVDLGSTNGSYVNGHKVNGSVELT
FT                   DGSTITMGRTKIIFRLLPQTPGGHA"
FT   gene            33474..33556
FT                   /locus_tag="AAur_0035"
FT   tRNA            33474..33556
FT                   /locus_tag="AAur_0035"
FT                   /product="tRNA-Leu"
FT   gene            complement(33757..34455)
FT                   /locus_tag="AAur_0036"
FT   CDS_pept        complement(33757..34455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0036"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08629"
FT                   /db_xref="GOA:A1R0V4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V4"
FT                   /protein_id="ABM08629.1"
FT                   /translation="MSRNLTADLAADLRNRIVDGVIQPGEKLPSENTLISEFGVSRTVV
FT                   RSALTRLQAEGLVETERGRGSFALTPPSDGPTPAPGTRAVASIEERLQMLDFRIAVETE
FT                   AAALAARNHSERQLKAAHGALEQFIASSGHPAHSMKADFEFHRAVAAATGNPFYTDCIS
FT                   ALGQTMITMPRPRLVSDDEQDSRGRFEQVVHEHSSIYAAIAEGDAVAAAAAMRLHLSNS
FT                   RRRFTGTARS"
FT   gene            complement(34466..35593)
FT                   /gene="clcB"
FT                   /locus_tag="AAur_0037"
FT   CDS_pept        complement(34466..35593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcB"
FT                   /locus_tag="AAur_0037"
FT                   /product="mandelate racemase"
FT                   /EC_number="5.1.2.2"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09978"
FT                   /db_xref="GOA:A1R0V5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR033978"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V5"
FT                   /protein_id="ABM09978.1"
FT                   /translation="MSTVDLIRHVKLSTARLPLTVPISDAKVFTGRQKPMTEVVFLFAE
FT                   ITTEQGHSGIGFSYSKRAGGPAQYAHAKEVAEGIIGEDPNDIGKIYTKLLWAGASVGRS
FT                   GVATQALAAIDIALYDLKAKRAGLPLAKLLGSYRDSVQTYNTSGGFLNATLDEVKARAS
FT                   QSIEEGIGGIKIKVGLPDSKEDLRRVAGIREHIGWDVPLMVDANQQWDRATALRMGRQL
FT                   EEFNLIWIEEPLDAYDFEGHAHLAQVLDTPIATGEMLASVAEHKGLINANGCDIIQPDA
FT                   PRVGGITQFLRLAALADERGLGLAPHFAMEIHLHLAAAYPREPWVEHFDWLDPLFEERL
FT                   ETKNGRMIVPDRPGLGVTLSDQARAWTTDSVEFGA"
FT   gene            35644..35898
FT                   /locus_tag="AAur_0038"
FT   CDS_pept        35644..35898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0038"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:CAB66283.1"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08618"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V6"
FT                   /protein_id="ABM08618.1"
FT                   /translation="MYLYYKSSGLVVAAAETSHSHLFPGAVVKVRGSGMELVVTFSDGA
FT                   TAAAEIVDDGGKPALVVEAYTTGAGKEITRNVVCVCCFC"
FT   gene            complement(36339..36851)
FT                   /locus_tag="AAur_0039"
FT   CDS_pept        complement(36339..36851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0039"
FT                   /product="putative D-mannose binding-like domain"
FT                   /note="identified by match to protein family HMM PF01453"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09103"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR036426"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V7"
FT                   /protein_id="ABM09103.1"
FT                   /translation="MRKQVTRRKRMVTALGSGVLALSLLGGLGVQPASAATGSSWGFLP
FT                   CYRTGQSIGIVPDWSLMYSPGNFCLVNGPYKAVFQSDSNFVVYKNGTALWHTRTNGKNA
FT                   KMLALQHDGNIVVYGQSMNVLWQSGTPGLSSGSTRALRMQSDGNFVMYHNSGSSARAVW
FT                   QTQTYGR"
FT   gene            37395..37970
FT                   /locus_tag="AAur_0040"
FT   CDS_pept        37395..37970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0040"
FT                   /product="putative RNA polymerase sigma (70) factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07762"
FT                   /db_xref="GOA:A1R0V8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V8"
FT                   /protein_id="ABM07762.1"
FT                   /translation="MGMSYLSRAPDREEAFRALYKSAYADLLKFVQRRTEVANAEDVVA
FT                   EAFLIVWRRFSETPKHEDEARAWIFGITRNLMLNAHRGEQRRQALGVRLAETSTQTHTA
FT                   SHADAVSSRVDLGRAWELLSEVHQEALGLAIFENMTAPQAAHVLGISPVAFRLRLTRAR
FT                   RALRLLLDHVPRHESPAPATFPERASTP"
FT   gene            37967..38791
FT                   /locus_tag="AAur_0041"
FT   CDS_pept        37967..38791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07359"
FT                   /db_xref="GOA:A1R0V9"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0V9"
FT                   /protein_id="ABM07359.1"
FT                   /translation="MKDTQNIDTLLRSMDAAEQNKPTDPRRSQKDLELILRSHPAPAAK
FT                   GIRPAEHQTSTSFPSRRRRRTLALGAFAFATTVGFLIGPTLSGGDPAFATWTAVPGALV
FT                   GAERNSAVSDCAKSSKGVGDGMFVTDVAAAEVAIAERRGAWTTVVLSGADGFEATCTTD
FT                   STAPWFKRGSFGSVGKPGNGHELAAREIRTTQLGTGVIADNPLSIASGQVGPEVIAMTY
FT                   TDIAGERITATVSKGQFAFWLPGGELENPSEQDVPVEVTYTDNTREIRYLSL"
FT   gene            complement(38817..39533)
FT                   /locus_tag="AAur_0042"
FT   CDS_pept        complement(38817..39533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0042"
FT                   /product="tetracycline repressor protein (TetR family)"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF02909"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06491"
FT                   /db_xref="GOA:A1R0W0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W0"
FT                   /protein_id="ABM06491.1"
FT                   /translation="MLGTQAAERPPMPAPTPAPSALPAGSVRRRAGRPTAAILDQDGIT
FT                   TAALELISSKGYDGLTMAALARSLGVAPSALYNHVASKDDVLLLVEDHLAAMVDVSAFG
FT                   VEAWDVAVRRWAWSYRDVFSEHTPLIPVIAVLPVANAPKTLAMYEAVTAGFRDDGFPEE
FT                   KIISAIVALEAFVFGAAYDVTAPEDIFDAGSLAEQVPNFTAAVDRLAAEKHTRPTDVAF
FT                   SLGLEALITGFGALRE"
FT   gene            39640..41016
FT                   /gene="puo"
FT                   /locus_tag="AAur_0043"
FT   CDS_pept        39640..41016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puo"
FT                   /locus_tag="AAur_0043"
FT                   /product="putrescine oxidase"
FT                   /EC_number="1.4.3.10"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06930"
FT                   /db_xref="GOA:A1R0W1"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:3RHA"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W1"
FT                   /protein_id="ABM06930.1"
FT                   /translation="MQNLDRDVVIVGAGPSGLTAARELKKAGLSVAVLEARDRVGGRTW
FT                   TDTIDGAMLEIGGQWVSPDQTVLMELLDELGLKMYSRYRDGESVYIGADGKRTQYTGDT
FT                   FPVNETTKAEMDKLVAILDELAAEIGPTEPWAHPKARELDTISFHHWLRQNSNDEEACN
FT                   NIGLFIAGGMLTKPAHAFSALQAVLMAASAGSFSHLTDEDFILDKRVIGGMQQVSLLQA
FT                   AELGDDVVLNSPVRTIKWDENGVSVVSERATVNARFVIMAVPPNLYSRVSFDPPLPRRQ
FT                   HQMHQHQSLGLVIKVHAVYDTPFWREEGLSGTGFSAGALVQEVYDNTNHGDSRGTLVGF
FT                   VSDEKADAVFELSAEDRKKAILESIAGFLGDKALTPEVYYESDWGSEEWTRGAYASSYD
FT                   LGGLHRYGKDQHANVGPIYWSSSDLAAEGYQHVDGAVRMGQATAARIVEANKLASVPVA
FT                   "
FT   gene            41107..42003
FT                   /locus_tag="AAur_0044"
FT   CDS_pept        41107..42003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0044"
FT                   /product="putative universal stress family domain protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07022"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W2"
FT                   /protein_id="ABM07022.1"
FT                   /translation="MRYVVGYTANARGHDAVHLAVALARNHDVSLDLVLVIPEDSPFNA
FT                   VYPPEAGYNDILNEQAQRWLDEGLALVPADVTARAHIRRGDSEARTLIDAAVEMDAAAL
FT                   VIGATNDGLFKRFTIGSVASSLLHSSPVPVALAPHGYRRTEPITRLSCGFGTRPGADEL
FT                   LDVAVESARDRGLPLRLVSLLALDGGNSPQLLDAAWMHAADRLAAVGSSVDADGSADAT
FT                   AAGSLQGEPEIVVAQGRKIEEAVDRLDWEDGEILLIGSSRLAQQRATFLGTTANRILRA
FT                   LPVPMIVVPRDYTRQSS"
FT   gene            42027..43529
FT                   /locus_tag="AAur_0045"
FT   CDS_pept        42027..43529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0045"
FT                   /product="putative amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08186"
FT                   /db_xref="GOA:A1R0W3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W3"
FT                   /protein_id="ABM08186.1"
FT                   /translation="MSTAPKTVQSKETSLSEKGLKAGSVGLIGAVVIGVSCIAPAYTLT
FT                   AALGPTVSEVGVHLPAIFLVGFIPMLLVALGYRELNNAMPDAGTSFTWATRAFGPWIGW
FT                   MGGWGLIAATIIVLSNLAAVAVDFFYLMLAQIFSNPELGELSKILPLNIATTLVFIALA
FT                   CWISYRGMETTKGVQYVLVAFQLLVLGWFAVSAFAHVANGTAFDATAISPDWFNPFAVD
FT                   SFSQFAAGVSLSIFIYWGWDVTLTMNEETKNPEKTPGRAATITVLVIVIIYMTVALATL
FT                   SFAGVGETGLGAGNPENQSSIFAVLAGPVMGPFAILMSLAILSSSAASLQSTFVSPART
FT                   MLAMGHYRAISPRFGRISPTFKSPSFATIAAAIAAAGFYVITRTVSENALWDTITALGM
FT                   MICFYYGITALACVWFFRAEAFRGARAFFFKFLAPLVGGVILLVMFVKTAMDSMDPEYG
FT                   SGSSVGGVGLVFVLGMGVILLGVVVMLVMYRLRPEFFKGKVL"
FT   gene            complement(43535..44092)
FT                   /locus_tag="AAur_0046"
FT   CDS_pept        complement(43535..44092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08997"
FT                   /db_xref="GOA:A1R0W4"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W4"
FT                   /protein_id="ABM08997.1"
FT                   /translation="MPAMMLLWGVALVLATAATTYVLHRKLTHGRGPEPDGVFWDVFGG
FT                   LVVIAPAILVPTVQWSPAGLIMVFVGIATAAGTVVSIRKVERIRAAEPRRRAGFPDDAA
FT                   RHESILERWRRYELDPAKTIDFPAMTDVRSAETAALTRAMREAEYCKMTAGTDYRAAVE
FT                   RLAEALAAAERAAGVPALPAPR"
FT   gene            44207..44644
FT                   /locus_tag="AAur_0047"
FT   CDS_pept        44207..44644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0047"
FT                   /product="putative glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09311"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W5"
FT                   /protein_id="ABM09311.1"
FT                   /translation="MRVIAARALSDPGRSLGTMRLKMCSIHVKDPAAAHVFYTETLGFE
FT                   TLMAMPEYNLFIIKDPGADNSSSPGLLLEPSDNPIASNYMNALHESGLAAITFGVPDVQ
FT                   AEYERLLAAGVKFQGEPSEDPSGVSAVFDDGCGNFIQLHQD"
FT   gene            complement(44700..45149)
FT                   /locus_tag="AAur_0048"
FT   CDS_pept        complement(44700..45149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09903"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W6"
FT                   /protein_id="ABM09903.1"
FT                   /translation="MTSSNSQSMKPATVAKKLGIYLPATPQEFQDSSISREEFAELQAN
FT                   PPEWLAELRRNGPHPRPVVAHKLNISISGLARGGVEEALTTTEITELLQAPPQWLVTER
FT                   ATHAAVRSEAQRVKDEAAKKAATKEARDNAAAKRDAPKTSKRDHA"
FT   gene            45255..45908
FT                   /locus_tag="AAur_0049"
FT   CDS_pept        45255..45908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0049"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07242"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W7"
FT                   /protein_id="ABM07242.1"
FT                   /translation="MTPGKWIRRWEERMPNFPLHSFMSDDAAQVSVLRDGSADLSFVRL
FT                   PVDREGLNVIPLYEEQPVVVAPKGHEISVFEEVALEDLAEENFLDVDEMGGPDMALQVV
FT                   ASGAGLVIMPMSVARHLNAKDTVMRRLTGAPGTQIGLAWLLGTDSPVIEEFIGIVRGRT
FT                   AQSSRQPSAQQEKPKKAPKPDRRGGGPKKPAVAQRYAPNPDKGRGKGSRKKGKR"
FT   gene            complement(46016..46714)
FT                   /locus_tag="AAur_0050"
FT   CDS_pept        complement(46016..46714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0050"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07609"
FT                   /db_xref="GOA:A1R0W8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W8"
FT                   /protein_id="ABM07609.1"
FT                   /translation="MAGADQDSSEHAGFDSARARVRMKVPSVAERVAEELRYQLAEGFL
FT                   VPGAKLTEATIAEDLGVSRNTVREAFAELAGERLLLRQPNKGVFVATLEAGDIHDVYTV
FT                   RRAIEVSSIRAGGSPERIAAVRAAVEEGKRAAAANDNEGLGSANQHFHGAIVALAESNR
FT                   LNTIMAQILAEMRLYFHKATMNAHFYSDWLKENEQICSALEAGERERAGDLLLAYLNRS
FT                   EQQQTAIHGE"
FT   gene            46896..47582
FT                   /locus_tag="AAur_0051"
FT   CDS_pept        46896..47582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0051"
FT                   /product="putative LamB/YcsF family protein"
FT                   /note="identified by match to protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08447"
FT                   /db_xref="GOA:A1R0W9"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0W9"
FT                   /protein_id="ABM08447.1"
FT                   /translation="MFESVSSANVACGFHAGDPSVIRSTCEKAAKAGVVIGAHVGYRDL
FT                   AGFGRRFMDIDPMELADDVVYQIGALQALAATTGASVQYVKPHGGLYNAIVKHTAQARA
FT                   VVDAVKSVDPNLPILGLPGSEVLRLAEEAGLRAVSEAFADRAYNPDGTLVSRSQPGAVL
FT                   HDPAEVAEHVLRMATEQSVKTVDGSILKIRAESICVHGDSPGAVAMATAVKSALADADV
FT                   SIGSFL"
FT   gene            47630..48979
FT                   /locus_tag="AAur_0052"
FT   CDS_pept        47630..48979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0052"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06639"
FT                   /db_xref="GOA:A1R0X0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X0"
FT                   /protein_id="ABM06639.1"
FT                   /translation="MTSTNNAAKAATRKPPPGAIKAYVASLTGTSLEYYDFAIYSVASA
FT                   LVFPKIFFPGNDEFVALLLSFSAFAVGYLARPIGGVIFGRLGDKIGRKYVLVFTLVLIG
FT                   VATVLIGALPDYSVIGVAAPTILVLLRLAQGIGVGGEWGGAVLLSSEFGDPNKRGFWSS
FT                   AAQIGPPAGNLMANGVLAILAASLSEEAFLSWGWRVAFLASALLVVFGLIIRLKLEETP
FT                   VFKAIQAHGDRPKAPIKEVFTTQPKALVAAALSRVCPDILYALFTVFVAVYATKELGMT
FT                   TGNVLSAILIGSAFQLFLIPLAGALTDRFNRRWVYGIAAAATAAYIPLFFLMIQGKSVA
FT                   MLTIGTVIGLALHAFMYGPQAAFITEQFPARLRYAGSSLAYTLAGVIGGAVAPIIFTAL
FT                   YGAAGGGWYLIAGYILLAAIVTIVGMLLGRDPKPEEDVRLMQGTHAQPAA"
FT   gene            48986..50650
FT                   /locus_tag="AAur_0053"
FT   CDS_pept        48986..50650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0053"
FT                   /product="putative urea carboxylase/allophanate hydrolase
FT                   domains protein"
FT                   /note="identified by match to protein family HMM PF02626;
FT                   match to protein family HMM PF02682; match to protein
FT                   family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08131"
FT                   /db_xref="GOA:A1R0X1"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X1"
FT                   /protein_id="ABM08131.1"
FT                   /translation="METVMQTTTAKRVRSVRPVGTRAVLAELDGLQDVLALQDMLYKSP
FT                   LPGQVDVLAAAETVMVVGESAAATRTIGARLMELELTAPEVTDSGLVVIDTVYDGDDLA
FT                   DVAELTGLSTEGVVAAHTGQIWTVAFAGFAPGFGYMVGENEALTVPRRSSPRTAVPAGS
FT                   VALGGQYSAVYPRRSPGGWQLIGRTGARMWDLNRSQPALVRPGDRVQYRAVREVVTTSD
FT                   TPAREPEKEHHTESGLRILNPGAQSLIQDLGRRGFGPLGVSAAGALDRASLRRANRLVG
FT                   NASSAAAIESVNGGLTVEAVGDQVIAVTGAPTTLTIESPSWVGSDDDDGGARPGGKRTV
FT                   PMAAPFALLDGELLTLGAPESGFRNYVAIRGGVDAPEVLGSRSADTMSGIGPAPLAIRQ
FT                   VLATGEQTASTAVGAPELQPDFPGAGVTVLDVVPGPRADWFDQEALDSLCNQEWLVTPQ
FT                   SNRVGMRLDGKPLERTREGELPSEGTMAGALQIPPAGLPVLFLADHPITGGYPVIGVVR
FT                   DEHLDRAAQVPIGGRIRFRLVPDSADFTTTTTKTPEK"
FT   gene            50658..52418
FT                   /locus_tag="AAur_0054"
FT   CDS_pept        50658..52418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0054"
FT                   /product="putative Acetyl-CoA carboxylase alpha chain"
FT                   /note="Includes: Biotincarboxylase (EC 6.3.4.14); Biotin
FT                   carboxyl carrier protein (BCCP); identified by match to
FT                   protein family HMM PF00289; match to protein family HMM
FT                   PF00364; match to protein family HMM PF01071; match to
FT                   protein family HMM PF02222; match to protein family HMM
FT                   PF02785; match to protein family HMM PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07536"
FT                   /db_xref="GOA:A1R0X2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X2"
FT                   /protein_id="ABM07536.1"
FT                   /translation="MRKVLIANRGEIAVRVARACDDAGIQSVAVYADIDADAMHVGAAD
FT                   EAFSLGGNSPADTYLNIEKLLAVAEQSGADSVHPGYGFLSENADFAQAVLDAGLEWIGP
FT                   SPESIRQLGNKITAREIAVRAGAPLVAGSDGPVSSAAEARAFAEEHGLPLAIKAAFGGG
FT                   GRGLKVVRELAEVEEAFDSAVREAVAAFGRGECFVEQYLDRPRHVEAQVIADKLGNVIV
FT                   VGTRDCSLQRRHQKLVEEAPAPFLSDTQRQKIYEGSKAIIREAGYYGAGTVEFLVSADG
FT                   AVAFLEVNTRLQVEHPITEETAGIDLVQEQFRIAAGLPLSISEDPTPRGHSFEFRINAE
FT                   DVGRGFLPSPGTVASFEAPTGPGIRIDTGVRSGSFVAPQFDSLLAKLIVTGADRQQALR
FT                   RARRALAEIKITGLATVLPFHRAVLESDDFTSVAGLRVHTRWIETDFADQIPVDPDYNV
FT                   IAPSGERRTITVDVDGKRLAVGLPADLLDGWARSGHGLPATADVTGLPGSSDSTDSPAE
FT                   SALVSSMAGTVVKWLVEPGTAVAAGDPLVVLEAMKMETQVPAHRTGTLSEVLSAPGGVV
FT                   TAGAVLAHIE"
FT   gene            complement(52419..53666)
FT                   /locus_tag="AAur_0055"
FT   CDS_pept        complement(52419..53666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0055"
FT                   /product="putative xylitol oxidase"
FT                   /note="identified by match to protein family HMM PF00941;
FT                   match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10137"
FT                   /db_xref="GOA:A1R0X3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X3"
FT                   /protein_id="ABM10137.1"
FT                   /translation="MKNWAGNLEYSSADVHSPTSVEELQELVANASRIKALGSRHSFNT
FT                   VADTDGTHILLDALPQEVVLNTAKNTVKVSGGISYGALGRALEEQGYAIHNLASLPHIS
FT                   VAGAIQTGTHGSGVNNPSLAAAVVSVDLVRASGELVTLTADDDEFLANVVGMGALGIVT
FT                   GLELAVRPSYDVRQRVLTGLTWEGALANFEAIASSAYSVSFFTDYTGDTIPQVWFKALD
FT                   SEAPLTDLFGATAATAAMHPLPDMSAENCTEQLDVAGKWLDRLPHFRHEFTPSNGEELQ
FT                   SEFLLPLEQAPAALRAVRELAHKFAPLLFVSEIRTVAADEFWLSPFYQQQSVALHFTWK
FT                   PLQAEVEAILPELETALRPFGARPHWGKLFTPGEYDFAALYPRFEDFRALVQANDPTGK
FT                   FSNSLLDSVLGVAVTS"
FT   gene            53835..54800
FT                   /locus_tag="AAur_0056"
FT   CDS_pept        53835..54800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0056"
FT                   /product="putative transcription regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09913"
FT                   /db_xref="GOA:A1R0X4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X4"
FT                   /protein_id="ABM09913.1"
FT                   /translation="MAAEVSLTTVSYVLSGRHGGTTRISQPTQDRVLAAVKELGYVPNQ
FT                   AARGMRRGKTDVVAVAIGNLEWPWDRALATAAARILPEHGYQPVILLGDDWRKFMMSGG
FT                   ADGVIIGYFPEARSEDETVTELARRGVAQVVISGTMKPAGFDVLAPEADAGLAECMEFL
FT                   TASHRRIACIRRADPAGRPKSRFAAYAAGLERAGIALDESLVRTSHHRPATAYQSALEL
FT                   LQLPDRPTAILCTDDMEALQTIRAAYRLGLRVPEDVQIVGVGNSTEGQDYDPALTTVGP
FT                   APIFEQVVRMLLDRLAGTTPAAGIRVASPWKLHRRGTTLG"
FT   gene            complement(54801..55796)
FT                   /locus_tag="AAur_0057"
FT   CDS_pept        complement(54801..55796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0057"
FT                   /product="putative arsenite efflux pump"
FT                   /note="identified by match to protein family HMM PF01758"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09517"
FT                   /db_xref="GOA:A1R0X5"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X5"
FT                   /protein_id="ABM09517.1"
FT                   /translation="MLEATNTPSKTEEPAAPVNPALAAEAKIARIAVTVFPLLVVVAGV
FT                   LGFLIPDLFKPMGVAVPYLLGVIMFCMGLTLTPPDFASVARRPWAVALGIVAHYVIMPG
FT                   AGWLIAVLLQLPPELAVGLILVGCAPSGTASNVMAFLAKGDVALSVAVASVSTLIAPIV
FT                   TPTLTLFLAGSFLHIDAGAMVMDIVKTVLLPVIAGLLARLFLSKLVAKVLPALPWASAV
FT                   VISLIVAIVVAGSASKIVAAGAIVFLAVVLHNGFGLGLGYLAGKLGRLDDKARRALAFE
FT                   VGMQNSGLAATLATAHFSPLAALPSAVFSLWHNISGAIVAAWLARRPLKD"
FT   gene            complement(55903..57399)
FT                   /locus_tag="AAur_0058"
FT   CDS_pept        complement(55903..57399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0058"
FT                   /product="putative sulfate transporter family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916; match to protein
FT                   family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07916"
FT                   /db_xref="GOA:A1R0X6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X6"
FT                   /protein_id="ABM07916.1"
FT                   /translation="MTPEQLMSLRATFRSPRRLLTESLAGLVVALALIPEAIAFSVIAG
FT                   VDPRIGLFASFTMGVVTAIVGGRPAMISAATGAVALVIAPVMKEHGLDYLIATIILAGV
FT                   FQIILAVLGVTKLMRFIPRSVMIGFVNALAILVFMSQMPELFDVPWMVYPIVVVGLVIV
FT                   FGLPRITTAIPAPLVAIVAITLVTVLGNVDVPTVSDKGELPDSLPGFFLPNVPLNLETF
FT                   QIIAPFALSMALVGLLESLMTAKLVDDITDTRSNKTRVSWGQGAANIVTGFLGGLGGCA
FT                   VIGQTMINVKGSGARSRLSTFLAGVFLLILVVVLGDVVGMIPMAALVAVMIFVSLITFD
FT                   WHSIRPSTLKRLPKSETAVMLITVAAVVATHNLAVGVGVGVVTAMVLFARRVAHFATVE
FT                   RTELELNGERVATYTVDGELFFASSNDLYTQFDYAKDSSDGIDRVIIDLHGSHIWDAST
FT                   VAVLDSVTEKYRNHGREVEFIGLNEASVRMRERLAGKLNS"
FT   gene            complement(57422..58528)
FT                   /locus_tag="AAur_0059"
FT   CDS_pept        complement(57422..58528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0059"
FT                   /product="putative RelA / SpoT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07631"
FT                   /db_xref="GOA:A1R0X7"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X7"
FT                   /protein_id="ABM07631.1"
FT                   /translation="MASNWDSLDQAQRDAVDANVALYERVRPALKRVTRDVLLTLRDML
FT                   NDAEVTPLFVTGRTKTVESFREKISRTDDPLEPGGPRVLKFPDPFRTLNDMVGIRVITK
FT                   LPAENAAVANIIKRQRQLFDCRGDREKDIGSIESGTYGYSSRHLILRTIQNEAVKEYQH
FT                   VFNPDMPANGSYFFECQIRTVFAHAWSEIEHDIRFKAEDPRAWTPHFDRQFTATAAMLE
FT                   TVESAFADLHERYEEVRGYWDLEGDGGMPLTPNRVRDVWRTLLPHVDRKVDDDWGWAAE
FT                   LLAAHGLTKTVELAGLLSANRITEVRKALDHRYSPGPDRLLDDLLLWQYGTEHIDLTAE
FT                   APDVVPHPRRDSLQRRLKQIERYRQTAL"
FT   gene            58639..59460
FT                   /locus_tag="AAur_0060"
FT   CDS_pept        58639..59460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06499"
FT                   /db_xref="GOA:A1R0X8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X8"
FT                   /protein_id="ABM06499.1"
FT                   /translation="MLRHKYSYGEHPSQWGELFIPEPSNGNHRGASAVAGGIAVVIHGG
FT                   YWRSQYGAELGEPLARDLAAHGITAWNLEYRRAGNGGGWPHTFEDILAGIDHLSEIAGQ
FT                   HDLQLGKVVALGHSAGGHLAVWAAGRQRLSEIGTPDADRQLQRGPEDNAVHLTGVVSQS
FT                   GLLNLAAAEKLNLSNGAVCNLMGGDSGRYPKRHKYADPMSSLPIDVPVYAVHATEDEDV
FT                   PASQSEAYVAAATAAGSAAQLLRVPGDHFDLIDPKAVAYKKCRELVQRLLS"
FT   gene            59500..60435
FT                   /locus_tag="AAur_0061"
FT   CDS_pept        59500..60435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0061"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10130"
FT                   /db_xref="GOA:A1R0X9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0X9"
FT                   /protein_id="ABM10130.1"
FT                   /translation="MLTVIGEALVDVVQRSSGIEAHVGGSPLNVAVGLARLDHPVQFIG
FT                   RYGRDAYGDSVAAHLRSSSVMVPLPPDEKPTSVATAQIDDDGAATYAFDLAWELPGLAG
FT                   RLPLMLQGSTLLHTGSIATFLEPGAAEVLAAVEHAHPSSTISFDPNCRPSIITDVEYAR
FT                   TQAERFVVLSDVVKASDEDLEWLYPGVDPTESARRWLSLGGEEGPALVVVTRGSRGPWG
FT                   VTRAGETQVPAPSVNVVDTVGAGDSFMAGLLSAIVDHGLDGAQNRGDLRAMPAETLAAI
FT                   MDHATRAAAVTVSRAGANPPTRAELNHGVA"
FT   gene            complement(60451..61509)
FT                   /locus_tag="AAur_0062"
FT   CDS_pept        complement(60451..61509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0062"
FT                   /product="putative glutathione s-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09684"
FT                   /db_xref="GOA:A1R0Y0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y0"
FT                   /protein_id="ABM09684.1"
FT                   /translation="MSDKTISEEHSTRGAYVTGNEFNRDTNYIEDRITRDGASGPNGEP
FT                   GWPVEPGRYRLIAARACPWANRTVIVRRLLGLEDVISLGQPGPTHDARSWTFDVDPEGK
FT                   DPVLGIERLQEAYFRRFPDYPRGITVPAVVDIASGAVVTNNFPQITLDFSTEWTEFHRP
FT                   GAPQLYPEHLREEIDQVNKRVFTEVNNGVYRCGFAGSQEAYDAAYTRLWNALDWLEERL
FT                   TGQRYLVGDSITEADVRLFTTLARFDAVYHGHFKCNRNKLSEMPALWGYARDLFQTPGF
FT                   GDTTDFVQIKQHYYIVHEDINPTQIVPAGPDLSGWLTPHGRESLGGSPFGEGTPPGPVK
FT                   VGEEVAAGHGAG"
FT   gene            61592..62404
FT                   /locus_tag="AAur_0064"
FT   CDS_pept        61592..62404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0064"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08532"
FT                   /db_xref="GOA:A1R0Y1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y1"
FT                   /protein_id="ABM08532.1"
FT                   /translation="MMRLVASDIDGTILGHDGKISDRTIKAFQACRDAGVELVFVTGRP
FT                   PRWLYPLQEQLGHSGIVICSNGAVVWDLETEKALSSCVLDAESVFEARRIIKSIRPDAL
FT                   FAVETLTGFQLEPGFIENETSELLAEFTPKPLAETLTADDAVVKFLAITREGTPDEFLA
FT                   EVQPAVAHLVSTTHSAPRTAMLEMSVPGINKAVTLAQYAESLGIEAADVVAFGDMPNDI
FT                   EMLRWAGHGYAMASGHPEAILAAGQQAPHFDDDGVAQILEAKLTEQRV"
FT   gene            complement(62401..63330)
FT                   /locus_tag="AAur_0063"
FT   CDS_pept        complement(62401..63330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0063"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07854"
FT                   /db_xref="GOA:A1R0Y2"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y2"
FT                   /protein_id="ABM07854.1"
FT                   /translation="MNREAPTASRAQGWGRIYFAVQAVAGLAWWVGVFLSPAIRTATLG
FT                   SLDPVLVAAFDVPLFVVASAWAAFGVRTGAMVATSWTGLVAVALATYATFSTEAGWGVL
FT                   IMLAAAACSTIALFLVVEGRVPTELIVRGPFAFRPAPTLRGVAANVAATMGQLALFWGL
FT                   FLVVLPSVICWFEQRWAVSLALPSTAAPAGLVVLVLASCLGIASAVTMSSAGGGTPLPS
FT                   AMPNRLVIAGPYRWVRNPMAVAGITQGVAVGLILGSWLVVAYAAIGSLLWNYAVRPLEE
FT                   ADLESRFGAEFRHYRDSVRCWIPRVGRN"
FT   gene            complement(63327..64193)
FT                   /locus_tag="AAur_0065"
FT   CDS_pept        complement(63327..64193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0065"
FT                   /product="putative NAD dependent
FT                   epimerase/dehydratase-related protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02558"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08161"
FT                   /db_xref="GOA:A1R0Y3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y3"
FT                   /protein_id="ABM08161.1"
FT                   /translation="MTVLIAGCGDLGTEAGLRFAAAGHDVVGLRRSPEKLPSGIRGVFA
FT                   DLSKHVPELPADVDIVVVAVAADASTEEAYRAAYLNGVKNVLDALERQSIEPQRILFVS
FT                   STAVYKDSGGAVVDESTPTEPTRFSGKVLVEAEELLFSRTRGTATQPISLRLGGIYGPG
FT                   RTRLIDQVRTGQAVIPAQPRHTNRVHRDDAAAMIVHLTTMTPTPDRVYVGVDDHAAEMG
FT                   DVMRFLASEMGCPEPPTAEPGGASDAGPGDKRCSNARIRATGFEFTFPTYKEGYRALLA
FT                   GEGVRHP"
FT   gene            complement(64302..64613)
FT                   /locus_tag="AAur_0066"
FT   CDS_pept        complement(64302..64613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0066"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07162"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y4"
FT                   /protein_id="ABM07162.1"
FT                   /translation="MAKARLALLREDRRRLRNDRHAVADMHQRPAATAVELHPHRGGIA
FT                   SNGVHHSGRFEAGRQRDLDPVSLAKRLPVVIRFDATHWRGIDVVDPALGHVSPCKSDL"
FT   gene            64612..65409
FT                   /locus_tag="AAur_0067"
FT   CDS_pept        64612..65409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0067"
FT                   /product="putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09623"
FT                   /db_xref="GOA:A1R0Y5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y5"
FT                   /protein_id="ABM09623.1"
FT                   /translation="MGYATGVTLPYFFRKDGSVGPLAFAHRGFSLDGLENSMAAFRAAT
FT                   ELGTVHLETDVHTTADGVLLVFHDSSLDRVTDSVGKISELTATQVAAARIGGVEPVPTF
FT                   DELVTALPHARLNLDVKDWNSVGPMAAAIEKHGVHDRVLVTSFSDRRRRAVLSRLSRRV
FT                   ASSAGSSLTALFVVLGPVLPAPLARKLLAGVDVFQVPVRYGRVPVVTPGFIRRAHRLDR
FT                   QVHVWTVNDPVEMERLLDLGVDGIVSDRLDLLKEVLVRRGQWA"
FT   gene            complement(65451..67268)
FT                   /locus_tag="AAur_0068"
FT   CDS_pept        complement(65451..67268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0068"
FT                   /product="beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF02836; match to protein
FT                   family HMM PF02837"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08721"
FT                   /db_xref="GOA:A1R0Y6"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y6"
FT                   /protein_id="ABM08721.1"
FT                   /translation="MTPAMPKPEHPRPQLVRDKWLNLNGTWGFEIDAGDSGLERGLTTR
FT                   ELNSEILVPFAPESALSGIEHVDFMEAVWYRRTVTIPQEWAGQNVLLHFGAVDHDATVW
FT                   VNGVEVARHRGGFTPFTADLEGVVEPGTDAVIVVRARDSRHEMQARGKQATWYNNTHCQ
FT                   YTRTTGIWQTVWMEAVPAVHIKRLRMTPNLADSSITLEVPVSQNRSGHTVTAVLSDGSG
FT                   MRIEESAKADLDLTPSLRLSIPEGSLRPWSIEDPFLYDLEVCVRNGSGEVVDHVSSYAA
FT                   VRSIALDGKVVRINGKAVFQRLVLDQGYWPESLMTSPDEAALVRDIELSMAAGFNGARL
FT                   HQKVFEERFLYHADRLGYLVWGEFGDWGVSGGGTIGHNQKPTASFVAQWLEVLKRDFNH
FT                   PSIIGWCPLNETHQILHDRLTVLDDVTEAMFLATKLADPTRPVIDASGYAHRIRETDIY
FT                   DSHSYEQDPDRFRIEQQGLAEGKPYINRKADGEEYSVPYAGQPFFVSEFGGIWWNEVEA
FT                   RQAVKGSDVSTSWGYGQRVSSEEEFYTRFDGLCSVLLDNPDMFGYCYTQLTDVFQEKNG
FT                   IFNFDRSNKFHLERIRASQTRPAAIEGGN"
FT   gene            67343..68305
FT                   /locus_tag="AAur_0069"
FT   CDS_pept        67343..68305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0069"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07426"
FT                   /db_xref="GOA:A1R0Y7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y7"
FT                   /protein_id="ABM07426.1"
FT                   /translation="MTRFRLAILDDYQQVSGDYAPWDSLLDDGVKVSVFSAPFLSKEQA
FT                   VAALAPFDIIVAMRERTRFPQDVLESLPNLKLLVTTGMANAAIDLEAASERGIVVCGTG
FT                   GSPAAAPELTWALLLAFARNLAVEENSLRAGGWQTGVGFELEGKTLGIVGLGKIGKRMA
FT                   GYAKAFGMDVLAWSQNLTAETAEAAGARKVSKEELFRESDVVTLHLRLSERTEGIVGSE
FT                   ELRLLGPDGVLINTARGPLVDEEALIRALEEGWIRGAALDVFDEEPLPAGHALLHSPRT
FT                   VLSPHIGYVTHESYRQFYGGAFEDVKAWLEGAPVRVLGG"
FT   gene            68448..69689
FT                   /locus_tag="AAur_0070"
FT   CDS_pept        68448..69689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0070"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="identified by match to protein family HMM PF02595;
FT                   match to protein family HMM TIGR00045"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06267"
FT                   /db_xref="GOA:A1R0Y8"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y8"
FT                   /protein_id="ABM06267.1"
FT                   /translation="MAAIGAPLWKEGLPSPTLRAGQALSERSWQDGPMRILIAPDKFKG
FT                   SLTAAEAASAMAEGALRVYPDAVTTQFPVADGGEGTLDAAIAAGYEERNNAVVGPILKP
FT                   VGASWAIRKDAFGGASAVIETAMASGLAHMEPTPENSLRAHSYGCGQLVAAALDAGATE
FT                   IVLGLGGSAMSDGGSGALRALGLKPLDSAGNVVPLGGGSLTDVVALDVSELDPRLSSVK
FT                   FRIAVDVQNPLYGPEGAAHVFGPQKGADEDAVEKLDAGLRNWASLLREATGRDVNVPGA
FT                   GAAGGFPASFLAFTDAALEGGFALVAGLTGLAKHLGEADLVITGEGSMDEQSLTGKAPI
FT                   ALADAASVHGIPVIAVAGRITVTPEDLAKHGIVAAAQLLDVAQRKDGVPDVADAVANAG
FT                   KYLAWATSQVLEGA"
FT   gene            complement(69690..69932)
FT                   /locus_tag="AAur_0071"
FT   CDS_pept        complement(69690..69932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06816"
FT                   /db_xref="InterPro:IPR020311"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Y9"
FT                   /protein_id="ABM06816.1"
FT                   /translation="MDNQDLLERIQSLVEEEHRLRDAAGSDDGGGDSTARLAQLEAQLD
FT                   QCWDLLRQRRAKRDAGENPDDASARPVSEVEGYRQ"
FT   gene            70027..70470
FT                   /locus_tag="AAur_0072"
FT   CDS_pept        70027..70470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09416"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z0"
FT                   /protein_id="ABM09416.1"
FT                   /translation="MKFTTTIVGDGNKAGIEVPDEIVDGLGAGKRPPVVVTINGQSYRS
FT                   SIAVMGGKYMVGVSSANRELTGAAAGDTVDVGLEVDTEPRVIEVPEDLAAALDSEPDAK
FT                   AFYATLNYSSQRRYVEPIGDAKTEETRARRIAKVVSDLKAGKK"
FT   gene            70852..71973
FT                   /locus_tag="AAur_0073"
FT   CDS_pept        70852..71973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10276"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z1"
FT                   /protein_id="ABM10276.1"
FT                   /translation="MACLAFLVPVAGLSGFAVVMASKIVKRGPKDYRRAEMTEDGRRIR
FT                   IDLDDYTKAPGDFGVFDPATEKYTRVGEVTLINEDKKYVERRVDSLGSATGSLGPIVDW
FT                   TPDVFFEPSSVGGSYKEVDVPTEYGAAPAWLFEAENTDVWVIHIHGSWTDRSIMFRDVH
FT                   AFSPLGFTSLVPTFRSDPEVSPPQAESSHLGQTEWRDVESAVSYAVAHGAKRIVLSGWS
FT                   MGGTIALLTAEHSAHRDRIVGLVLVGPVTSWRKAIAAGAVRAGVPAIGAGLVMRLLEAP
FT                   LFARMLGLEEPIDFDALDWVDVPSRVAVPTLVLHSNADQEVPWEISAAFQRANPATVTL
FT                   ITLPEAHHTQEWNASPSAFTNELKSWVSKTILN"
FT   gene            complement(71980..72837)
FT                   /locus_tag="AAur_0074"
FT   CDS_pept        complement(71980..72837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0074"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10254"
FT                   /db_xref="GOA:A1R0Z2"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z2"
FT                   /protein_id="ABM10254.1"
FT                   /translation="MIKVAESRTSWVASVFGLAALYVLGTVTPLEDIDSHLGGVNVTNL
FT                   LQAIFALLAIFFFNDSVRRLANVPVVRWTYYAPLLSIPVMIASFSLIADKAPTAADFID
FT                   TRMDQLATAVYSGTYMFALLFTVLRIIYMLRHNAKGPYATFSAGLMVVAVAVSCHIAYV
FT                   VLYYFSPWDDFARAIGTWFDRLFYIGLTVTAAGWLILFLSKQLPRLRLWMIDALWLTAM
FT                   RMRVNADRSRVSPAWDLFNETLENGVYKSLIVLHNYERVNLMEFPESVQGRISHIEAKL
FT                   DAQT"
FT   gene            complement(72901..73347)
FT                   /locus_tag="AAur_0075"
FT   CDS_pept        complement(72901..73347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08565"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z3"
FT                   /protein_id="ABM08565.1"
FT                   /translation="MTLPSVQDKVRELCGDGTTSMKEVVDRLAVICKKPINLIEYKESW
FT                   GALTAFKAEFEDRINVYFPPQKSQQYKLHCIYHELGHIYLESFQMALALPDLSEEMLRE
FT                   TADAISVTCRSVPNHPVERWVEDFAFEMSKKTRSRSSSDPDPFL"
FT   gene            complement(73344..73793)
FT                   /locus_tag="AAur_0076"
FT   CDS_pept        complement(73344..73793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08613"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z4"
FT                   /protein_id="ABM08613.1"
FT                   /translation="MANGAPRVFLTQQQKKERLADRMGILVDIWESDNNTALTYPHVEE
FT                   ALSAHGIHMSRTRWSYLINGTGSLVTDQELLKGIAELVFSVPASYLVDLNSETPPEVEA
FT                   RMEFLVQMRKLKVKNFAARNLGATSPETLRTITRIIDASMNGEDE"
FT   gene            complement(74102..74317)
FT                   /locus_tag="AAur_0077"
FT   CDS_pept        complement(74102..74317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09948"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z5"
FT                   /protein_id="ABM09948.1"
FT                   /translation="MVLVPRLTLVLGHAIRARPIRELTDWLPDPPLQAVVVPTVLFAPQ
FT                   IIPSSATSLPRFMWRTGVIHYARQRR"
FT   gene            complement(74391..75653)
FT                   /locus_tag="AAur_0078"
FT   CDS_pept        complement(74391..75653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0078"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09775"
FT                   /db_xref="GOA:A1R0Z6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z6"
FT                   /protein_id="ABM09775.1"
FT                   /translation="MGVTKSPADTAPAPQRTLRVALSDPTLKILASAILVSTLGRGIFL
FT                   TLTVLYFSRFVGLNAVEIAVILSVSSGVGVATSYIGGRLADHFSARRLLVGMVATQGLA
FT                   IATYTFAGNFSTAVVLACIAVGLDRGANATRSAIIARAFDGPHRVNARAVLRTVTNLGI
FT                   AVGGMIAGLALLAGTADAFRGMMISAGVVYILSALHLRRLPKRVDAPRHDPATPAPKRG
FT                   ISPFRDRRYVLLTVLSGIFGMQFGLAEMGVPLWISQDTSAPEVLISVILVINTVCVVLL
FT                   QVPLSRGTDHPRRAGKIVLTGGVLMAVACVLYAAAGGAPVIAAIALLCGAALLHAFAEI
FT                   LSQAGAWGLSFELANPLQAGAYQGMFGMGSALGAMLAPLVVTATVVEHGALGWAVLGAV
FT                   FLASSAGVALIARKASTAAVA"
FT   gene            75743..76657
FT                   /locus_tag="AAur_0079"
FT   CDS_pept        75743..76657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0079"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07010"
FT                   /db_xref="GOA:A1R0Z7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z7"
FT                   /protein_id="ABM07010.1"
FT                   /translation="MRFGISPLCELGLSLRAIRDPSQYPLQLPWLRRTEEARSRLDHEG
FT                   LLALVDDRLWTPDFLNPRPESPLTRIDDEFAALERISAEQFHGDLIRVHGDVPAVFAGP
FT                   VGPAIRRMVRILREFWDTCFAPHWLRMRTILESDIVYRGRQIAQGGLFTMLNDLSGAVE
FT                   FDGRVISVRLKNPASRTETTDGLGLTLVPTMFTRRASAPVNHGDPPLLMYPARGQGAMW
FT                   ETERVTNPAAIVAVLGEVRTSLLTALAAPASSTELGLRFGVTTSAVNQHLRVLRDAGLV
FT                   TSTRYGHSVLYFRSELGASLLLG"
FT   gene            complement(76705..77256)
FT                   /locus_tag="AAur_0080"
FT   CDS_pept        complement(76705..77256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0080"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /note="identified by match to protein family HMM PF01872"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09268"
FT                   /db_xref="GOA:A1R0Z8"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z8"
FT                   /protein_id="ABM09268.1"
FT                   /translation="MRKVTAGLFHSVDGVVQDPFKFQFDSFDDELGAGLTKMINTVDTV
FT                   VLGRVSYQEWAGYWPNAQQDDDFAAFINPVEKFVASRTLTEPLEWENSHLIEGDVEQFV
FT                   TDLKAREGGEIAVCGSISLVRQLLFAGILDELTLMTHPVVAGSGRRLFEDGDPLHRLVL
FT                   ENQYATSKGNVVSTYSLRKD"
FT   gene            77593..79674
FT                   /locus_tag="AAur_0081"
FT   CDS_pept        77593..79674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0081"
FT                   /product="FG-GAP repeat domain protein"
FT                   /note="identified by match to protein family HMM PF01839"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10033"
FT                   /db_xref="UniProtKB/TrEMBL:A1R0Z9"
FT                   /protein_id="ABM10033.1"
FT                   /translation="MSLANVLPFILAATLQRPPAYASSVTCATLRRRNCRQRCGHIARI
FT                   PARKLYSLPRGLYQAIHSLNIGGEVRSNTDAGVSEKSRQHRLLSKLTAALVAVLLMMVG
FT                   LPALPAQAATVASEAPQLAAVELVSAAQLAPGQTAKVRFTLSQPAQSVVFSYYDESLSE
FT                   TRQIKWSGNPGPGAFTAEASAVVGGDDYYDGLYRLSSIDVKYEKPGVDYPYVRFLRNST
FT                   YEALNVDGAGDPRLQSLDFVIKNPSRVLLVPQNTLAPSFAARMDLDWSRAVQGTISPGS
FT                   WTTGVNIIKVQWVVDGLVENYGTMASTKPFVGWASSPNYGKNLKLRITTITPGFKSVSA
FT                   ESVPYLFVAASPFVISGKPWIGSTLNTNFDVASIKGIPLGAKPKVEVLWRTLSTSYAGS
FT                   PAAPGASYLVKDSDGGGSISALVVISLDGKIVGRFGSEWTAEVTNPAPSRQFESRGVSD
FT                   YYMVRSADGRLWEWGPYFGAFPREIGTGWNVFDKIFSPGDFNEDGFPDVMARKPSGELW
FT                   MYPTDGQSWWKPASVVGVGWQGMTELIAPGDFDSDGHDDVLAKDRDGRLLLYPGNGKGG
FT                   WLAPRQVGAGWNMFKRVFSPGDFDGDSHADLLATNSSGQLFLYSSNGRGGWLGAKVIGS
FT                   GWQSFKTIYSAGDRDGDGWHDVLGVDGAGYMYVYPFKSGHWKPRYLVGADWDVFTALF"
FT   gene            complement(79767..80333)
FT                   /locus_tag="AAur_0082"
FT   CDS_pept        complement(79767..80333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0082"
FT                   /product="intracellular protease, PfpI family"
FT                   /EC_number="3.2.-.-"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01382"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08952"
FT                   /db_xref="GOA:A1R100"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1R100"
FT                   /protein_id="ABM08952.1"
FT                   /translation="MSEHNIAGKKVAFLLTDGVEQVELTSPWQAVKDAGGEPTLVAPSK
FT                   GKLQGFNGVDKGDTFDVDLAVADADASNFDALVLPGGVVNADHLRVDKDAQNFTRAFFE
FT                   QHKPVASICHGPWILIDAGVIKGRNVTSYHTLQTDLKNAGANWTDEEVVVDQGLVTSRT
FT                   PDDLPAFNSKVVEEISEGQHAGQTA"
FT   gene            complement(81151..82239)
FT                   /locus_tag="AAur_0083"
FT   CDS_pept        complement(81151..82239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0083"
FT                   /product="oxidoreductase family, NAD-binding Rossmann fold
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF01408; match to protein
FT                   family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06875"
FT                   /db_xref="GOA:A1R101"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R101"
FT                   /protein_id="ABM06875.1"
FT                   /translation="MAPSVATGRPIRWGVVATGSIAARVVQDLALLDDAILQAVSSRSE
FT                   ASARAFAEKFGFATAYSDAGGTLGYERLLADTGVDVVYVATPHAQHHEVALAALRAGKH
FT                   VLCEKPIAMDAVQARELVDLARERGLFLMEAVWTRFLPSFCRAVEILRSGEIGEPRWLQ
FT                   ADLGFVPAFDPASRIWDPAAGGGALLDLAVYPLTWALGVFGEPLSMLASGVLTPDGVDL
FT                   QNSLTLSYQGGAHAQLITSIGAECPSVVTVGGAEGWLRSSAPLFNPAELIIQPRSGTPR
FT                   TERFEVTGHGFSYELREVTRCLQAGLAESPFMTPEESVAMMEQLDEARRQMGLRYPSDP
FT                   QTPTGADHLADTPAPRTALRAL"
FT   gene            complement(82291..83310)
FT                   /locus_tag="AAur_0084"
FT   CDS_pept        complement(82291..83310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0084"
FT                   /product="putative transcriptional regulator, lacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06863"
FT                   /db_xref="GOA:A1R102"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R102"
FT                   /protein_id="ABM06863.1"
FT                   /translation="MTQDTSGPRPVPTLEMVAALAGVSRATVSRVVNDSPSVDPEMAQS
FT                   VRKAILALDYTPNRAARSLAKRRANAVTLIVPESTSKVFADPFFASVVQGIALYLTDTE
FT                   YTLNMVISSESKPEKTRSFLLGGNVDGVLVVSHHSGDNSWTHLSGSLPMVFAGRPLVGG
FT                   KESYYVDVANEQAAYDVTRLLTESGRKNVATIAGPQDMPPGLDRLAGWRTAVREAGLGE
FT                   SLVEEGDFTLASGAQAMRRLLDRGVPLDAVFAANDQMAAGAYTAIQGRGLRIPEDIAVV
FT                   GFDDDSFATSVTPALTTVHHPIVELGKKMAETLVKLIEGKPAERVTRMPTSIVIRDSV"
FT   gene            complement(83355..84812)
FT                   /gene="bglA"
FT                   /locus_tag="AAur_0085"
FT   CDS_pept        complement(83355..84812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="AAur_0085"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06312"
FT                   /db_xref="GOA:A1R103"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:A1R103"
FT                   /protein_id="ABM06312.1"
FT                   /translation="MPFEATTHPAITPHNRVWPEGFLWGSATAAAQVEGASHEGGKEDS
FT                   VWDAFARIPGAIANGETLKDAVQHYHRMPQDVRIMKELGLDSYRFSTSWSRVRPGGRSV
FT                   NAEGLDFYSRLVDELLDAGILPWLTLYHWDLPQALEEKGGWANRDTAYRFVDYANDVYS
FT                   ALGDRVQHWTTFNEPFCSSLLGYAAGVHAPGRQEPEAAVAAIHHQHLAHGLVVNELRSR
FT                   GAQQLGITLNLSNSIPRDPSDPVDLDAARRFDSLQNRIFLDPILRGAYPEDTLNDLEQF
FT                   GIRDVIKPGDLDIIGAPIDFLGVNHYHDDLISGHPTAEHGDGHSGGATRPTSSCWIGSE
FT                   DIAFPSRGLPRTAMNWEVNPDGLRMLLVRLGEEYPALPPLYITENGAAYDDVVSPDGAV
FT                   HDAERTEFVLDHIAAVGEALDQGADVRGYFVWSLLDNFEWSWGYGKRFGVVRVDYDTFE
FT                   RTVKDSGLAYARVIASAKASASATVNA"
FT   gene            complement(84812..85714)
FT                   /locus_tag="AAur_0086"
FT   CDS_pept        complement(84812..85714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0086"
FT                   /product="putative ABC transporter sugar permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08039"
FT                   /db_xref="GOA:A1R104"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R104"
FT                   /protein_id="ABM08039.1"
FT                   /translation="MILTQNRPQAPAPQRTSRSLTARKALFGNGRRPGFLTYGLLLAFF
FT                   LASAYPLWWSVIIGSRSNEALGETWPPLFPGGNFWTNAGEVFDTIPFWLALGNSVLISG
FT                   IITVSVVGFSTLAGYAFAKLRFRGRNWLMVAVIATMAIPTQLGIIPLFMLMRTLGWTGE
FT                   IGAVVIPTLVTAFGVFFMRQYLVDVIPDELIESARMDGASMISTFWHVALPAARPAMAI
FT                   LGLFTFMTAWTDFLWPLLVLDAGNPTLQTALSQLQSARYVDYSIVLAGAVMATLPLLAL
FT                   FVIAGRQLISGIMQGAVKG"
FT   gene            complement(85711..86808)
FT                   /locus_tag="AAur_0087"
FT   CDS_pept        complement(85711..86808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0087"
FT                   /product="putative ABC-type sugar transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09133"
FT                   /db_xref="GOA:A1R105"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R105"
FT                   /protein_id="ABM09133.1"
FT                   /translation="MTTTLNRPAAGRTAASKPKPTFRQRLSVFDMKASPYFYIAPFFIL
FT                   FALVGLFPLGYTFFVSLFDWHLLKGQGEFVGFQNFAEVLQDRFFWNSLFNTVSIFLIST
FT                   IPQLIMATIIAAVLDQNLRAKTFWRMSILLPYVVTPVAVAMIFTNMFGEQYGLINNILS
FT                   SFGIDPIMWKNDTLPSHIAIATMVNWRWTGYNALILLAAMQSVPRDIYESAAIDGAGSV
FT                   RRFFSITLPSIRPTMVFVIVTATIGGLQIFTEPRLFDPVAAGGTARQFQTTVLYLWEMA
FT                   FQRQNFGKASTIAWLLFLIILLFGIVNWLISRRIATNGDDRGAASRRRRKRPLAASAKA
FT                   DDAGLAAQAAGAPAAAPDSTPRSGQ"
FT   gene            complement(86872..88188)
FT                   /locus_tag="AAur_0088"
FT   CDS_pept        complement(86872..88188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0088"
FT                   /product="putative extracellular sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09722"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1R106"
FT                   /protein_id="ABM09722.1"
FT                   /translation="MEFSRLRKFTALAGVASLALVAAGCSGGGDKAASADNPVTLTVTT
FT                   FGTFGYDDLYAEYEKQNPGVTIEATNIDRGSNARTDAFTKLAAGSGLSDVTAIEEGWLG
FT                   SIMEVSDQFVDLKEHGAEDIKGNWVDWKYKQGTDPNGRVIGYGTDIGPQALCFNGKLFE
FT                   AAGLPSDREKVAELFGGKDASWDTYFKLGRQYKEATGKAWYDQSGFVWNSMVNQMDEGY
FT                   YTKDGKLNVEGNKEMRAKFDMLAAGTADGLSSNQTQFDWGNGKAFVDGSFATHVCPAWM
FT                   LGTIKGQLESAGGGAASGWDVADVFPGGASNWGGAFLSVPKSSKHPAEAAKLAAWLTAP
FT                   EQQIKQSAAANNFPSTLEAQAKIVEAAKPNELFNNAPYGAIFESRAEGVIAQFKGPDDS
FT                   VIQENVFGPALKMLDSGKGTADQAWNEAVKLLNDLVVNN"
FT   gene            88641..90107
FT                   /locus_tag="AAur_0089"
FT   CDS_pept        88641..90107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0089"
FT                   /product="putative lysozyme like protein"
FT                   /note="identified by match to protein family HMM PF00395;
FT                   match to protein family HMM PF01183"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09112"
FT                   /db_xref="GOA:A1R107"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR008270"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:A1R107"
FT                   /protein_id="ABM09112.1"
FT                   /translation="MKFSMSSRSSLPKTSAKPPTRGFAGAKTAAVLLATMLLAASGATA
FT                   ATASEESPIVQNDHAMGSTIRGHESAGQLFSIQATDSASSLPGVPGMDVSSHQGVVDWT
FT                   KAAANGAKFAYVKASEGTEYSNPYFADQYAGAASAGMLRGAYHFALPNASSGAAQASYF
FT                   LQSGAAWTPDGKTLPALLDLEYNPYGSTCYGMTPGEMVSWVSDFATTILSRTGRLPAIY
FT                   TTTDWWNTCTGRANGFGNHPLHIARWESTPGVLPAGWNAYTLWQYSDSGVFPGDQNVFN
FT                   GTAEQLSAFASNPGPIFSDISGGQFTTEVNWLGSRGISTGWTEANGARTYRPLAPVARD
FT                   AMAAFMYRLAGSPAFTAPAKSPFTDVATTNPFYKQITWLASKGISTGWIESTGTKTYRP
FT                   FEPVARDAMAAFMYRLAGSPEFNAPAESPFTDVATTNPFYKQITWLASSGISSGWTEAD
FT                   GTKTYRPFEPVARDAMAAFMSRFDTKFGDQ"
FT   gene            complement(90156..91511)
FT                   /gene="ncs2"
FT                   /locus_tag="AAur_0090"
FT   CDS_pept        complement(90156..91511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ncs2"
FT                   /locus_tag="AAur_0090"
FT                   /product="uracil-xanthine permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF03594; match to protein
FT                   family HMM TIGR00801"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07834"
FT                   /db_xref="GOA:A1R108"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A1R108"
FT                   /protein_id="ABM07834.1"
FT                   /translation="MSMLGIKWKLHGNGKSIRPGHVVAPDERLAWPLTIGIGMQHVVAM
FT                   FGATFLVPIITGMPPATTLLFSGIGTLLFLVITKGRVPSYLGSSFAFIAPIMASQQQYG
FT                   VSGALGGVVLAGVVLALIGAVVQKFGAEWINRLMPPIVTGAIVALIGLNLAPAAKANFD
FT                   AAPVTALITLVTIILVSVLFRGILGRLSILVGVVVGYLVAMMRGEVSYEKMDAAAWVGL
FT                   PLFQTPEFHIGVVGLFVPVVLVLVAENVGHVKSVAAMTGQNLDGVSGRALMADGAATVL
FT                   AGFGGGSGTTTYAENIGVMAATKVYSTAAYWVAGVFAILLSFSPKFGELIATVPPGVLG
FT                   GAATMLYGMIGVLGVKIWVQNKVNFSNPINLTTAAVALIIGIADYAWTIGELKFTGIAL
FT                   GSAAALVIYHGMKGLAHWRGTVAEPETETAGLPPAVKSAMNAAAKRGGKKGK"
FT   gene            complement(91586..94075)
FT                   /locus_tag="AAur_0091"
FT   CDS_pept        complement(91586..94075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0091"
FT                   /product="Acyltransferase family domain protein"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06468"
FT                   /db_xref="GOA:A1R109"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:A1R109"
FT                   /protein_id="ABM06468.1"
FT                   /translation="MPTFPLAARQRALAVLAMLLAMFLMPSAQAWGSVQQPGVEDPGTR
FT                   FFGALLDWDTDSAADYAQRLGAPAALYGQNVSLPVDDGGREYLKGYFSQIAEQGSHALL
FT                   TVRPGIPLKDINQDVASAFARQITTAAAGFRGKVLVRFAPEMNAPWVSWGQEPEAYRAA
FT                   FDNVAAALRATLPDPVMVWSPTAEKDYPFQVATSTPPKGVPLASLDTSGNGIWDQDDSA
FT                   FEPYYPGDDVVDWVGLSVYHDTTGAGAASNTLPAAGEFNDALHASSGGTSSGEGGTDNF
FT                   YGTYVQARTKPLLVETGAFYSPGAGGAAELDVKETWWHQVFASVAEPGNGSVRAVVWNE
FT                   TTEVRDPGRVPIDWRATAEPSLANPFRTSLDTSGLTIGPVTEKGLDNVPGIEAPQPKTG
FT                   TVIQGWAAWASAGSVLVAVAALWFLSSRAFASKWSYTGTGKRDARIDMLRGLAIVFVVV
FT                   NHVGINSVFQLLSQETLGVVSGAELFVMLSGVVLGMVYGPRIATELGDVVDGTTKRAWK
FT                   LYFTALAVVLIVYGLSLLPFINAAAVTTFTDQGTGGAGRAAAGTTYDLYAGMEGLLQFP
FT                   VPQGLIPALLLLQVGPWQFNIMGLYVVLLLISPLILVALSRGFTWLVLTLSVGLYIAGS
FT                   IFRFRLLPSQFEDSFPLLVWQLLFVVGMTAGFYRHHIIEWFADRRRRWLLGVCIFLAAA
FT                   CAVFSWSGPYLTNQLDFRLALIPETTFRYVYDTFFSRTYLGPGRVLNVFLITIALYALL
FT                   SAFWKPLSRAVGWFFIPLGQATLYVFIMHVFFIVAIANIPVLRDGNLWLNTGVYIALLA
FT                   ILWVMVKTKFLFRLVPR"
FT   gene            94280..94885
FT                   /locus_tag="AAur_0092"
FT   CDS_pept        94280..94885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0092"
FT                   /product="putative nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06379"
FT                   /db_xref="GOA:A1R110"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A1R110"
FT                   /protein_id="ABM06379.1"
FT                   /translation="MTIAHEEAVIDAAAVDAIFAEARTANSFAGEVTDEQARAIYELTK
FT                   FGPTAFNSQPLRVTYVRSDDARAKLVDALSRGNQAKTASAPLVAILSYDTDWQGQWDKF
FT                   LPAYGAPKAMYDADPALAATTGNNNAHLQAGYFILAVRSLGFAAGPMTGADFAAIDAEF
FT                   FPAGDQKSFLVVNIGQPGPDAWGEAKPKFAYDDVVRTV"
FT   gene            95128..95634
FT                   /locus_tag="AAur_0093"
FT   CDS_pept        95128..95634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10287"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A1R111"
FT                   /protein_id="ABM10287.1"
FT                   /translation="MPMRNLIWVAFTEPVSPGLVFPRSDWPLHITLLRFDVGANVSADV
FT                   ADVLADQAEAPVKGALGTRLRVGEEAGFGHMGSIPVSLIEHNPLLQGLHEEIVDAVNSI
FT                   GGRIATPNYVMERFRPHISHHDGKRPKSGDAVVLDQVALVDMAPEGDHTIRRILRLWTQ
FT                   DTKTG"
FT   gene            complement(95757..97430)
FT                   /gene="pgm"
FT                   /locus_tag="AAur_0094"
FT   CDS_pept        complement(95757..97430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="AAur_0094"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /EC_number="5.4.2.2"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01132"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07932"
FT                   /db_xref="GOA:A1R112"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A1R112"
FT                   /protein_id="ABM07932.1"
FT                   /translation="MLDPMASRAGTVALPQDLVDITALLDAYFDVTPDLGDPAQRVAFG
FT                   TSGHRGSSLKASFNEPHILAITQAIVEYRGRQGITGPLFIGRDTHALSEPAQNSALEVL
FT                   AANGVTVLVDARHGYTPTPALSHAILKYNREAAPGTPQADGIVVTPSHNPPGDGGFKYN
FT                   PPHGGPADTDATGWIADRANQLLENGLRGVKRMPLNDALAADTTGKFDFLSSYVDDLPS
FT                   VLNLDAIRNAGVRIGADPMGGASVDYWGEIGERHQLNLTVVNPTVDPQWAFMTLDWDEK
FT                   IRMDCSSPSAMASLIKRMAAGADGTAAYDVATGNDADADRHGIVTPDGGLMNPNHYLAV
FT                   AIDYLYRNRSGWNPESVVGKTLVSSSIIDRVAAGLGRKLVEVPVGFKWFVPGLLSGEGA
FT                   FGGEESAGASFNKLDGSVWTTDKDGILLALLASEITAVTGSSPSQLYKGLTDQFGSPVY
FT                   ARIDAAATREQKSKLGKLSAADVTATSLAGEEITAKLTEAPGNGAPIGGLKVVTENAWF
FT                   AARPSGTEDVYKIYAESFKGADHLAQVQKEAKALVDGVIA"
FT   gene            complement(97615..98370)
FT                   /locus_tag="AAur_0095"
FT   CDS_pept        complement(97615..98370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0095"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06667"
FT                   /db_xref="GOA:A1R113"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R113"
FT                   /protein_id="ABM06667.1"
FT                   /translation="MGNFEGKTALVTGGGSGLGEAISKDLAKNGVNVVVVDVNLDAATR
FT                   VADQITADGGTAVAFQGNTAVAEDSKKAVDFAIETYGALNYAVNNAGIGGASAPVGEVD
FT                   IEDWDRVIAINLSGVLYGMRYQVPAILAAGASEGAIVNMASIHGAVAAPGNAAYTAAKH
FT                   GVVGLTKNAAAEYGAQGLRVNAIGPGYIDTPLLAAAPKEVISGLEAKHPLGRLGKAEEI
FT                   ANVTTFLLSDKASFMTGSYVLVDGGYTAV"
FT   gene            98563..99192
FT                   /locus_tag="AAur_0096"
FT   CDS_pept        98563..99192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08034"
FT                   /db_xref="GOA:A1R114"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:A1R114"
FT                   /protein_id="ABM08034.1"
FT                   /translation="MSDQPARGNEDKPSGYEPPQYVPPAQFSAPESTTHHQGTPAEYAP
FT                   EQGANATQPLPPYEQSAHGQNPYAQPQQPAGAYAPGDYSQQPPSPYGQPPSPYQQQAFN
FT                   QQPYGQPQSPYGQPAYYAMQAEPKGLSIASMCCGIAVYVGFGFFILPQIAAVILGHLAL
FT                   KREPAGKGMAIAGLVMGYLGVALTVIFGIIFFIAIGASSSSYNNRF"
FT   gene            complement(99277..100803)
FT                   /locus_tag="AAur_0097"
FT   CDS_pept        complement(99277..100803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0097"
FT                   /product="dipeptide/tripeptide permease (Peptide:H+
FT                   symporter)"
FT                   /note="identified by match to protein family HMM PF00854;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07570"
FT                   /db_xref="GOA:A1R115"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R115"
FT                   /protein_id="ABM07570.1"
FT                   /translation="MPRAFIDVTMPAVSASIEKMSTPQTTAESAKPAGDTSFFGHPKML
FT                   ASLFSVEMWERFSFYGMQGILLYYMYFTAEQGGLSIDQGLAAGLVGAYGGGVYLSTILG
FT                   AWLADRLFGSEKVLFGSAIMIMAGHIALALLPGIPGLIAGLVLVGIGSGGLKANATALV
FT                   GTLYGEKDERRDAGFSIFYMGINIGGLIGPLVTGWLQTSYGFHIGFGAAAVGMAIGLVI
FT                   YSLGRKKLPEEAHRVPNPLPTKDRTKYGLIFLGILIVIGVLLGTGIVNANNLARSMAYA
FT                   AIGAAVIYLFLIFRSPLVTGVERKRVVAFIPLFIASAGFWALFQQQFTFIAVYSQEKLD
FT                   RNLFGWEMPAAWVQSINPVFIIIFAGVMAALWTKLGSKQPSSPLKFSAGLFIMGLAFLA
FT                   FIPLAGDGKTPLLALVGILFMFTLAELFLSPIGLSVSTKLAPKAFHTQMVALFFLSVSL
FT                   GTTLAGILAGLYNPEDELPYFLGIGGVAVVLAVGLAAASPAIKKLMGGVR"
FT   gene            complement(100831..102207)
FT                   /pseudo
FT                   /locus_tag="AAur_0098"
FT                   /note="amidase domain protein; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF01425"
FT   gene            complement(102260..103003)
FT                   /locus_tag="AAur_0099"
FT   CDS_pept        complement(102260..103003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0099"
FT                   /product="putative peptidase family S51 protein"
FT                   /note="identified by match to protein family HMM PF03575"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06801"
FT                   /db_xref="GOA:A1R116"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1R116"
FT                   /protein_id="ABM06801.1"
FT                   /translation="MATGQPTILATSGGYKPGERTRIEFNHLMHYAVELSGVSGRAPRV
FT                   THIGTASGDQRWWAAEMDQAARIAGFDFSHLSLFTMPNIEDPEAHLLEQDVVWVNGGSV
FT                   VNLLAVWRAHGLDGIMRKAWESGVVLAGVSAGSICWYQGGVTDSFGPELKPVTNALGFL
FT                   PYGNGVHYDSEPRRAPAIHRLVANGTLGETHCTDDGVGLVYRGTELAEVVSEVKNKAAF
FT                   RVTAGAGESVDAVAVEERLESRFLG"
FT   gene            103158..103484
FT                   /locus_tag="AAur_0100"
FT   CDS_pept        103158..103484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0100"
FT                   /product="putative rhodanese-related sulfurtransferase"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08177"
FT                   /db_xref="GOA:A1R117"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1R117"
FT                   /protein_id="ABM08177.1"
FT                   /translation="MSDFDTVPVGDIPADASILDVREDYEWVAGHAEGARHIPMDQLPA
FT                   RLEELDPDDDLFVICRTGGRSFRAVQWLVGQGYSAVNVAGGMDMWFEAGKPMVSDNGLK
FT                   PVVL"
FT   gene            103517..104449
FT                   /gene="pheA"
FT                   /locus_tag="AAur_0101"
FT   CDS_pept        103517..104449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="AAur_0101"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00800;
FT                   match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07728"
FT                   /db_xref="GOA:A1R118"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="PDB:3MWB"
FT                   /db_xref="UniProtKB/TrEMBL:A1R118"
FT                   /protein_id="ABM07728.1"
FT                   /translation="MSAVTYTFLGPQGTFTEAALMQVPGAADATRIPCTNVNTALERVR
FT                   AGEADAAMVPIENSVEGGVTATLDAIATGQELRIIREALVPITFVLVARPGVELSDIKR
FT                   ISTHGHAWAQCRLWVDEHLPNADYVPGSSTAASAMGLLEDDAPYEAAICAPLIAAEQPG
FT                   LNVLAEDIGDNPDAVTRFILVSRPGALPERTGADKTTVVVPLPEDHPGALMEILDQFAS
FT                   RGVNLSRIESRPTGQYLGHYFFSIDADGHATDSRVADALAGLHRISPATRFLGSYARAD
FT                   KQPAVVAPHTSDAAFASAHAWVDSILKGS"
FT   gene            complement(104781..105842)
FT                   /locus_tag="AAur_0102"
FT   CDS_pept        complement(104781..105842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0102"
FT                   /product="putative diacylglycerol kinase catalytic domain"
FT                   /note="identified by match to protein family HMM PF00781"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06259"
FT                   /db_xref="GOA:A1R119"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A1R119"
FT                   /protein_id="ABM06259.1"
FT                   /translation="MSDWILYLILAGGVAFAVSSWWGVRRLKARHIRSAVREDAHKPGP
FT                   GDQRVAVILNPVKNNAEVARQAIIDACDLAGWDAPKFFETTVDDPGYGQSRQALAYGAD
FT                   VVLACGGDGTVRVVAECLAHKNVAMGLIPLGTGNLLARNVDLDVTDIADCIQVALFGHQ
FT                   RFIDTATMGIDNDITGESAEHTFLVIAGMGLDAEVVGDTRDNLKKSVGWLAYTEAGVRH
FT                   LPGRRKRVTITMDDQPEQTRKIRSVLFANCGLIPGGIDFIPQAMIDDGMLDIVVMSPRS
FT                   AFGWLAMYTKVLFKHNANLPMMSFYRSGKVTIRSQEPMATQLDGDPSGEATTVTVQVAP
FT                   GSLLVRVPKAKTA"
FT   gene            105955..107235
FT                   /gene="serS"
FT                   /locus_tag="AAur_0103"
FT   CDS_pept        105955..107235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="AAur_0103"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09166"
FT                   /db_xref="GOA:A1R120"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R120"
FT                   /protein_id="ABM09166.1"
FT                   /translation="MIDVKDLSENPDKFRASQRARGADESVVDAIISADSDRRAALIRH
FT                   ETLRAEQNAFGKKVAQAKGEEKQALLAEVKELANSVKAASAEAAAAQAKQEELLRVIPN
FT                   LVVDGVPEGGEDDYVVLKTVGTPREFTDFEPKDHLEIGELIGAIDMERGAKVSGSRFYF
FT                   LRGVGARLEMALLQMAMEQAIDAGFVPMITPTLVRPETMQGTGFDVKHDAEIYRLAEDD
FT                   LYLVGTSEVALAGYHADEILDLSAGPIRYAGQSSCYRREAGSHGKDTRGIIRVHQFNKV
FT                   EMFIYTTVEEAAAEHERLLAWEEEMLAKCELPYRVIDTAAGDLGMSAARKFDCEAWVPT
FT                   QNAYRELTSTSNCTTFQARRLNIRERVINDEGVAKGTRAVATLNGTLATTRWIVAILEH
FT                   HQNPDGSVNVPKALQKYLGGLEVLPVL"
FT   gene            complement(107266..108294)
FT                   /locus_tag="AAur_0104"
FT   CDS_pept        complement(107266..108294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07811"
FT                   /db_xref="UniProtKB/TrEMBL:A1R121"
FT                   /protein_id="ABM07811.1"
FT                   /translation="MDYGNEFIVTARYALETGASRQLSRRYEKGELVRVRRGIYTDKQH
FT                   WLALKPWERYRATARAVAAENPSVDFCYETAALFWGLQIVGVPSHIHLANASRGHAGAR
FT                   SPSTIAAALNPSGTNGLERIRAYGIYRHHYNTVTVFHRGLQLTNLVQTAVDVISRGSFS
FT                   HGVVLADHVISASRFKKLFTSKEALEKAAGNLSSEAKRQRVNHILEFANQNSGSAGESL
FT                   SRAQMLLLGFPPPELQIEFYDTEGFIGRTDFFWREQGIIGEFDGDAKYLRDEYLGGQSA
FT                   REAVLAEKKREDRLRALGFTIVRWDWATAKDPAKLYAKLLAKGLAPTRNTHLRTIHPRA
FT                   RG"
FT   gene            108513..109358
FT                   /locus_tag="AAur_0105"
FT   CDS_pept        108513..109358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0105"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08597"
FT                   /db_xref="GOA:A1R122"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1R122"
FT                   /protein_id="ABM08597.1"
FT                   /translation="MTILTDTPVAGIDDQPNNNNKLMIALDVDGTLVDHDGHMSPAVRS
FT                   AAQAVVASGHNVMIATGRSLNATLPIIQQIGLERGYAVCCNGGVTLRLDPSLDKGYEII
FT                   HKATFDPAPALKALRERLPNAKYALEDEDGNFLSTERFQDASFGVESIGVDFQTMLDST
FT                   AVRVVVFSSENTSEEFNEAIRHIGLSGVTYSVGWTAWLDIAAEGVTKASALEALRHKLG
FT                   TDQANTVAVGDGRNDIEMLTWAGRGVAMGQAPDEVIAVADEVTASVLDDGAAQVLLSVL
FT                   "
FT   gene            109397..110251
FT                   /locus_tag="AAur_0106"
FT   CDS_pept        109397..110251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0106"
FT                   /product="putative transcriptional regulator, AraC family
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07803"
FT                   /db_xref="GOA:A1R123"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1R123"
FT                   /protein_id="ABM07803.1"
FT                   /translation="MFYEECPAPPILQPFVTRLWFVRAQPQARYEKILPGPEAHLILNL
FT                   SDPYRLISPSESSPAGSTEQPKATEVSTGFYAGLQRSYLISENPDQLFNVGARLTPYGL
FT                   AAFTSQPPSGFQNRVVDAESIFPGFSELRSPLTRAEPEQAFTALSTFLQQRLRPSYRAD
FT                   PRVVKAAEILAREDVEIGVLAAELGISTSTLERIVMRDCGTTAKAYSDVCRFNRIVNQA
FT                   AALPKGAVPGRDLLHLADYYDQPHLIRSFRRFSGFTPTEYLQVVQSYGAEYATFVPLEQ
FT                   VTG"
FT   gene            110330..110725
FT                   /locus_tag="AAur_0107"
FT   CDS_pept        110330..110725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0107"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07486"
FT                   /db_xref="GOA:A1R124"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniProtKB/TrEMBL:A1R124"
FT                   /protein_id="ABM07486.1"
FT                   /translation="MDIQINWLAVLLAALATFVVGGLWYSVLFAKPWQKAAGVSDEQLK
FT                   SGTARVFVGSFVLAVVMAVFLAAFIGRGGFAFGSFAGLAAGLGWVATALGVNYLFERRS
FT                   LTLFAINGSYNVVTFTAMGAIIGAMQG"
FT   gene            complement(110742..111482)
FT                   /locus_tag="AAur_0108"
FT   CDS_pept        complement(110742..111482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0108"
FT                   /product="ANTAR domain protein"
FT                   /note="identified by match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06346"
FT                   /db_xref="GOA:A1R125"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1R125"
FT                   /protein_id="ABM06346.1"
FT                   /translation="MEDPQLAEPSTVLSDIQDLLLSTPDVEAFLEELARHSSEMFTSPD
FT                   HEVYCGITLMRHRNAGTVASSSERAKQLDEVQYAFADGPCLHACREGTQVHIPDFEKDN
FT                   TWPDYNEAITDHGLRSVLAVPFPLPDDSSRAGLNLYSDRPNAFDQAAVQRANDYVQQAS
FT                   KGLQLAVLIAQHSQTAANLKAAMESRTVIDIATGIIIAQNRCTQEDAMELIKKASSNRN
FT                   VKLRVVAQAIVESAGGGPIQTVFK"
FT   gene            111624..112400
FT                   /locus_tag="AAur_0109"
FT   CDS_pept        111624..112400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0109"
FT                   /product="putative RNA polymerase sigma (70) factor"
FT                   /note="identified by match to protein family HMM PF04539;
FT                   match to protein family HMM PF04542; match to protein
FT                   family HMM PF04545; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09606"
FT                   /db_xref="GOA:A1R126"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1R126"
FT                   /protein_id="ABM09606.1"
FT                   /translation="MRQTRPFDVRTTPPAGAPEGSIRQSFQDSLVLDHLNLAKSIAARY
FT                   SAHTHDLDDVRQVAYMGLIKASRGYDEAKGVSFPAYAAPTIAGEVKRYLRDHCWVVRPP
FT                   RTIQDVRRQVLARTEEMTQTLQRTPSPEEVAEDLNLEPCQVREALMAGTSKRPDSLDAP
FT                   ASDGRDGLQGSLSAFGCPTDRLEDVLALRNAIRGLSAEDRHLLYRRYYREETQSTIAEA
FT                   LGMSQMQVSRKLSKILVSLQTQLLDEEAQLLDGTAP"
FT   gene            complement(112408..113370)
FT                   /locus_tag="AAur_0110"
FT   CDS_pept        complement(112408..113370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0110"
FT                   /product="heptosyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06328"
FT                   /db_xref="GOA:A1R127"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A1R127"
FT                   /protein_id="ABM06328.1"
FT                   /translation="MDTALDSQENNDQPLLLALRALKLGDLLVAVPALRGLRRAFPEHR
FT                   ILYAAPAWIAEALQLVGGIHHLPTPGLDDPLTVPRGAVDIAVNLHGNGAESRMRIEELQ
FT                   ANRVVAHGSPGTDGPEWTTGIPERERWTRLLNWHGIHADPLDYRLNRPAVPSPRPLATV
FT                   IHVGAAYGSRLWPVERFADVAVELAAAGHDVVLTGGVSERGRAEETAALAKRKGANLDD
FT                   GLLAGEQGLAEFAATIAEARLVVSADTGAAHLASAYERPSVVLFGPAPAEEWGPPPGPH
FT                   VVLTAVELRRGDVFSTDPDPALLAVSVRDVLDAVERLGC"
FT   gene            113457..114011
FT                   /locus_tag="AAur_0111"
FT   CDS_pept        113457..114011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0111"
FT                   /product="haloacid dehalogenase-like hydrolase protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549; match to protein family HMM
FT                   TIGR01656; match to protein family HMM TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06692"
FT                   /db_xref="GOA:A1R128"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1R128"
FT                   /protein_id="ABM06692.1"
FT                   /translation="MGGTGTLKAVLFDRDGTLVVDVPYNGDPQLVRPMDGALSALEKVR
FT                   RAGLATGVVTNQSGVARGLLTLEQMHSVNQRVEQVLGPFDVWEFCPHGPDDRCHCRKPE
FT                   PEMILAACLALGITPGEAAFVGDIGADMKAAAAAGARAVLVPTSVTRREEIEAASSVAE
FT                   DLGHAVELLLSGALDEQDAPV"
FT   gene            114008..115096
FT                   /locus_tag="AAur_0112"
FT   CDS_pept        114008..115096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0112"
FT                   /product="heptosyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09733"
FT                   /db_xref="GOA:A1R129"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A1R129"
FT                   /protein_id="ABM09733.1"
FT                   /translation="MSRVLVARLDSMGDVLLSGPALRAVANGSRPDGSRPNDVVLLCGP
FT                   EGSSAAEMLPGVTQVHTWACPWIVNPAPPPTQETTNALIDFVRSSRIEEAVILTSFHQS
FT                   PLPLALLLRLAGVQKITGASTDYAGSLLDVRLKPGEDFPEDQPEVVRALTIAEAGGYVL
FT                   PNGDDGKLRITSGPDPEGLAEELADEGPYIVVHPGAAAPARAWPALHNAATVELLEAYG
FT                   HRVVVTGGPGETSLTATVAGPSARNLGGGTNLRTLAAVLAGAAVVVTGNTGPAHLAAAV
FT                   GTPVVCLFAPVVPAIRWAPYGVPLELLGDQDAACKNTRARVCPVPGHPCLSSVTPEQVV
FT                   EAVERLLGGVSSLSTRRKVWKP"
FT   gene            115093..116178
FT                   /locus_tag="AAur_0113"
FT   CDS_pept        115093..116178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10176"
FT                   /db_xref="UniProtKB/TrEMBL:A1R130"
FT                   /protein_id="ABM10176.1"
FT                   /translation="MRILVWHVHGGWMEAFVRGRHEYLLPTSSDGGAWGLGRGGREWPA
FT                   AAQEVDLESLDPGSVDAVVLQRPEEIAAVARALGRRPGVDLPAVYLEHNTPKGDVPFTL
FT                   HPLADQSTIPVVHVTHFNQLFWDTGTATTTVIEHGIPDPGHLYSGEQEEMGVVVNEPVR
FT                   RGRVTGTDLLPGFAGVGPLRVFGMGTEDLREALNLKRSGLSEERLRIAGDVPAPKLHQE
FT                   LARCRLYLHPLRWTSLGLALLEAMHLGMPVLALATTEASRAIPRGAGLVSNDVDDLRKF
FT                   ARRLLDDPDDAYAMGIIAREAALQRYGLNKFLGAWDQLLAELPKATRSGSRPQSGTAFA
FT                   RHDTDARHDTDARHDTERTHP"
FT   gene            116175..117443
FT                   /locus_tag="AAur_0114"
FT   CDS_pept        116175..117443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0114"
FT                   /product="putative glycosyl transferase, group 1 family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08591"
FT                   /db_xref="GOA:A1R131"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1R131"
FT                   /protein_id="ABM08591.1"
FT                   /translation="MKVSMVSEHASPLAALGGVDAGGQNVHVAALSSSLAERGHQVTVY
FT                   TRRDDPALPAKVQVSPGLTVVHVDAGPARRIPKDELLPFMGELADGICADWAGQLPDVM
FT                   HAHFWMSGLAAIQASRRAGASDPVPVVQTFHALGSVKRRHQGAADTSPPARAWLEPWVG
FT                   RAADWVIATCPDEVFELKALGISRSKISIAPCGVDLTLFPGTSDAEPKSRTHRILSVGR
FT                   LVQRKGVDLIIQALPLLAEAGFNDVELLIVGGSGDALTLEEDPEAQRLHALAKELGVEE
FT                   NVTLRGQVPRDAMPGIFRSADAVVCAPWYEPFGIVPLEAMACGVPVVAAAVGGLRETVV
FT                   DQKTGLHVPPRNPEALAEALAKLLADPGLRSDMGRAGARRARSRYAWERIAADTEKAYR
FT                   SVLAAGLSRQADEGLEPLEGTAL"
FT   gene            117500..118132
FT                   /gene="gmhA"
FT                   /locus_tag="AAur_0115"
FT   CDS_pept        117500..118132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="AAur_0115"
FT                   /product="phosphoheptose isomerase"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM TIGR00441"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09057"
FT                   /db_xref="GOA:A1R132"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A1R132"
FT                   /protein_id="ABM09057.1"
FT                   /translation="MPARWSPDTSNSTHHAEVTTHLDNVLPALESLRSQSGRLSEWGTE
FT                   LAKRLLSGQRLLAAGNGGSAAEAQHLTAELVGRFDEERAPFSAISLHAESSALTALAND
FT                   YGYEEVFARQVRAHGRAGDLLILLSTSGRSPNLLKAVRAARERGITTWALTGPGPNPLA
FT                   EACDQAITVDAIAANAQEGHLIAVHAVCRAFDAEVARRASTHGGSQP"
FT   gene            118129..119538
FT                   /gene="rfaE"
FT                   /locus_tag="AAur_0116"
FT   CDS_pept        118129..119538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="AAur_0116"
FT                   /product="rfaE bifunctional protein"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by similarity to SP:P76658; match to
FT                   protein family HMM PF00294; match to protein family HMM
FT                   PF01467; match to protein family HMM TIGR00125; match to
FT                   protein family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06844"
FT                   /db_xref="GOA:A1R133"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R133"
FT                   /protein_id="ABM06844.1"
FT                   /translation="MRITVVGDVLLDVDINGAATRLSPDAPVPVVDVADIRRRAGGAGL
FT                   VATVLAHDGHEVALVTALGNDDGASHLRRALTGVSVLAGAPLAPTPTKTRVRIGTHPMV
FT                   RFDEGCAPAPIPLSTAEMLAAIASAEAVVVADYGRGITTNPDIRTALAEAARRVPVVWD
FT                   PHPAGSEPVAGVAVVTPNLAEATASATTGGLDPSRTGAEEAGRYLLGKWGSGAVLVTRG
FT                   EDGAVLLSAGGRAQGIPALKTNVADPCGAGDRLAGSLAVHLRLGLELAQAATKAVEDAS
FT                   AFLAAGGAASLAVVGEAPAASPAVEFKGLELVDAGDLSPDGVHLARAVRSRGGTVVATG
FT                   GCFDLLHAGHARTLAAARSMGDCLIVCLNSDESVRRLKGAHRPIVSVEDRAELLLALEC
FT                   VDAVVVFGEDTPEACLSEIRPDIWVKGGDYTPQELPEARLVAGWGGRCVTVPFHPARST
FT                   SGLAAALAKVS"
FT   gene            119570..120265
FT                   /locus_tag="AAur_0118"
FT   CDS_pept        119570..120265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0118"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07268"
FT                   /db_xref="GOA:A1R134"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R134"
FT                   /protein_id="ABM07268.1"
FT                   /translation="MNTQTPGRVIVTGGGSGLGAAIVEAIRDAGGTPFVFDRDVSNVSG
FT                   AKALEVDVSNREAVEAAVKEAAETLGGLDGVVTAAGIDRCGKLGDVPAEEWEKVIGVNL
FT                   LGTVSVIRAALPYLKGSRGRAITIASTLGLRALPDATAYCASKFGVIGFSRALAAETGG
FT                   VIGVTTIIPGGMKTHFFDDRDEQYKPQDDSKLNDPANVAQAVVFALSQPFGSEVRELLI
FT                   CPAEEGSWP"
FT   gene            complement(120231..121550)
FT                   /locus_tag="AAur_0117"
FT   CDS_pept        complement(120231..121550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0117"
FT                   /product="heptosyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06389"
FT                   /db_xref="GOA:A1R135"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A1R135"
FT                   /protein_id="ABM06389.1"
FT                   /translation="MGLQFPVPLRYPAARASHAEPGSFRPESLRRRSYGRARPQHWQRK
FT                   ESSMEKPLTNPSPGVGPVLEKFNDVKRIAVLRGGGLGDLIYTYPALTALKNAYPDATIT
FT                   LLGTPVHAAVVAAMDGPVDDVLMLPVARGVHDGPRNGERFEDDAEDVAEQEAFFEAMRA
FT                   KKFDVALQMHGGGRFSNPFLLRLGARHSVGTRTRDAERLERNLDYVYYQNEPDRWLELA
FT                   GLAGAPPIVAPPLRPRPEHHRNIAGFRDPQRRSLVVVHPGATDPRRRWPASNFAEAVAA
FT                   AAAEGAQVLIVGDSSEKALTQEVEELAVRQLAEEDRMAVRSVAGELDIGDLAALLADAT
FT                   VMLASDSGPRHLAQAVGTPTVGIYWVGNAFNAGPRGRSLHRVHMSWVTRCPACGADVTQ
FT                   VGWTAPHCGHDDTLIRGIAVADVVQDVLDLTATSLLLRGK"
FT   gene            121565..123142
FT                   /locus_tag="AAur_0119"
FT   CDS_pept        121565..123142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0119"
FT                   /product="ADP-heptose synthase"
FT                   /EC_number="2.7.-.-"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM PF01467; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08963"
FT                   /db_xref="GOA:A1R136"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R136"
FT                   /protein_id="ABM08963.1"
FT                   /translation="MARLSNQEGLANQEGLADWLPGRLAEERPVVTVIGDSILDGWWDG
FT                   TIDRFCREAPAPVVQVQRRDFAPGGAANTAMNLAAMGADVRFVSLVGQDSGGHKLLEQL
FT                   SSAGVDVSHVVAHEGMTTTTKFRVSSGGQVMLRLDDAATEVPADGLRQMAAAIPEALRT
FT                   SSAVVLCDYGAGALDGAVRDAIFHHLGPGNDGPDSVEARSSNARQDTLLVVDAHYPGRW
FT                   AQLRPDLSTPNAQEAARLLGTEFPGGAARCPFVEAHADQLLRASGAAAVVVTLDREGTL
FT                   TIRRNDTSQKPATHRTWARPQAEKQASGAGDTFVAALTIARAAGLPLTTSVNLAQAAAD
FT                   VVVHRPGTSVCTTEELAKHLRGFADTALTDEELARQVDEHRREGKRIVLTNGCFDVLHR
FT                   GHTRYLNQAKQLGDVLVVALNSDSSVRKLKGPDRPVNHEADRAAVIAALSCVDHVTVFD
FT                   TPTPIPLIDLLRPDVYAKGGDYTPEMLQETEAVERYGGTVTILDYVPEHSTTAVLERIR
FT                   STGEPPQS"
FT   gene            123153..124187
FT                   /locus_tag="AAur_0120"
FT   CDS_pept        123153..124187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0120"
FT                   /product="putative NAD dependent epimerase/dehydratase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08066"
FT                   /db_xref="GOA:A1R137"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R137"
FT                   /protein_id="ABM08066.1"
FT                   /translation="MRIVIIGATGHGGTELLKRLQRARSEEGADLELVGVVRRQPDQDA
FT                   APYHGVEWHTLDISAAEDQPALEEALAGADALVHLAWLIQPNHNREMLRRTNVAGTAHV
FT                   LAAARKAGVGHIVCASSVGAYSPAPKDQRTKEGWPTGGIRSSHYSADKAAQERLLDGFA
FT                   KENPDIVVARLRPALMFSAGGGSEVGRYFLGRVLPRLVPRKPWLPLLAIPKEMVFQAVH
FT                   TADVADAYWRVLERRAEGAYNIAAEPVIDPNALAWIFNARRVMPFPLPVLRAVVEVSWR
FT                   LRLQVTDGGWVDMAANAPIMDTARAHTLLGWSPKHSSLESLAEMLDGIGAGKGRKGSPP
FT                   LTPR"
FT   gene            complement(124191..125264)
FT                   /locus_tag="AAur_0121"
FT   CDS_pept        complement(124191..125264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0121"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08736"
FT                   /db_xref="GOA:A1R138"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A1R138"
FT                   /protein_id="ABM08736.1"
FT                   /translation="MPLRRRLIPALRKTITRHRLLFAAKTAVAAGLAWYLAPFMPGSAA
FT                   EYPYYAPLGALVSMHPTVADSAKHGLQSLAGLVLGIGMAFAITTVAAPTALAVAVVVGL
FT                   GVLIGGLPRLGTASEWIPMAALFVLVLGDSNAEGFSFAYVLQMALGVAVGFAVNWLVFP
FT                   PLHLEDIDPAIAGHQEALSRQLKDMARAMEESWPPNHEAWASRSDELSLTAAAVRTAVH
FT                   QAELSAKANPRSRRRATRLPGDLAGLRTLERLTFHVQDITDVLASAIWEKDAGTVIPDA
FT                   VVGNLSEALEATAAVIDHWRDAENGELANRLARAKDSITALSNAVAEAAADQSSVNAPA
FT                   SVAMSLRRILTVVLSAE"
FT   gene            125352..126389
FT                   /locus_tag="AAur_0122"
FT   CDS_pept        125352..126389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07169"
FT                   /db_xref="UniProtKB/TrEMBL:A1R139"
FT                   /protein_id="ABM07169.1"
FT                   /translation="MVIRTLVSGYTPIDSNDTYYPGCCPQPANCGKRAIMTESKSPQDG
FT                   SFAAPNTGAHAGTEPFTGNYLDSADVETQTAGTTGISGTPAGSGTGSDSSGKVDTAKEE
FT                   AAGVAGAVSDAAGGVVDTAKTEAGHVAHEVKVNARQLLTQTKGELSEQAQAQQQRVAEG
FT                   LRSISDELSTMANSTENGGVATDLVQQAAQRSSSVAQWLEGRDPGSLLDEVKGFARRKP
FT                   GTFLLLAAGAGVLAGRLGRGMAGNASDAASASGTPATTETPRAVYYPTQGGAVTPPAVD
FT                   LPGPTATTAGYGSATTTGYDAGTTGGYDGSTLPYPETEAGGVKAQGDPLAGPLDPDDPQ
FT                   YGGHR"
FT   gene            126386..126817
FT                   /locus_tag="AAur_0123"
FT   CDS_pept        126386..126817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0123"
FT                   /product="putative protein of unknown function (DUF1469)"
FT                   /note="identified by match to protein family HMM PF07332"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09400"
FT                   /db_xref="GOA:A1R140"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A1R140"
FT                   /protein_id="ABM09400.1"
FT                   /translation="MSSPADLPPTEAHVKAETLPLGELLSDLTRDVSTLMRQEVELAKA
FT                   ELKESATKAGKGAGMLGGAAYAGHITVLFLSIALWWALGQLVGLGWSAVIVAVIWGIVA
FT                   AVLAAKGRKELNTIKGMPQTAETVKEIPPALKPNTEETR"
FT   gene            126814..127410
FT                   /locus_tag="AAur_0124"
FT   CDS_pept        126814..127410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09816"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:A1R141"
FT                   /protein_id="ABM09816.1"
FT                   /translation="MTQNPDALRADIEETRRRLSTNVDAVADKVTPSHIVNRRVDKIKT
FT                   AVFGARDDVSDAAGNAAHRAGDAVSGVASNVSGAVSDLGDAPQVITRKAQGSPIAAGLI
FT                   AFGAGLLVSSLFPASEKEREAAQAVKEAAQPLTDELSHAAQEVAEHLREPAQDAMQNVK
FT                   DSATEAAANVKDEGQAAAADVQDRAQTAKDNVSNQ"
FT   gene            complement(127493..128092)
FT                   /locus_tag="AAur_0125"
FT   CDS_pept        complement(127493..128092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06317"
FT                   /db_xref="UniProtKB/TrEMBL:A1R142"
FT                   /protein_id="ABM06317.1"
FT                   /translation="MFTLTINQRDSRRDGDLVPQLLKDLRHIPARLDFDRSVEDEVQGI
FT                   VECSHQAVETALIALRTGQWYVGIGVGPINEPLPNLVKDASGHGLVYARRAVDRLRNGK
FT                   ERVPVAVDGPLTALASEAEAVLRLLGHIVQHRSTAEWRVLDLLTPGVRGQQKAVAQELG
FT                   ITTQAVSKALARAQWSEEHAARPAAARLLQMILEVR"
FT   gene            complement(128151..128786)
FT                   /locus_tag="AAur_0126"
FT   CDS_pept        complement(128151..128786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07287"
FT                   /db_xref="GOA:A1R143"
FT                   /db_xref="UniProtKB/TrEMBL:A1R143"
FT                   /protein_id="ABM07287.1"
FT                   /translation="MRGRNWLVRRVERRLGPELGGLRHVASSRRVFWKALIPCLVVGFV
FT                   FGTIAEFVSPIRSTREAGHFSDPTLFITVGILTGLLLWSMTLLGSFRKLLVFDRGAVAK
FT                   YSQKHTMVVIPWSDIVPGSIKAVTTADGSDPDRRLVARQKVSLGAGGRNALVFQARDTH
FT                   WVFASDEDPQPLVIAIRECLRDAGMDDAVRATAGALPAVVLTGRTALD"
FT   gene            complement(128773..129408)
FT                   /locus_tag="AAur_0127"
FT   CDS_pept        complement(128773..129408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0127"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07984"
FT                   /db_xref="GOA:A1R144"
FT                   /db_xref="UniProtKB/TrEMBL:A1R144"
FT                   /protein_id="ABM07984.1"
FT                   /translation="MSTPKSTTLTGLLDAVNGRPVRRHPETGAYFVKASGGAHFWGRVL
FT                   DALVFLVGYAVLAVILAVVRESMMNSGSALGYNDGLWLTLYVVLWFVGLFAYGMIWGSV
FT                   GSVGDAAAGMRSVRIKNGTTAGAWLGGWRAICWSFFPFFVVMLIASAVSGGGDDTWEPK
FT                   FAAIDRRSGIAQGQQPVPDPKVVAAEQAAEAERRNMPNLYGQRPDARP"
FT   gene            complement(129456..130232)
FT                   /locus_tag="AAur_0128"
FT   CDS_pept        complement(129456..130232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0128"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06790"
FT                   /db_xref="UniProtKB/TrEMBL:A1R145"
FT                   /protein_id="ABM06790.1"
FT                   /translation="MTASTMNWTERDVQAAAKVLASASATGAPLPTLTDEEVVALDGAQ
FT                   HEQLVALPWLSAQDASKELMCAVALRGLLAKELVYPVIFEGEAEPSRLHATEEITGALT
FT                   LRRSGSSVVSVERTVSTGKRWLYSYLHDDGVLLEEVDEGGLHGFTVITRDQLAQRLAEF
FT                   VDPEKAAERDTDPTGYTEAQFEEHAATALADTLAASTVVAFNSDTNEFPTITVYTGPSG
FT                   VHVLTPQVDGDSVSLELKETSAASLAGVLGGLAGLA"
FT   gene            complement(130229..131242)
FT                   /locus_tag="AAur_0129"
FT   CDS_pept        complement(130229..131242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0129"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09562"
FT                   /db_xref="UniProtKB/TrEMBL:A1R146"
FT                   /protein_id="ABM09562.1"
FT                   /translation="MAGFYGADIAQLRSLAGVMGKAADAISLQSTQLSNAINSTTAWQG
FT                   RDATVFKGDWNSQHRQSLVKAANMLRENASQLKKHANQQEFASHNDGSGTSVGVLKDVY
FT                   DTAMGAKGAISPLVAAVRYVLPVKPLPNGVIDPRHVRYGKTKEILTNWRAGGTVLRDGI
FT                   TALRNGEKVTDVITDLKANIPYSQAFQEASKFSKGLRIAGALAAPLNIVGGISDMINPQ
FT                   HDGWRGTGDRVAGGLSVVGGVGSIMLMTAGGAALLGPIGAPIVIGAGLVAGAWALGNLV
FT                   ADNWDSISNFARNPGSYIADGAKEVAGFAKDVGSKVADGVSDAAKSVGNFVGGIFG"
FT   gene            complement(131442..131930)
FT                   /pseudo
FT                   /gene="ppa"
FT                   /locus_tag="AAur_0130"
FT                   /note="inorganic pyrophosphatase; this gene contains a
FT                   frame shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF00719"
FT   gene            132078..133523
FT                   /gene="dacB"
FT                   /locus_tag="AAur_0131"
FT   CDS_pept        132078..133523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="AAur_0131"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF02113;
FT                   match to protein family HMM TIGR00666"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09949"
FT                   /db_xref="GOA:A1R147"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1R147"
FT                   /protein_id="ABM09949.1"
FT                   /translation="MGVKNGGARKRVPAAWGRFTWPVLLTTVLLCLGAVVAVGMFPGLL
FT                   SFPKPLPSVPAWQQVPDRLSGANSVLPLDPKAPVPVPAEVAKLLDATLKPDGAGSISGV
FT                   VMDASTGQVLFDREATANRIPASNMKLLTAVSALKVLGPETRFTTRVLASDNPSTVVLT
FT                   GGGDVLLGTSASEPTAVLGRAGLASLAADTAAALASAGVKGPVTVQVDDSLFSGAPLNP
FT                   AWSLEDVAAGETAPLYSLALNSGRYAPDVLTGPRPLDSALATAQTFAEQLAAAGVAVSP
FT                   GVERGKGIPAKELAAAESATIGEQVDLMLESSDNFLAEALGRMTALASGHEGTYDGATA
FT                   AVRQRLGELGIATDSMQLADVSGLALENQVTARQFAEVVRAITSGPDPALRTALDGFPV
FT                   AGLTGTLDDRYVDAGTSEGAGLVRAKTGTLNTVLALSGYVVDADGRLLVFSFIGNGLDP
FT                   GAAGNKVALDRSASVLASCGCRG"
FT   gene            133584..134705
FT                   /locus_tag="AAur_0132"
FT   CDS_pept        133584..134705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09243"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A1R148"
FT                   /protein_id="ABM09243.1"
FT                   /translation="MVSSARDSSAGAPSLINWDLAASTAARLAPPGPELSAGEIGKAVD
FT                   NLRFNADISVPHVHDITGLDAARDLRDSHVLVVDRASWSKANTQSFSVMLQPALKKMLE
FT                   NRSGVAMTPAAAAASGAITGTQLGAVLAFLSSKVLGQYDPFAALAPDSNVPPGGRLLLV
FT                   APNIISVERELNVHPDDFRLWVCLHEQTHRVQFAAAPWLRHHMLDEIEKLSGNLLGNMD
FT                   TLVERASAVAKSLRDRNPSEKTPGRGAILDLLQNPEEKASLSHITAVMSLLEGHANVVM
FT                   DAVDSSIVPSVKTIRQRFNERGKDRGVVEKFIRNLLGLDAKMRQYTDGAKFVREVVAVA
FT                   GMEGFNRVWESAEYLPTEEEIHNSKLWLERMGL"
FT   gene            134798..135868
FT                   /locus_tag="AAur_0133"
FT   CDS_pept        134798..135868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0133"
FT                   /product="putative tRNA(Ile)-lysidine synthetase"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07880"
FT                   /db_xref="GOA:A1R149"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A1R149"
FT                   /protein_id="ABM07880.1"
FT                   /translation="MQNALASAGYPSRVLVACSGGPDSLALAAVAAYFARRGHVDGHPV
FT                   SVAGVVVDHQLQAGSAEVAARTASVLRELGLSPVEVRTVEVASTGFGPEAAARDARHAA
FT                   LESAADHLGCDAILLGHTLDDQAEQVLLGLARGSGTRSLAGMRPARGRLLRPFLGLRRE
FT                   ETLEICEVEELDPWHDPSNADPAFARSRTRVEVMPVLEEKLGPGVAESLARTAAILQQD
FT                   ADFLEDLANETYLSLVQRVDDGAWLPEDAVRELPAALRFRVIAKAAADVGGQQPGYGRL
FT                   QAAEALLRRQGSAGPVELPGHVSVYRLSLSDLEQEGPVSAGASSAFSAGAAADGVPRLA
FT                   PRCGKLVFRHQKPSQQ"
FT   gene            135900..136451
FT                   /gene="hpt"
FT                   /locus_tag="AAur_0134"
FT   CDS_pept        135900..136451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="AAur_0134"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06301"
FT                   /db_xref="GOA:A1R150"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1R150"
FT                   /protein_id="ABM06301.1"
FT                   /translation="MDSNDVQADLKHVLYTKEQIQTRIAELAAQIDKDYEGRDILIVGV
FT                   LKGAVMVMADLARALHSHVSMDWMAVSSYGSGTQSSGVVRILKDLDTDLMGKDVLIVED
FT                   IIDSGLTLSWLKSNLESRGTASVEICTAFRKPTAAKVEIDVKYVGYDIPNEFVVGYGLD
FT                   YAEKYRNLDFVGTLAPHVYE"
FT   gene            complement(136679..136789)
FT                   /locus_tag="AAur_0135"
FT   CDS_pept        complement(136679..136789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09253"
FT                   /db_xref="UniProtKB/TrEMBL:A1R151"
FT                   /protein_id="ABM09253.1"
FT                   /translation="MRAEKGTTSESEHAVRIGHQRQTDTGSELYDATDTA"
FT   gene            136850..137800
FT                   /locus_tag="AAur_0136"
FT   CDS_pept        136850..137800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09042"
FT                   /db_xref="UniProtKB/TrEMBL:A1R152"
FT                   /protein_id="ABM09042.1"
FT                   /translation="MRRWRLGGACGGCRCSSGYRMSLPSRRPSALNLTMTGAPARLLAW
FT                   LAVMATLLTACTPAVDSTVLDAGQPIATSSSVPPRGDAAVPSTSATQAPSPAPPPAPAP
FT                   APPPPPAPPAVPQAFAVNLYQEGDFVPQYTFDWCVAASIQMAHNLVDDTGGGSWASSAQ
FT                   QSELWEMARARSSNSFNGANPRGWAQVLTEVGMGAYTVVSIANYEDTLQTAARAIAETG
FT                   RPVGLVMWSGRHAWVMSGFESMGDPSQFPEFQVTGIRVLDPLYPYGSGQWGPSPEPNSL
FT                   LTPEQLATQFVVREPRRWSADLPTGYLLVLPVAAA"
FT   gene            complement(137863..138840)
FT                   /locus_tag="AAur_0137"
FT   CDS_pept        complement(137863..138840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08471"
FT                   /db_xref="UniProtKB/TrEMBL:A1R153"
FT                   /protein_id="ABM08471.1"
FT                   /translation="MAFPELLLASDATRIGQDARQLAKRAMRGELVRVRRGTYVRSAYW
FT                   AELNNRQRHGLQAAALVNTTRTAPIFNLQTAALLWGLGVVGVPKHLCTVTADPTGGRSK
FT                   HGIRRSFGACDTGVVQLGAFRVTDKVRTTMELAAALNFAEALAIVDSSRRTQRWGDALE
FT                   VDDWNKDRAWGPPSDVDELGDAVSAFTSQSRKRRAGTILELSTDKSESVGESMSRAQMI
FT                   LLNFPTPSLQGSFTLRTGRTARTDFWWPELDLVGEFDGYGKYLRNKLRGNLTIQQAVMA
FT                   EKARENGLRALGLTVIRWDWSDMMNPRMFARILNDGGLRSLRVA"
FT   gene            139278..141347
FT                   /locus_tag="AAur_0138"
FT   CDS_pept        139278..141347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0138"
FT                   /product="putative cell division protein (ftsH)"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09312"
FT                   /db_xref="GOA:A1R154"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1R154"
FT                   /protein_id="ABM09312.1"
FT                   /translation="MKAKSFFKGPGIWIVVVVGLLLVAFATLAPGGSTRIDTKEGLELL
FT                   SQSGKVEQAKIFDAENRVDLVLKDNLNLDGQDKGKNVQFFYVTDRGPDVVKAVTNANPD
FT                   KGFTDQPVENNWFSGLFSLLIPVLLLGVLFWFLLSRMQGGGSKVMQFGKSKAKLVNKDM
FT                   PQVTFSDVAGADEAVEELQEIKEFLQEPAKFQAVGAKIPKGVLLYGPPGTGKTLLARAV
FT                   AGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKASSPAIIFVDEIDAVGRHRGAGI
FT                   GGGNDEREQTLNQLLVEMDGFDVKTNVILIAATNRPDVLDPALLRPGRFDRQITVEAPD
FT                   MIGREQILNVHAKGKPMAPGIDLRGVAKKTPGYTGADLANVLNEAALLTARSNANLIDD
FT                   RALDEAIDRVMAGPQKRSRVMKELERKITAYHEGGHALVAAALRNSAPVTKITILPRGR
FT                   ALGYTMVIPEDDKYSVTRNELLDQMAYAMGGRVAEEIVFHDPSTGASNDIEKATSTARK
FT                   MVTQYGMSERVGAVKLGQGGGEPFLGRDAAQERNFSDQIAYVVDEEVRRLIDQAHDEAY
FT                   AILTENRDVLDRLALELLERETLNQTEIAEIFHDIRKRDFREIWLSKESRPVQSIPPVE
FT                   SRAEKAERQAQEEAKQARLDEPLDVVAPHAQGVSSQDSFQAPQPDGGNDHPHHG"
FT   gene            141357..141992
FT                   /gene="folE"
FT                   /locus_tag="AAur_0139"
FT   CDS_pept        141357..141992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="AAur_0139"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06740"
FT                   /db_xref="GOA:A1R155"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A1R155"
FT                   /protein_id="ABM06740.1"
FT                   /translation="MTHFDDDDDLAAAHGSAAGSKHDHKVDRPRIEAAVREILLAIGED
FT                   PERGGLLDTPKRVAKAYAEMFAGLHQHPVDVLSTTFDLDHEELVLVKDIPFYSTCEHHL
FT                   VPFHGVAHVGYIPSHDGKVTGLSKLARLVDIYARRPQVQERLTTQIVEALVTHLNPRGA
FT                   IVVVECEHMCMSMRGIRKPGAKTVTSAVRGQLHDPATRAEAMSLILGR"
FT   gene            141998..142903
FT                   /gene="folP"
FT                   /locus_tag="AAur_0140"
FT   CDS_pept        141998..142903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="AAur_0140"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06645"
FT                   /db_xref="GOA:A1R156"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1R156"
FT                   /protein_id="ABM06645.1"
FT                   /translation="MDSLAAAPGTGPATSPLPILRKPRPAARFEDLPTDRTLVMGILNV
FT                   TPDSFSDGGTHRTPDTAIALGLRMFYAGADIIDVGGESTRSGAEPVSPEEEQRRVLPVI
FT                   QALVKAGALVSIDTMHTSTAAAAIEAGAAIINDVSGLTIEPDMPELVARTKVPYILTHR
FT                   RGDALTMDSLTDYNNVTEDVVAEISGVRDKLYAAGVAPEQIIIDPGVGFSKNEDQNWEI
FT                   LKNLDQLFSLGHKVMVAASRKRFLGSLLTVAGKSAAPLERDAATAAITALSATKGAWAV
FT                   RVHDVGPSLDAVKVAARISR"
FT   gene            142916..143275
FT                   /gene="folB"
FT                   /locus_tag="AAur_0141"
FT   CDS_pept        142916..143275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="AAur_0141"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00525; match to protein
FT                   family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07577"
FT                   /db_xref="GOA:A1R157"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A1R157"
FT                   /protein_id="ABM07577.1"
FT                   /translation="MDRITLTGVTAVGYHGVFDFERRDGQPFVVDAVLYTDFTKAAETD
FT                   DLQYTAHYGEVAELITKHIEGEPLNLIEGLAVRIAEGILENYQVAAVDVTVHKPKAPIE
FT                   VPFGDVTVSVHRERS"
FT   gene            143272..143817
FT                   /gene="folK"
FT                   /locus_tag="AAur_0142"
FT   CDS_pept        143272..143817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="AAur_0142"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09027"
FT                   /db_xref="GOA:A1R158"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A1R158"
FT                   /protein_id="ABM09027.1"
FT                   /translation="MTSGYTKVILALGSNLGERNDTLSTAVADLVDPPEVRLLGVSPVV
FT                   QTKAVGGPEGQPDFLNMVMAVETTLTPLELLKHCHAVEQKHHRTREVRWGPRTLDVDII
FT                   VFGEVVSDDPVLTIPHPRAAERAFVLYPWSLLEPHATLNGQSVAELAAVAADMPDIRRF
FT                   DGFGDVAGVPATGAVEQP"
FT   gene            143814..144335
FT                   /locus_tag="AAur_0143"
FT   CDS_pept        143814..144335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0143"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09857"
FT                   /db_xref="GOA:A1R159"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A1R159"
FT                   /protein_id="ABM09857.1"
FT                   /translation="MKAMRPVVLVLIAVIAAVIGWLATVTTNRFSMPTPVLPVSALVTM
FT                   AVIAVLTLIMGIRVLRWRNGKKKNLLNPILAARTLILAQACAYAGTLLLGWHAGITVDL
FT                   LRIGGLRGGEGILWNAVLMGGGGVVMVVVGLVVERFCRIPPEDLEGGTAGPETRRGETK
FT                   GEGEYAYRGD"
FT   gene            144316..144828
FT                   /locus_tag="AAur_0144"
FT   CDS_pept        144316..144828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0144"
FT                   /product="putative integral membrane protein"
FT                   /note="identified by match to protein family HMM PF03703"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06656"
FT                   /db_xref="GOA:A1R160"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A1R160"
FT                   /protein_id="ABM06656.1"
FT                   /translation="MHTEAIDPPGVQWLRVSPKYVTVRLVEWAIGNVVMLAVLSLPLIF
FT                   VLLGWWRWPPLWLAITVPAVMLVLALWRLVLIPRQVRAIGYAERDDDLLIRRGIFFQRT
FT                   MVVPYGRMQYVDVAVGPVERSLGLCTLKLHTASAGTNAHLPGLPSAEGARLREQLSARG
FT                   EARLAGL"
FT   gene            144825..146396
FT                   /locus_tag="AAur_0145"
FT   CDS_pept        144825..146396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0145"
FT                   /product="putative bacterial membrane flanked domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03703"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08082"
FT                   /db_xref="GOA:A1R161"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:A1R161"
FT                   /protein_id="ABM08082.1"
FT                   /translation="MSLESNATASLPGKPEPTVDGGWNRVHPASPFVRGWVALAAVGFF
FT                   FGRDAFERMLQGRDFVDPNLNGRVPWLLAGGAVVLLLTVGGFILSWYFTRYQVAEGYVR
FT                   VNTGFLFKQQRQARLDRVQAIDIVQPLLARIFGLAELKFEVADAGESAVRLAYLPLDKA
FT                   KQLRATILARAAGVVSGPETAEEVPEAPEHVVLSVPPSRLVGSLLLSEQTVGILVGAAV
FT                   VVAVSVFTQNQTLFLALIPGILGIGAAYWSSFNKGYNFTAAISPDGIRLRYGLLDTQAQ
FT                   TLPPGRIQALMVTQPPLWRIFGWYRIHVNVAGYGVSASTEGTSRTMLLPVGMKSDVLRM
FT                   MSLVLPDPGVEDPERVFSAGLDGLGPAGAGSALVDGFTTTPRRARLLAPLGWRRNGFLA
FT                   TKTALLIRSGRWWHTLVMVPHQRTQSMALHQGPWARRFKVADLVLHTTAGPVSPRVFQA
FT                   DVTQAVELFDQQAARAREARKRQTSEQWLAQVAPQAPEVAATLNEQPAQPEPPRTSPQQ
FT                   EDRHDG"
FT   gene            146389..147297
FT                   /locus_tag="AAur_0146"
FT   CDS_pept        146389..147297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0146"
FT                   /product="putative NADP oxidoreductase coenzyme
FT                   F420-dependent family protein"
FT                   /note="identified by match to protein family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07516"
FT                   /db_xref="GOA:A1R162"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:A1R162"
FT                   /protein_id="ABM07516.1"
FT                   /translation="MARPGRLGVGIIGAGKVGAVLGAALRAAEHAVVGVSAVSEASRER
FT                   AENLLPGVPILEIQDIVERSELVLLAVPDDALGELVAGLAKLGAWQPGQLVAHTSGRFG
FT                   VGILNPVRAVGAIPLALHPAMTFTGMSLDLTRLMDCTFGVTADAAMLPIAQALVVEMGA
FT                   EPVVIAEADRTIYHASLAHSSNHMVTLVAQASQMLREIGVENPESMLGPLLRATLENAL
FT                   ASGESALTGPVARGDVGTVSAHAQALKEYDGGAGGDVLSAYQAMARATARRAGNRGLLR
FT                   PEQLTEIDEALGAEPEAPEGN"
FT   gene            147303..148205
FT                   /gene="panC"
FT                   /locus_tag="AAur_0147"
FT   CDS_pept        147303..148205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="AAur_0147"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07369"
FT                   /db_xref="GOA:A1R163"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R163"
FT                   /protein_id="ABM07369.1"
FT                   /translation="MAIKLVTTAAELRAESARLLAAKGGNSQGLVPTMGALHSGHAALA
FT                   RTAVAENDVVVATIFVNPLQFGDAVDLDRYPRTLDADMALLDAEGVDLVFAPSVDEVYP
FT                   GGQPLVRVTSGPLGEKWEGASRPGHFDGALTVVAKLLHYGLPGGAAADGTTAAYRAYFG
FT                   QKDAQQLALVKRMVSDLNFPVEIIPVPIVRSEDGLALSSRNRFLSDAERDAALVLSRAL
FT                   RLIESRANAHEPLHLDSAVALVESQPLVELDYFDVVDPATLEPLAENCKETPFRGEGLA
FT                   IIAAKVGAVRLIDNAPLFS"
FT   gene            148311..149828
FT                   /gene="lmrB"
FT                   /locus_tag="AAur_0148"
FT   CDS_pept        148311..149828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmrB"
FT                   /locus_tag="AAur_0148"
FT                   /product="lincomycin resistance protein"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08493"
FT                   /db_xref="GOA:A1R164"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R164"
FT                   /protein_id="ABM08493.1"
FT                   /translation="MSTDVTSDANGKPESSASGTVTSTEAAPPQAPAVKATVSQAPVSG
FT                   KMSRESVTVIVTLLVATFVVILNETIMNVALQRLMTDLQVSASTVQWLATGFMLTMAVV
FT                   IPTTGFILQRMSTRGAFMLAMGLFSGGTLLAALAPGFLVLLLARIVQAGGTAIMLPLLM
FT                   TTILTLVPMSKRGAVMGNVSIAISVAPAMGPTVSGIILDHFSWRFMFVFVLPVALAAFA
FT                   IGAKYLTNVGEREKTTLDVPSVILTVPAFGGLVYGLSQIGGAEAGVVPVIALVVGVLCL
FT                   ALFVFRQLKLQKSDSPLLDLRAFKFRMFTVSTLLMVVAMMALFGGVILLPLYLQNTLHL
FT                   QPLETGLALLPGGLAMGLLGPVIGRIFDKVGPLPLTVTGSVLMVLTLWQFSRLDEASSL
FT                   GWVIALHVTLSLGLALLFTPAFTTGLNPLPPHLYSHGSAIISTAQQVAGAAGTALLVSI
FT                   YAVVSASSGLVAGMQAAFLAATVIAVAAVVLGAMMRKTEGAGGHGGH"
FT   gene            complement(149916..150038)
FT                   /locus_tag="AAur_0149"
FT   CDS_pept        complement(149916..150038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0149"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09921"
FT                   /db_xref="UniProtKB/TrEMBL:A1R165"
FT                   /protein_id="ABM09921.1"
FT                   /translation="MKPITPPNPHPKTTKTPNPTTAVEHPTLKQQRSPTEVRER"
FT   gene            150582..152062
FT                   /gene="rrsA"
FT                   /locus_tag="AAur_0150"
FT   rRNA            150582..152062
FT                   /gene="rrsA"
FT                   /locus_tag="AAur_0150"
FT                   /product="16S ribosomal RNA"
FT   gene            152659..155798
FT                   /gene="rrlA"
FT                   /locus_tag="AAur_0151"
FT   rRNA            152659..155798
FT                   /gene="rrlA"
FT                   /locus_tag="AAur_0151"
FT                   /product="23S ribosomal RNA"
FT   gene            155945..156064
FT                   /gene="rrfA"
FT                   /locus_tag="AAur_0152"
FT   rRNA            155945..156064
FT                   /gene="rrfA"
FT                   /locus_tag="AAur_0152"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(156151..156696)
FT                   /locus_tag="AAur_0153"
FT   CDS_pept        complement(156151..156696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0153"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09557"
FT                   /db_xref="UniProtKB/TrEMBL:A1R166"
FT                   /protein_id="ABM09557.1"
FT                   /translation="MSDLAYMMRKMPKSAGGTLAARLRISDEKLPDNRLATSRTTSTSS
FT                   GYGSHLHQTRTTSGGMNSLAASTEGIAMPESPRVLAGKQRRRLNRFFKSSHKDWAAGGQ
FT                   GLQEYRERFACYLEQLDQDGRKGAFALTFKHVQDNRYGIADRYYEPYGIPAGLVRMPLP
FT                   IEQALYPFSELAPVTLNG"
FT   gene            complement(156742..157326)
FT                   /locus_tag="AAur_0154"
FT   CDS_pept        complement(156742..157326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0154"
FT                   /product="putative HhH-GPD superfamily base excision DNA
FT                   repair protein"
FT                   /note="identified by match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07206"
FT                   /db_xref="GOA:A1R167"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR017658"
FT                   /db_xref="UniProtKB/TrEMBL:A1R167"
FT                   /protein_id="ABM07206.1"
FT                   /translation="MELHITGDAAADQLLSDDAFALLTGMLLDQQVTMESAFAGPEKIR
FT                   TRLGSLEPGTIAEYDPAGFVEVFKERPAVHRFPGSMAARVQALAETVHREWDGNAAAIW
FT                   TSGNPDGPEVLRRLKALPGFGEQKAKIFLALLGKQCDLKADGWREAAGHYGEEGSYLSV
FT                   ADIVDPESLVKVRASKQAAKAAAKAAKTSGA"
FT   gene            157866..159346
FT                   /gene="rrsB"
FT                   /locus_tag="AAur_0155"
FT   rRNA            157866..159346
FT                   /gene="rrsB"
FT                   /locus_tag="AAur_0155"
FT                   /product="16S ribosomal RNA"
FT   gene            159943..163082
FT                   /gene="rrlB"
FT                   /locus_tag="AAur_0156"
FT   rRNA            159943..163082
FT                   /gene="rrlB"
FT                   /locus_tag="AAur_0156"
FT                   /product="23S ribosomal RNA"
FT   gene            163226..163345
FT                   /gene="rrfB"
FT                   /locus_tag="AAur_0157"
FT   rRNA            163226..163345
FT                   /gene="rrfB"
FT                   /locus_tag="AAur_0157"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(163440..164294)
FT                   /locus_tag="AAur_0158"
FT   CDS_pept        complement(163440..164294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0158"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07871"
FT                   /db_xref="GOA:A1R168"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R168"
FT                   /protein_id="ABM07871.1"
FT                   /translation="MNLTHLRAFHQVATYGSYVAAAAAANVSQPTLSEQVRLLERNHGV
FT                   RLLQRAGRSVELTPLGSRLLQVTSTLFAAELEAEAVLAKARNVMQGELRFGTDAPINAV
FT                   GVLSTFRRRNPGVSIQLVSGNSAEIRQRVLAGTVEVGIIADETPHPDLTARALGTQDLV
FT                   AFVRHDHALAGAKVIRLRELVTHPLIIREIGSVTRRSIERALSDAHLQPTEVLETDSRE
FT                   AVHAAVIAGLGIGVIAEDEFNDDPRLVLLDFADPLQPITEYLVFRTDNQRSHVVEAVLE
FT                   CVG"
FT   gene            164321..165289
FT                   /locus_tag="AAur_0159"
FT   CDS_pept        164321..165289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0159"
FT                   /product="Type I phosphodiesterase / nucleotide
FT                   pyrophosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01663"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07324"
FT                   /db_xref="GOA:A1R169"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A1R169"
FT                   /protein_id="ABM07324.1"
FT                   /translation="MDGCPYELSSEPSTVVDVMNEPHVLVVGIDGVRFDSLGAAATPAL
FT                   DRIAREGFLTPVRVHEKNATISGPVWATVATGVYADRHRVTGNSHHPVELSAFQDFTEV
FT                   LRAARPELQTMIAASWHPLATRTECGPLFSSRGWVPMPDPEEANDADSWVRADDAVAEY
FT                   AARRLKTENLAISFVYFGEADVEAHNNGTGAGYISAIERCDSRLNALLEAIEARPNRHD
FT                   EDWTIIVLTDHGHLDAGGHGGETDVERTAWMAASGTGLSSGSTAVNHADIFPHTLAIFG
FT                   VAARGSDGVPFGARQEARHETLQGPRLNTAPASPHNAAGSR"
FT   gene            165286..166143
FT                   /locus_tag="AAur_0160"
FT   CDS_pept        165286..166143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0160"
FT                   /product="putative Integral membrane protein DUF6"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09835"
FT                   /db_xref="GOA:A1R170"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1R170"
FT                   /protein_id="ABM09835.1"
FT                   /translation="MTLAVTAAVLLAAVMHSAWNAIAKAIPDRLASSTMIAVAYGACGV
FT                   IGAAVFGIPLQQSWPYVLASAVLQTCYLILLTTSYKHGDFSQVYPLARGLAVLLVTGIA
FT                   TTFLAERLSFWQLAGVAVVAGSLLSLALVRQNVSATTDGNRKGAFFAVLTGVAIAAYTL
FT                   VDGVGVRVSGQSMAYISWLFLLQGLLIPVVCWRMAKDRRTFPQRVARYWKPGFIGGLVS
FT                   MLAYGIVVWAQSLAPLALVSPLRETSVLLAGIIGAVFFKEKFSRLRGALTVVAVAGIAA
FT                   IQLG"
FT   gene            complement(166168..167001)
FT                   /locus_tag="AAur_0161"
FT   CDS_pept        complement(166168..167001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0161"
FT                   /product="putative hydrolase, alpha/beta fold family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07544"
FT                   /db_xref="GOA:A1R171"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R171"
FT                   /protein_id="ABM07544.1"
FT                   /translation="MTRDIIMTHDGGHLEVLTTGGELAAAGSGVVVVPASMVTATDYSR
FT                   FAQKLSEALGRPVHTFNRRGRGDSSPQSEDYTLEADIRDLETVMKHTSSTDVFGHSFGG
FT                   AVALHAARTLPVERLAVYDPAVSVNHSVKADWTPDYERATAAGDYDRALAVLIKGVETG
FT                   GAFARMPLSMLTLANKLAAGTPLGKQMRELMTCGVREIKAVIAADMPAEPFLELPLETL
FT                   IVVGEKSPAYFGVACGQIHDVLSGSSYTILPGFGHDGPNKAPDKLISELSEFFSG"
FT   gene            complement(167065..167919)
FT                   /locus_tag="AAur_0162"
FT   CDS_pept        complement(167065..167919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0162"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06880"
FT                   /db_xref="GOA:A1R172"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R172"
FT                   /protein_id="ABM06880.1"
FT                   /translation="MKERHIKTHDGGRLALYSYGTEDAPGERRVVLIGGAFLTALIYRP
FT                   FSIALSKGLGEGWAVDVYDRRGRGQSTEQPPNYSMATEIADVRTIMDETGARNVMGHSL
FT                   GGAVALNAAQSFAGTHHQPDKLAVYDAAVNIDGSMDTAWLDGFAESVNRGDVGRALARM
FT                   KRGMQPGTALARVPEPILAGLMAVVSGTKVNRLFRELMPSGVGELKAAFDAADTPRDFS
FT                   VLPPGTHFMVGKKSPQFYKVTAARLNRAVPGSTLEVSPKGFHGSVPAAVSELVSDISEY
FT                   FKR"
FT   gene            complement(167929..168825)
FT                   /locus_tag="AAur_0163"
FT   CDS_pept        complement(167929..168825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08013"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R173"
FT                   /protein_id="ABM08013.1"
FT                   /translation="METWTVETNDGGGQLEVHTFRPASGTSIPGSKAPAEPAGVVLVHG
FT                   TLVTDSLYWPFARTLSGMLGRPVHSYNRRGRGHSAPQPPGYSVDTEISDLQAVMEKSGS
FT                   TDVVAHSYGGFVALQAARRASINKLVTYDAAVSLSGNLSSRWRPELEDAVTSGQLDHAW
FT                   AHLVQGLGTAGPISYLPMGALRALSVLSARTRLGLEMRSLLPTAVTEMRAVLDADAHLH
FT                   DFMKLSTPTLMLSGGWSPSYFAETGRILAGAVPAIDFAIVPLQFHEGPLRPGKRLAARI
FT                   ARFLSGNHVKEEPSSAT"
FT   gene            168901..170430
FT                   /gene="lysS"
FT                   /locus_tag="AAur_0164"
FT   CDS_pept        168901..170430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="AAur_0164"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09113"
FT                   /db_xref="GOA:A1R174"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A1R174"
FT                   /protein_id="ABM09113.1"
FT                   /translation="MTSANTPAQNTSAEPIDASEQMRIRMEKRAKLIERGTEAYPVGVE
FT                   RTHSLSEIREKYAHLEADETTGDTVGVTGRVVFVRNTGKLCFATLQEGGVDGKGVRLQA
FT                   MLSLANVGEEALADWKALVDLGDHVFIKGEVISSRRGELSVMADSWSMASKALRPLPVL
FT                   HAELNEETRVRQRYVDLMVRDEAREMVYRRAAITRSVRDTLDRHGYVEVETPILQLVHG
FT                   GATARPFETHMNAFDQKMTLRIATELFLKRAVVGGIDRVYDMGRVFRNEGVDSTHSPEF
FT                   TTLECYEAWADQFVMAERMKEIILNVADVVGTRTIQTDAGEINLDGEWAWISVYPGISE
FT                   AVGVEITPDTTVDELLAIAAKHEVKVDPKWDAEKMVVELFGEIVEPTLLNPTFVYDYPP
FT                   SAQPLARPHREDGRLIEAWDLIIGGMERGTAFSELIDPVIQRERLTEQSRRSAAGDEEA
FT                   MQLDEDFLRALEYGAPPMGGIGLGIDRLVMLFTGAGIRETILFPLLKPEGH"
FT   gene            170433..170606
FT                   /locus_tag="AAur_0165"
FT   CDS_pept        170433..170606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0165"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08579"
FT                   /db_xref="GOA:A1R175"
FT                   /db_xref="UniProtKB/TrEMBL:A1R175"
FT                   /protein_id="ABM08579.1"
FT                   /translation="MEYIAVLAPSIVVGLIFWFAMKSIFNADKSERQAEAKAQAEANLK
FT                   NSGPASEGPAAK"
FT   gene            170738..171064
FT                   /locus_tag="AAur_0166"
FT   CDS_pept        170738..171064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10298"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:A1R176"
FT                   /protein_id="ABM10298.1"
FT                   /translation="MAQKVKIILVDDLDEGAADETVRFGLDGVSYEMDLSTVNAASLRK
FT                   ALEPYVAKARKTSSGRATRGRATAARNQDSAQIRQWARDNGYTVNSRGRIQAEIQEAYQ
FT                   KANS"
FT   gene            171417..173909
FT                   /locus_tag="AAur_0167"
FT   CDS_pept        171417..173909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0167"
FT                   /product="putative ATP-dependent Clp protease, ATP-binding
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF02861; match to protein family HMM PF07724;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07123"
FT                   /db_xref="GOA:A1R177"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1R177"
FT                   /protein_id="ABM07123.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLSISLDGVREQVQEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKETAGSGSGQGQPEGT
FT                   PAGSVVLDQFGRNLTQAARENKLDPVIGREQEMERVMQVLSRRTKNNPVLIGEPGVGKT
FT                   AVVEGLAQAIVRGDVPETIKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEIRTRGDI
FT                   ILFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHIEKDAALERR
FT                   FQPIQVKEPSVAHAIEILKGLRDRYEAHHRVTITDGALASAAQLAERYISDRFLPDKAI
FT                   DLIDEAGARLRIRRMTAPPELKAMDERIADVKMEKESAIDAQDFEGAASLRDKEQKLIA
FT                   ERAEKERNWKSGGMDDISEVDEDLIAEVLANSTGIPVFKLTEEESSRLLKMEDELHKRV
FT                   VGQNEAIKALSQAIRRTRAGLKDPKRPGGSFIFAGPTGVGKTELAKALAEFLFGEEDAL
FT                   ITLDMSEYSEKHTVSRLFGAPPGYVGYEEGGQLTEKVRRRPFSVVLFDEVEKAHADLFN
FT                   SLLQILEDGRLTDSQGRVVDFKNTVIIMTTNLGTRDISKSVATGFQSGTDTQTGYNRMR
FT                   ARVTEELKQHFRPEFLNRVDDVVVFPQLTQDEIIEIVDLFVTRLERRLKDKDMGIELTP
FT                   AAKVLLATRGYDPAMGARPLRRTIQREIEDQLSEKILFGELHSGDIVVVDVDGEGDDAK
FT                   FTFEGNAKPRIPEIAPTA"
FT   gene            173989..175197
FT                   /locus_tag="AAur_0168"
FT   CDS_pept        173989..175197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0168"
FT                   /product="putative glucosyltransferase"
FT                   /note="identified by match to protein family HMM PF03033"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06952"
FT                   /db_xref="GOA:A1R178"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A1R178"
FT                   /protein_id="ABM06952.1"
FT                   /translation="MRVLMVTPGTRGDVAPMAGLGSRLQGLGYEVAVAANPAYAPLVVE
FT                   SGCEFRPLPGDLAGLITQPAPGAKASSGSVLTFWRKLTEYMDNAATGTLAAAEAGADVI
FT                   LANSVAPYAYDIADALGIPAIGAHLQPIEPSAAYPPVIMNSAQSLGAWGNKIIGERAAA
FT                   GPAPYDAPSARLRRELGLGKESRAAGERRRRKAKATILHGISPTVLPRPADWHSGLVMA
FT                   GYWWPAVEPDWQPSADLVDFLTAGPPPVFVGFGSSAHIDPAFILEATRRAGVRAVVQGA
FT                   EGGLGDDAIAVGSVPHEWLFPHMAAVVHHAGAGTAAAGLRAGVPAVGVPVYTDQPLWAS
FT                   RVAALGAGPAPIPYKKLTPERLGDAIMKVVSTPSYSLRAAELGAAIAKEDGTVAVVGAL
FT                   RNL"
FT   gene            175267..177384
FT                   /locus_tag="AAur_0169"
FT   CDS_pept        175267..177384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0169"
FT                   /product="putative prolyl oligopeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00326"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06978"
FT                   /db_xref="GOA:A1R179"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R179"
FT                   /protein_id="ABM06978.1"
FT                   /translation="MLNRIMDSADTHTQGEQPETPFHHLDHYLAIPRVGGLTLSPDGKR
FT                   LVTTVTTLNGKGTEFATALWEIDPSGRNQARRITRSSKGEAGAVFAANGDLYFTSARPD
FT                   PDSPDADPVNALWLLPADGGEARVVHSRSGGIGSVMAAKDANATFVNAEVLAGSADEEN
FT                   DEERRKARKDNKVSAILHSGYPIRYWDADLGPAEPRIFAVEQGEEKEPGKPSTIDSAAP
FT                   LKLRNLTPGVGGSLREAKTVVSPDGRTIYTSMTKALAKADSREVLAAVDVATGTVKVLL
FT                   DHQGMSYFPGPVSPDNRTLVVQSESDTTPTQAPHVKLHLLNVAGGETTDLEPLAHQWDR
FT                   WATPLAWLPDGTAVLVTADDDGASPVFRIDVADGAVTRVTKDAAAYSDVVISPDGTEAY
FT                   ALRSSYEFPAEAVRINLATGETVRLQAPAEQPVYKGRLERVDTTAEDGSRVPAYLALPE
FT                   GASADNPAPLLLWIHGGPLGSWNAWTWRWNPWLLVAKGYAVLLPDPALSTGYGQEFIQR
FT                   GWGEWGKKPFTDLMAITDAVVARPDIDESRTAAMGGSFGGYMANWVAGQTDRFKAIVTH
FT                   ASLWALDQFGPTTDAAQYWLKEMTVEMAMENSPHLNVGNIKTPMLVIHGDKDYRVPIGE
FT                   GLRLWYELLSSSQLPADDNGQSPHRFLYFPDENHWVLQPQHAKVWYGVVESFLAKQVLG
FT                   EEVSLPEELGV"
FT   gene            177560..178069
FT                   /locus_tag="AAur_0170"
FT   CDS_pept        177560..178069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0170"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06508"
FT                   /db_xref="GOA:A1R180"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1R180"
FT                   /protein_id="ABM06508.1"
FT                   /translation="MDSTFSLRPARTSDVAAIKRLVAPLAEERILMAKETVAYYESLQE
FT                   FRIAESDDGEVIGCGALHVMWEDLAEIRTLAAADSWRGRGVGHVLVENLLEEARALGVS
FT                   RVFCLTFEVDFFKRHGFEVMADQSAVDPQVYSELLRSHDEGVAEFLDLARVKPNTLGNT
FT                   RMIKQL"
FT   gene            178240..179688
FT                   /gene="mcrA"
FT                   /locus_tag="AAur_0171"
FT   CDS_pept        178240..179688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /locus_tag="AAur_0171"
FT                   /product="mitomycin radical oxidase"
FT                   /EC_number="1.5.3.-"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07705"
FT                   /db_xref="GOA:A1R181"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1R181"
FT                   /protein_id="ABM07705.1"
FT                   /translation="MQSHASFSDVSELQLSVRGPVFTPADPGFAPEVAAFNLSTQHQPD
FT                   LAFGALDAEDVSAAIRWAAERGMPVSVQSTGHGATNAIEGGLLISTRRMLELSIDPLEK
FT                   TARVGAGVRWKAVVELAATFGLMGLCGSTTDVGVVGYTLGGGLPILGRKYGFASDHVIA
FT                   FELVTADGTQRRVTKDENSELFYLLRGGKGNLGIVTAMEFHLFPAADLYAGGMYFDGEH
FT                   APEVLRAFREWVPSLPVDASASMAFLRLPDMEMVPEPLRGKFVIHLRYAYQGDLATAAE
FT                   VLEPMRHCAPFMMDATGPLDSTQFDTIHQDPDQPVPVREHGFLLDRLDDQAEDALLRHF
FT                   GPGVESPVLLAELRLLGGALAKSTDGEDIVGGRDAAFSFFMGAIAVPPVLDILPGVFSA
FT                   VHEDLRPAANAGTFVNLHGHFVDAEDRERPWLPSARERLRKAKAEVDPKNMFSFGHVVG
FT                   LPVIDQTVLLEDVVTAGGDAVLNN"
FT   gene            179699..179887
FT                   /locus_tag="AAur_0172"
FT   CDS_pept        179699..179887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08270"
FT                   /db_xref="UniProtKB/TrEMBL:A1R182"
FT                   /protein_id="ABM08270.1"
FT                   /translation="MLDRVMFPDFSAFQIDIPHASWPHEASWQDAGHSNPDLYSAFWPE
FT                   YQARNEPEAVTTQAAED"
FT   gene            180035..181036
FT                   /gene="dhaK"
FT                   /locus_tag="AAur_0173"
FT   CDS_pept        180035..181036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaK"
FT                   /locus_tag="AAur_0173"
FT                   /product="dihydroxyacetone kinase, DhaK subunit"
FT                   /EC_number="2.7.1.29"
FT                   /note="identified by match to protein family HMM PF02733;
FT                   match to protein family HMM TIGR02363"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08459"
FT                   /db_xref="GOA:A1R183"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:A1R183"
FT                   /protein_id="ABM08459.1"
FT                   /translation="MKKLINDPRAVVDESVEGFGMAHADIVDVHPEPKYVIRKGAPVAG
FT                   KVALISGGGSGHEPLHAGFVGLGMLDAAVPGAVFTSPTPDQIIPATVAVDSGAGVVHIV
FT                   KNYTGDVLNFETAAEMAQAEGVHVRSVLVNDDVAVEDSLYTAGRRGVGGTVLVEKIAGA
FT                   SAQRGDDLDAVTAIAERVVANVRTMGVALSGCTVPHAGTPSFELADDEIEIGIGIHGEP
FT                   GRHRIAMESADAITDRLLEPVLEDLALASGDKVLLFVNGMGGTPQSELYIVYRRAAQVL
FT                   AERGATVERSLVGNYVTSLEMQGCSVSVLRLDDELTRLWDAPVHTAALRWGA"
FT   gene            181039..181701
FT                   /gene="dhaK2"
FT                   /locus_tag="AAur_0174"
FT   CDS_pept        181039..181701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaK2"
FT                   /locus_tag="AAur_0174"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF02734;
FT                   match to protein family HMM TIGR02365"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07572"
FT                   /db_xref="GOA:A1R184"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A1R184"
FT                   /protein_id="ABM07572.1"
FT                   /translation="MGLDVDWALDWLKLSAKAMAEHRVELIELDRPIGDSDHGENMDRG
FT                   FQAVLQKLDETPPETPGAALKAAAMALMSKVGGAAGPLYGTAYLRAATSLGDAGDIDAE
FT                   ALAAALAAARDGVVARGKAELGDKTMIDAWTPAVEAAQKAAASGADPVAVLEAAAEAAE
FT                   TGAMATDPLVARKGRASYLGERSAGHRDPGAASTALLLRAAAAAAAGSTADKGADAV"
FT   gene            181698..182390
FT                   /locus_tag="AAur_0175"
FT   CDS_pept        181698..182390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0175"
FT                   /product="dihydroxyacetone kinase, phosphotransfer
FT                   subunit/phosphocarrier protein HPr"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM PF03610; match to protein
FT                   family HMM TIGR01003; match to protein family HMM
FT                   TIGR02364"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09201"
FT                   /db_xref="GOA:A1R185"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:A1R185"
FT                   /protein_id="ABM09201.1"
FT                   /translation="MTVGIVVVSHSSKIAEGAVELAAQMAPDVDLVAAGGTDDDRIGTS
FT                   LEKVLAAVEQSLVDSGGDGVVVLTDLGSAVMTAESAVEFASDPDAVLLADAPLVEGLVA
FT                   AAVAAQGGDGVEDVRKAAEAVAFGNVPAGVGGPAIPEDKDEPDASGDFELINPLGMHAR
FT                   PAAKIAGGLSGLDAEVTVNGVDGMSIMALMALAAGKGSILRIEARGKDALKAVEYVGRL
FT                   VEEGFGEL"
FT   gene            182414..182656
FT                   /locus_tag="AAur_0176"
FT   CDS_pept        182414..182656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0176"
FT                   /product="putative CsbD-like family protein"
FT                   /note="identified by match to protein family HMM PF05532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07342"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A1R186"
FT                   /protein_id="ABM07342.1"
FT                   /translation="MLSMLISDVVEVQVHYKEEVRNMGADDKMENAGEKLGGKAKEAAG
FT                   KLTDNERLEAEGKGDQTKADLKGAGEKLKDAFKKD"
FT   gene            182752..183012
FT                   /locus_tag="AAur_0177"
FT   CDS_pept        182752..183012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06765"
FT                   /db_xref="GOA:A1R187"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:A1R187"
FT                   /protein_id="ABM06765.1"
FT                   /translation="MNILVKLFGLAVSLGAGALANKTLEGLWEKRTGKPAPKDGTDLND
FT                   SLPGVLVFAVVSAGVGAVVHVLTQRGTKSALARMKKTADEV"
FT   gene            183016..183375
FT                   /locus_tag="AAur_0178"
FT   CDS_pept        183016..183375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0178"
FT                   /product="putative glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06457"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A1R188"
FT                   /protein_id="ABM06457.1"
FT                   /translation="MAIAKFPSVVIDCPDAAALAAFYGELFGWEIEDKGDWFDIRPSDG
FT                   SNCISFQQVEVYQPPKWPGQTIPQQMHLDMVVEDLDKGEEVALSLGATKADHQPGETFR
FT                   VFLDPAGHPFCLCLS"
FT   gene            complement(183389..183901)
FT                   /locus_tag="AAur_0179"
FT   CDS_pept        complement(183389..183901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0179"
FT                   /product="putative glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09587"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1R189"
FT                   /protein_id="ABM09587.1"
FT                   /translation="MTDTTSTEPTTAAHGEHTTHGIPNGLTSLTPFLAVPNAREAIAFY
FT                   RDVFGARVVGETEMGGMVVHAELDFGNGRLQLGEPNPEYHLVPAPSGEDDCYSLGLYCP
FT                   DADGLVKKAEQAGATIREPLSTFVSGDRYASIRDPFGVRWSIMTRVEDLSEEESNRRVD
FT                   EWAAKQG"
FT   gene            183981..184793
FT                   /locus_tag="AAur_0180"
FT   CDS_pept        183981..184793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0180"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09412"
FT                   /db_xref="GOA:A1R190"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1R190"
FT                   /protein_id="ABM09412.1"
FT                   /translation="MEGSFKGILYPARLPTFHRFPAPASVADLVQWFWIPEWNIEPGRS
FT                   SRQHVIAYPASNLVVQGDVVEFSGPTTRAAYRDLTGQGWAVGALLRPAAVPLFTDHPGA
FT                   LRDQEVGMVLEGLQRAVSAAMTTPSVEIMHDGGTHRERAVEAFVAWLVSLEFVASEEAL
FT                   LANRLVDVITSEPDMILLEDVASRLAVSPRTLQRIAGKYVGLSPSALIRRRRLQDAAER
FT                   TRSNPTADLAAIAVELGYADHAHLTNDFQKYLGFTPSGYRKAVGGNPG"
FT   gene            184957..185109
FT                   /locus_tag="AAur_0181"
FT   CDS_pept        184957..185109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09049"
FT                   /db_xref="InterPro:IPR012455"
FT                   /db_xref="UniProtKB/TrEMBL:A1R191"
FT                   /protein_id="ABM09049.1"
FT                   /translation="MLGKLMCKLNLGHKWHVERTEDGTRYRRCTRCGKDEDDSGGSRLI
FT                   MDAGG"
FT   gene            complement(185116..185583)
FT                   /locus_tag="AAur_0182"
FT   CDS_pept        complement(185116..185583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0182"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09359"
FT                   /db_xref="UniProtKB/TrEMBL:A1R192"
FT                   /protein_id="ABM09359.1"
FT                   /translation="MALTLAGTAALLPGCLAEPVACPAIGHVAGISLTVAVDYADDVAS
FT                   LRLKACQDGICTEKDLLLNPGATAVDQGCTPDGVCSATSSPDGTLQGFLELPALSESFL
FT                   EATATGTSPSGAALPARTVTFTPKGDYPYGEQCGRMISAALILDEEGLRQH"
FT   gene            complement(185720..186670)
FT                   /locus_tag="AAur_0183"
FT   CDS_pept        complement(185720..186670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0183"
FT                   /product="putative A/G-specific adenine glycosylase"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10142"
FT                   /db_xref="GOA:A1R193"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A1R193"
FT                   /protein_id="ABM10142.1"
FT                   /translation="MTLPDSGQLAGLHQALDQWFARTARNLPWREPDCSPWGILVSEVM
FT                   LQQTPVVRVLPVWRDWMERWPTPAHLADEPSGAAVRHWGRLGYPRRALRLHAAAVAIRE
FT                   QHGGKVPDTYPELLGLPGVGNYTAAAVAAFAFGRRETVVDTNIRRVHARLISGDALPAP
FT                   ALTAGEMRLADALLPLDKELSVRWNASVMELGAMVCTARSPKCADCPVRSSCAWLAAGE
FT                   PPPSYTPKGQSWHGTDRQVRGAVMAVLREAATPVPREMFEQAPADLGFAPSGVGIPLAA
FT                   LHRLNSAPEQLERALDGLLVDGLAEMHDGGLRLPA"
FT   gene            186807..187529
FT                   /locus_tag="AAur_0184"
FT   CDS_pept        186807..187529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06547"
FT                   /db_xref="GOA:A1R194"
FT                   /db_xref="UniProtKB/TrEMBL:A1R194"
FT                   /protein_id="ABM06547.1"
FT                   /translation="MANKGKQQSTARASASAKGAARGSSRAGAAGKSTSTKRRRPSPAV
FT                   YRRRRQVVFGALLLVIALVIGGVVALTGALAGNPEPQAVSTADASTAPTPGTTPTGTAA
FT                   PSPSASPVCDLNLMTVAAKTDKPAYGAEEKPLLTMTITNGGTAPCEVNVGTSQMEYLLM
FT                   SGSDRIFSSKDCQTGGEDLIKTIQPGKSETANFPWQRNRTLEGCAAITAKPGAGGAYYT
FT                   FEARLGNKSSPKVAFQLN"
FT   gene            complement(187568..188644)
FT                   /locus_tag="AAur_0185"
FT   CDS_pept        complement(187568..188644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0185"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF02457"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07675"
FT                   /db_xref="GOA:A1R195"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:A1R195"
FT                   /protein_id="ABM07675.1"
FT                   /translation="MARSPEESLKATLARVAPGTPLRDGLERILRGRTGALIVLGYDRT
FT                   IDSICSGGFDIGIDFSPTRLRELAKMDGAIICDKDASNIVRAAVQLVPDSSIETQESGT
FT                   RHRTAERVAIQTGVPVISVSQSMQIIALYVNGLRHVLEGSEKVLARANQALATLERYSA
FT                   RLDQVTSSLSALEIEALVTVRDVAVTLQRQEMVRRISEEIAQYVLELGEDGRLLSLQVE
FT                   ELTVGRGPGSEVIIRDYSDPDATPEQIEEAVQALLNLGPTELIDLSRIAHIIGFAGGVE
FT                   QLDAVVQPRGYRLLSGLKSVPKAVADRLVDYFGGLQNLMAATIDDLMTVDGIGDQRART
FT                   VREGLSRMAEASLLDRFL"
FT   gene            complement(188879..190714)
FT                   /gene="atzF"
FT                   /locus_tag="AAur_0186"
FT   CDS_pept        complement(188879..190714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atzF"
FT                   /locus_tag="AAur_0186"
FT                   /product="allophanate hydrolase"
FT                   /EC_number="3.5.1.54"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR02713"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08365"
FT                   /db_xref="GOA:A1R196"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1R196"
FT                   /protein_id="ABM08365.1"
FT                   /translation="MSGRTVERVLSALEAIDAVHRPEIWIHLRGREELLAEAARIDAAA
FT                   AAGEDLPLAGLLLAVKNNVDVAGVITTAACPGFGEAPARDAVPVARLRAAGALVLGATN
FT                   LDQFATGLVGTRSPYGIVRDSRRPDRISGGSSSGSAVAVALGLVDLAIGTDTAGSGRIP
FT                   AALQGIVGIKPTLGVVSTDGVVPACRSWDTATIFARDLATAELAMGIMAGECRSWPADV
FT                   KLAAPATPRVAYPATLPALPDAWALEFEAQIERLRSTGVVAEAIELDVFLEAARLLYDG
FT                   GLVAERYAAVGNFVDTVQAGGVSATLDPTVAGIITAAGKVPAHQYVADSAALERLRAEA
FT                   MRRLAGFDALIVPTAPFHPTLAEVAADPVGVNSRMGTYTNFCNLFDLSAVAVPAGTVRD
FT                   TDGISQFGLTVVGRTFQDGVAADIARRIELTPEHPELFAAGAAGARTAAPMVPWPVAAG
FT                   AGVVPLVVVGAHRKGQPLAAELERRGAFWDGQVVTASRYRMVALETMPPKPGVVRSEQG
FT                   TGLVAERWLLSESALGSFLADLPEPMLLGSITLDDGSTAVGFACDAVAAASARDISEYG
FT                   DWIKYLEESTAGPGNQPLWREAGRALLTGLSRGQR"
FT   gene            complement(190711..194385)
FT                   /gene="uca"
FT                   /locus_tag="AAur_0187"
FT   CDS_pept        complement(190711..194385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uca"
FT                   /locus_tag="AAur_0187"
FT                   /product="urea carboxylase"
FT                   /EC_number="6.3.4.6"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02626; match to protein family HMM PF02682;
FT                   match to protein family HMM PF02785; match to protein
FT                   family HMM PF02786; match to protein family HMM TIGR00724;
FT                   match to protein family HMM TIGR02712"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08799"
FT                   /db_xref="GOA:A1R197"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1R197"
FT                   /protein_id="ABM08799.1"
FT                   /translation="MNRFDTLLIANRGEIACRIIESARKAGLRTVAVFSEADRGAKHVK
FT                   LADEAVLLGPAPAKESYLKVEAILNAAAATGAGAIHPGYGFLSEDAAFAEAVEAAGLVF
FT                   VGPTPEQLRIFGTKHTARDAAQRAGVPMIAGSGLLDDVDQAVSAAETIGYPLMLKATGG
FT                   GGGIGMAVCRDEAELRDNYSRVARLASSSFGTAGVFAERYIEHARHVEVQVFGDGEGRV
FT                   VSLGDRDCSLQRRHQKVLEEAPAPDLPDALREELHRSSRALCASVGYRSAGTVEFVYDP
FT                   VRREASFLEVNARLQVEHPVTEAITGVDLVEWMLNLAQQEPVLQGVPDSVPVSGHAVEA
FT                   RIYAEDPARNFQPSAGTVTNAQYPASDVVRIDAWVETGSEVSTSYDPLLGKVITSGTTR
FT                   DAAFDALAAALAETRIDGIETNLGMLRAVAGMEVVRAAEHSTGTLNTVGDPEPRITVER
FT                   PGLQTSVQDWPGRTGLWQIGVPPSGPMDDLSFRLGNTALGNPEGAPGLEFTMAGPALRF
FT                   THATTVCVTGADVTVTVNGNTANTWEPITVPENGLLDVGSADGSGLRGYILFEGGLDVP
FT                   RYLGSASTFTLGQFGGHGGRVLRTSDVLRTVSDHLPETVPGVVPEESRPALTSDWELKV
FT                   VEGPHGAPEFFEREDIEELYAAEYEVHFNSARTGVRLIGPKPRWARNDGGEAGLHPSNI
FT                   HDTAYSVGALDFTGDTPILLGPDGPSLGGFVCPVTVVTGERWKLGQLRPGDKVRFVPIR
FT                   SVEAPSVKELGAARQLILPGGTDFSSSAAGLLRGDGDDGVLGRVPEGEGRPAVTFRRSG
FT                   DDNLLVEYGDMVLDLGLRARVHALHQELERLGIPGIVDLTPGIRSLQIKADPSVLPTPK
FT                   LLGLVREVDASLPASSELVVPSRSVRLPLSWDDPATREAIERYMAGVRDDAPWCPWNIE
FT                   FIRRINGLDSVNDVFDTVFNAEYLVLGLGDVYLGAPVATPLDPRHRLVTTKYNPARTWT
FT                   PENAVGIGGAYMCIYGMEGPGGYQFVGRTTQVWSRYADAAPFEPGSPWLLRFFDRISWY
FT                   PVNPEELLDLRADMAAGRGRGVEIEEGTFSLAEHEKFLERNSVSIAEFRETQSAAFAVE
FT                   RLAWEEAGEFDRAEQAVSLAPPADDVVVPDGGTLVTSPFAASVWKVDVEPGDLVVAGQS
FT                   LVSLEAMKMETVIQAPVDGVVQQVLPTAGAQVVAGEALVVLEPVDIREPALVLEGSAS"
FT   gene            complement(194382..195038)
FT                   /locus_tag="AAur_0188"
FT   CDS_pept        complement(194382..195038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06942"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1R198"
FT                   /protein_id="ABM06942.1"
FT                   /translation="MNAVADISPALVPGKVVLDELVEARGPWSAVVAAGDILTIVDLDG
FT                   NQAVDCILYAAHDTGTRYSAAATIAGQGSIFLTTGSILRADSGRELMTVVADEVGVHDT
FT                   IGGACSQESNTLRYGQHTHEQHACVENFLIEGAKWELGKKDLVSNINWFMNVPVDPDGA
FT                   LGIVDGLSAPGKRVALRAEVDTLVLVSNCPQINNPCNGFNPTPVRMIVTRPEARA"
FT   gene            complement(195035..195922)
FT                   /locus_tag="AAur_0189"
FT   CDS_pept        complement(195035..195922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07417"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1R199"
FT                   /protein_id="ABM07417.1"
FT                   /translation="MIAMTQTLESAPGTATTAGAKLHARAQHGRAAETMIHVPPASAPA
FT                   RLTQNLPAEAKDSLTWAETLAFGRYTHLELARGTRLRLTDLDGDACVHAVIIRSGAQHE
FT                   RLNVADTVKVPWQAYMTTGHPLLSDAGRLMATVVADSSGNHDALTGTTNLAGNTAKYGA
FT                   GSAHSPSPAGRELLTLGGMKHGVGQRELPPSLSFFKGVTVERDGRIQFAGSAGAGAAVE
FT                   LLLHMDAVLVLANTAHPLDPRPDFTGSAVDIVAWRAPQDLAALVDGNFTVDLGPEGRLA
FT                   LHNTELDYNARTSA"
FT   gene            complement(195976..197499)
FT                   /locus_tag="AAur_0190"
FT   CDS_pept        complement(195976..197499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0190"
FT                   /product="putative amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09481"
FT                   /db_xref="GOA:A1R1A0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR017794"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A0"
FT                   /protein_id="ABM09481.1"
FT                   /translation="MTSTLSTATSRTDDADLTALGYQPTLHRKLGRYASFAAGFSFVSI
FT                   LTTIFQLFAFGYSFAGPAFFWTWPVVLVGQLLVALNFAELAARYPLSGAVYQWSRRMGG
FT                   EVVGWFAGWFMSIAQVITAAAAAIALQVVLPQLWDGFQVVGGDPSLTSPTGAANAVILG
FT                   AVLLVITTVINCLGVKLMSHVNSIGVTCEIVGVAAVILALFSAAQRGPGVVADVSVVTT
FT                   SDLGAVGAFLVSGLMAAYVMVGFNSAGELSEETKNPRKTAPRTILSALIISGIGGGLMI
FT                   IAALMAAPSLDDGRLATEGLPYVLTAVLGTFWGKVLLVDVAIAIFVCTLAIQTAGSRLV
FT                   FSMARDGKLPASALLSRVHPQRGTPMWPSIAIGALAVGILAINIGNSALFTTLCSVCIV
FT                   MVYLAYLMVTVPQLLSRFRGDWRRVGQTMPGGLFSLGRWGLPVNILAVLYGALMVVNLS
FT                   WPRPEVYDPSGEHGILLFSAPIMVGAVLLLGIWVRRNIRVRENKGATAG"
FT   gene            197728..198426
FT                   /locus_tag="AAur_0192"
FT   CDS_pept        197728..198426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0192"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10042"
FT                   /db_xref="GOA:A1R1A1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A1"
FT                   /protein_id="ABM10042.1"
FT                   /translation="MTTAGPGRPRKQQAVRPGATARDEILDAAAELFTGQGFANTSTRA
FT                   IADAVGIRQSSLYHHFSTKDEILGELLGGTVSTSLDFARAIRQHSADAVSAAARLHAVV
FT                   LFDGSQLCNSRWNLGVLYHLPEARAEIFQPFMAARKELRTIYSELGRELARVSDADQGL
FT                   GDTAFRLVESLINLRADGLISTDSASTTADTVMILAGLKRELPAVRTASRDLISRFGDV
FT                   PERVSSMKSA"
FT   gene            complement(198423..199046)
FT                   /locus_tag="AAur_0191"
FT   CDS_pept        complement(198423..199046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0191"
FT                   /product="putative Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07019"
FT                   /db_xref="GOA:A1R1A2"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A2"
FT                   /protein_id="ABM07019.1"
FT                   /translation="MTKRNVLIGGRFFFGLLTLVAVGTQLTVHLGMGYDFWNFFSYFTN
FT                   LSNIFAALVLLISGYRVLVRKRPSELDDVTRGTATIAMAVVGLVFGALLAGEDLGSLLP
FT                   WVNFVVHYLMPVVMVADWLFQPPRATLRPKHIWYWLLYPIGYLVYSLIRGAFVNWYPYW
FT                   FIDPARAGGWGGVVVFAVAISVGFLLVSLAMLWLGNKLKRQVDY"
FT   gene            complement(199102..200475)
FT                   /gene="radA"
FT                   /locus_tag="AAur_0193"
FT   CDS_pept        complement(199102..200475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="AAur_0193"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07113"
FT                   /db_xref="GOA:A1R1A3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A3"
FT                   /protein_id="ABM07113.1"
FT                   /translation="MASKTSRASKTPAYKCAECGWTAVKWVGRCGECQAWGTVEEYGAT
FT                   VARTTAAATVLEPARRIAEVDGTTAAFLPTGVDELDRVLGGGLVPGAVILLAGEPGVGK
FT                   STLLLDVAAKFARTGQDVLYITGEESAAQVKLRAERIDAVAHTLYLSAETDLGQALGQV
FT                   EKLEPKLLIVDSVQTLSSADVEGSAGGVSQVREVAASIISAAKRRNMTTLLVGHVTKEG
FT                   TIAGPRLLEHLVDVVCQFEGERHSRLRLLRAVKNRYGATDDVGCFDLNEAGIEGLADPS
FT                   GLFVSRTREPVSGTCITVTMEGRRPLLAEVQSLLAESANSQPRRATSGLESSRVAMLLA
FT                   VLQQRAGCMLHKDDSYVATVGGVKLTEPATDLAVALAVASAKSRKALPQRLIAFGEVGL
FT                   AGEVRPVPGINQRIQEAHRLGFTHAIVPASPAGAGVIPEGFSVREVGHLAEALELLIT"
FT   gene            complement(200515..201753)
FT                   /locus_tag="AAur_0194"
FT   CDS_pept        complement(200515..201753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07715"
FT                   /db_xref="GOA:A1R1A4"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A4"
FT                   /protein_id="ABM07715.1"
FT                   /translation="MNDGGPLGYAARATLSGTCPAVVALRRNASRANRLERMAAAKGFS
FT                   ASKRFLRARVRTGLVRSRNSLTPAIQMTVCAVGAYAFAEYVLGHQGPLFAATSSLIALG
FT                   FSRDPRLRRVIEVGLGCTLGIVVGDLLLHWLGAGIWQAAVVLLFSILLARFLDSGTIFT
FT                   TQLGLQSLLVVLLPAPAGGPFTRSLDAVIGGVFALLVTILVPKDPRREPRKDVQKILYE
FT                   LAEVLRECAKAMIDSDSTQAWHALIRGRNCQPLVDRMRQTLRASGEVATLAPAHRRHRD
FT                   ELAGLEHSLEYIDLALRNSRVFARRLTSAINHAALSDEAIDSISEVLQETAAAIDEMTI
FT                   GLSEQSEGTRRVHLRRARNELADIAARLHPKMLDVQRLEGETVVMLFRPLMVDLLEASG
FT                   MEPEEARAVLPAL"
FT   gene            201892..203013
FT                   /gene="pstS"
FT                   /locus_tag="AAur_0195"
FT   CDS_pept        201892..203013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="AAur_0195"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00975"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08265"
FT                   /db_xref="GOA:A1R1A5"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A5"
FT                   /protein_id="ABM08265.1"
FT                   /translation="MKATHFGRNAAIAVIAAGALALTACGSDNATGTTGGTQSAASGPK
FT                   VTGTLTGIGASSTGAAMDAWKAGFSAANSGATVQYSPDGSGAGRKAIIDGSAQFAGSDA
FT                   YLKDEELESSKAKCGPEGAINIPVYISPIAVAFNVPGVTDLKLDAVTVAKIFRGEIANW
FT                   NDPAIAALNEGVTLPDLKVTPVNRSDDSGTTTNFTDYLAAAAPEVWTDKAAGIWPATLP
FT                   GENAKGTSGVVKVVTDTPGAVTYADDSAVSGKLGTASIKVGDEFVKISAEAAAKAVEAG
FT                   KPVDGRAANDVAIKLDRKTTASGAYPVVLVSYHVVCTTYETKEVADLVKGFETYVVSDE
FT                   GQKTAADAAKSAPLSKTLQDKAKAAIETIKAKA"
FT   gene            203223..204083
FT                   /gene="pstC"
FT                   /locus_tag="AAur_0196"
FT   CDS_pept        203223..204083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="AAur_0196"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09297"
FT                   /db_xref="GOA:A1R1A6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A6"
FT                   /protein_id="ABM09297.1"
FT                   /translation="MAAGCLILAVLFGVALFLVVQAIPALTAPAEDIQGGNGFFAYIAP
FT                   IVVGTLIAAVIALVIATPVAIGVALFISHYAPRRLASGLGYVVDLLAAIPSVVYGAWGA
FT                   AFLAKEISPAYDWLATYLGWIPIFEGPASATGKTILTAGIVLSVMVLPIITSLSREIFL
FT                   QTPKLHEEAALALGATRWEMIKMAVLPFGRPGIISAIMLGLGRALGETMAVALVLSSGV
FT                   LTASLIQSGNQTIAAEIALNFPEASGIKVNTLIAAGLVLFVITLGVNMIARWIITRHKE
FT                   FSGAN"
FT   gene            204084..205187
FT                   /gene="pstA"
FT                   /locus_tag="AAur_0197"
FT   CDS_pept        204084..205187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="AAur_0197"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10011"
FT                   /db_xref="GOA:A1R1A7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A7"
FT                   /protein_id="ABM10011.1"
FT                   /translation="MSATVVRKRSALTKGQLPKFAPYIVLAVALIVGAAILALIGFNAF
FT                   GWGIVSAILFAVGLVSWSGAVEGARKAKDKLATCLVVGAFLVALLPLISVIVTVLVNGI
FT                   PGLITPGFLGTSMNGVTGAFDNKAVEEGAPVLGGIYHALLGTIQITLLATVISVPVGLL
FT                   TAIYLVEYGNDRPLARAITFFVDVMTGIPSIVAGLFAAAFFFAIVGPGTKTGAVAAVAL
FT                   SVLMIPVVVRSSEEMLKIVPNELREASYALGVRKWRTITKVVIPTAISGIASGVTLAIA
FT                   RVIGETAPILVTAGFATTINNNVFGGWMASLPTFIYTQILNPTSPSNPAPSDQRAWGAA
FT                   LVLIILVMLLNLGARLIARLFAPKTGR"
FT   gene            205256..206035
FT                   /gene="pstB"
FT                   /locus_tag="AAur_0198"
FT   CDS_pept        205256..206035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="AAur_0198"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10017"
FT                   /db_xref="GOA:A1R1A8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A8"
FT                   /protein_id="ABM10017.1"
FT                   /translation="MSKRIDVKDLNVYYGNFLAVEDVNINIQAKSVTAFIGPSGCGKST
FT                   FLRTLNRMHEVLPGARVEGEVLLDGDNLYGPGVDPVTVRTQVGMVFQRPNPFPTMSIRD
FT                   NVLAGVKLNNKKISKGAADALVEKSLVGANLWNEVKDRLDKPGSGLSGGQQQRLCIARA
FT                   IAVEPQVILMDEPCSALDPISTLAVEDLINELKDQYTVVIVTHNMQQAARVSDKTAFFN
FT                   IAGTGKPGKLIEFADTTSIFNNPGQKATEDYVSGRFG"
FT   gene            complement(206132..207148)
FT                   /locus_tag="AAur_0199"
FT   CDS_pept        complement(206132..207148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0199"
FT                   /product="putative phosphate transporter"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06556"
FT                   /db_xref="GOA:A1R1A9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1A9"
FT                   /protein_id="ABM06556.1"
FT                   /translation="MTIAFLVLVVALASGFAFLNGFRDVSNAVALSTRTRALTPSIAVL
FT                   LAAIFNFVGAMLSGTFILAFTQSWITLPEGTSGLTMLASALTAAILWGVYAWWRGIPLS
FT                   STNSLIGGLIGAGAASVLVGGNAVGGMDNVLLTQVALPLVLSPVIAFVAAYLLVWPVTW
FT                   AARYTQPNVVNRRFRRAQAISTAAVAFGHGLQDGQRTAAVMVLAMVAAGLSSGSDVPLW
FT                   ILLVTAIMLTAGTMFGGWRISHTLGHKLIRVDPLRGFVAQTLTSVMLFIGAIGFHLPLS
FT                   TTHTLTAAVLGSGVNQRFHTVNRRLVRRVLLFWVATPLITAAAAFILELAFSPLADL"
FT   gene            complement(207150..207953)
FT                   /locus_tag="AAur_0200"
FT   CDS_pept        complement(207150..207953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08284"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B0"
FT                   /protein_id="ABM08284.1"
FT                   /translation="MIGLIRCVTSIARFPTLSDGDNCPPRSRSLSKRRRRTGKVGIEMG
FT                   CVKSSRPPPARPQPGSEMKLRLFPQEPAGLVLLAQMAGVIVAATGTLSEILGAPASEHQ
FT                   RLAEELHEHESKSLDLHFALLTHMRTSFVNPLPREDMYTLSRHLNEAMEKLDAAGDLVA
FT                   LYKLDRLPKRAADQLEIISRQAELTVDAMRKLEDLDELEDYWIEILRLAKRAERSHRIW
FT                   VAEMLKDMKSTQYARHRDIANQLVEVTKDMRKVATQVGSIIVKES"
FT   gene            207922..208695
FT                   /locus_tag="AAur_0201"
FT   CDS_pept        207922..208695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07594"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B1"
FT                   /protein_id="ABM07594.1"
FT                   /translation="MLVTHRINPINGGIVRLNNVVKITSLAAAGLLALTACGGATAGST
FT                   TGGSESSSSSSASASPSASASPLASTSSEGAGTSSGSYKVAAWALPISEAGDKLGSLKG
FT                   ESFSVDIYQVATDVASKDSMFVDKETKENLLKKGDPVVYLNYVVTNTSSADIPLSHSLV
FT                   TPKAKYLDWKYLGGMPSDSSSDGYKKHGLSSTGTKLKEKAPFVLKPGESFNIAENFGYT
FT                   AGKETEISATMTPQDAAGDLDHDKKDKAETTVTLK"
FT   gene            complement(208928..209587)
FT                   /locus_tag="AAur_0202"
FT   CDS_pept        complement(208928..209587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09276"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B2"
FT                   /protein_id="ABM09276.1"
FT                   /translation="MSEQPGSRAYGGANRHHKPKPFAPIDFEPFAGGADPARVSEAAHL
FT                   AAQALVRRGRDSDDPKVTRRLVKLADEQGLEAIAEMWAESPARSLPGALWRLYALRAAT
FT                   IQNPEKISVYFRAGRDTAQVSNVVAGAAEPPGADEMKTMADAILSGAFDGEFDVALERS
FT                   AAFCRVVALGQATLADGAEHSNEGHASKLTRNSHQLVKTAEDLEHAANAWRLGELD"
FT   gene            209827..209902
FT                   /locus_tag="AAur_0203"
FT   tRNA            209827..209902
FT                   /locus_tag="AAur_0203"
FT                   /product="tRNA-Lys"
FT   gene            210126..211652
FT                   /gene="abfA"
FT                   /locus_tag="AAur_0205"
FT   CDS_pept        210126..211652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abfA"
FT                   /locus_tag="AAur_0205"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="identified by match to protein family HMM PF06964"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08551"
FT                   /db_xref="GOA:A1R1B3"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B3"
FT                   /protein_id="ABM08551.1"
FT                   /translation="MGNQENPTAKITIDPAFVVGPVRRKTFGAFVEHLGRCVYTGIFEP
FT                   EHPKADEDGFRTDVLELTKELGVSTVRYPGGNFVSGYRWEDGVGPKGDRPTRLDLAWHS
FT                   SDPNLVGVDEFAKWSEKAGVEPMMAVNLGTRGTQEALDLLEYSNIKGGTALSEQRKANG
FT                   AVEPHNIKMWCLGNEMDGFWQIGHKKAGEYARVAAETARAMRMVNPDLELVACGSSAPT
FT                   MPTFGEWERVVLNETYELVDLISAHQYFEDFGDLQEHLSAGHRMEAFIKDLVSHIDHVK
FT                   SAIKSQKQVNISFDEWNVWHMSRDESKAPTGDDWPVAPVLLEDRYTVADAVVVGDLLIT
FT                   LLRNTDRVHSASLAQLVNVIAPIMTEPGGRAWKQTTFHPFALTSQHAAGTVLNLAVESP
FT                   RLDSEKTSGFTALSAVATYDAEANEAVVFAVNRSATDALTLDGAVGSLNPARVIEAVTY
FT                   TNKDPYWQATADDSTSVLPSENVSVKLDGGRLTTELPAVSWSMIRLALNS"
FT   gene            complement(211649..212023)
FT                   /locus_tag="AAur_0204"
FT   CDS_pept        complement(211649..212023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08839"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B4"
FT                   /protein_id="ABM08839.1"
FT                   /translation="MTIANRDLFQALKTQASLAQAFGTLPGSQDEPHALNPGQYIEAWH
FT                   NGRLYHRGTVVKTVAGTELFWLQDETGSRRLLDMESMEIVTLDEPAPAPATQAPEPTTA
FT                   ATVTPMSAFPIFRDGSQAIA"
FT   gene            complement(212132..212428)
FT                   /locus_tag="AAur_0206"
FT   CDS_pept        complement(212132..212428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08414"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B5"
FT                   /protein_id="ABM08414.1"
FT                   /translation="MGFDINEPEQRSKLRAAIDAAGINIGNLWLYYFSIGGSVGEYEVE
FT                   AYLQGMLSIPELERDLLAMAANDLLNNHGGPRAPYADELPQDDPPASEDPETP"
FT   gene            complement(212439..213161)
FT                   /locus_tag="AAur_0207"
FT   CDS_pept        complement(212439..213161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0207"
FT                   /product="ANTAR domain protein"
FT                   /note="identified by match to protein family HMM PF01590;
FT                   match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06584"
FT                   /db_xref="GOA:A1R1B6"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B6"
FT                   /protein_id="ABM06584.1"
FT                   /translation="MTKKQLPLDELSTAIGRILGLLLTEEKVDHAVQNLSQAIRESVPG
FT                   TIGAGVSILDSQGRRTSRGFTDSVVEQADFLQYELGEGPCLTAWATEETVLVHDLSDDS
FT                   RWAQWSAAVSSLPIRSVISAPLTAGGQSFGTIKVYSPEPAAYDTETANLLELFASPAAT
FT                   LLSHIQSAETPKRISEGLQSALQSRDLVNRACGMLMERHGIPHELALQRLLKHTRDHGS
FT                   SLHHISAEIVAGIPADKN"
FT   gene            complement(213286..214077)
FT                   /locus_tag="AAur_0208"
FT   CDS_pept        complement(213286..214077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0208"
FT                   /product="ANTAR domain protein"
FT                   /note="identified by match to protein family HMM PF01590;
FT                   match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07739"
FT                   /db_xref="GOA:A1R1B7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B7"
FT                   /protein_id="ABM07739.1"
FT                   /translation="MTETQPSHHIGSPPNGLRQQDTADLTDFLVRLQDILVENEDIREF
FT                   LQDLAEMTAAKLTRIGNTIACGVTVVRQKKPVTIAHSDALARRLDKMQNSFGDGPCLTA
FT                   LRTRTVSHVPDVNTEERWHSYMTAVRAMKVRSILALPMELQGTGEAVVNLYSTRPHGFS
FT                   QEDIQAAERVTATAAKSLRLALKMAQLRDARENLTAALESRTTIDTAVGIIMGQNRCSR
FT                   EAAFQILVKASSHRNIKLRSVAATVIAGVAGDQETLISFEE"
FT   gene            complement(214089..214346)
FT                   /locus_tag="AAur_0209"
FT   CDS_pept        complement(214089..214346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0209"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07352"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B8"
FT                   /protein_id="ABM07352.1"
FT                   /translation="MTGPLNSADAAPDPPRKFAGERFRDAGLSLNGLWAYYYGIGGNAD
FT                   EFDLDGYLNGLTTLDQAQMALVDTALEELGNESPGRSASW"
FT   gene            complement(214330..215067)
FT                   /locus_tag="AAur_0210"
FT   CDS_pept        complement(214330..215067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0210"
FT                   /product="ANTAR domain protein"
FT                   /note="identified by match to protein family HMM PF01590;
FT                   match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09368"
FT                   /db_xref="GOA:A1R1B9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1B9"
FT                   /protein_id="ABM09368.1"
FT                   /translation="MAQYNAVPTAEELQDLLLESPGFSEFLLGLTTISASLLGGETPML
FT                   CAITVERDGGPATVASSTEAARVLDEKQYEFDDGPCLTALRTGQMVQIPDLHSDIRWRG
FT                   YANAISGAHVRSMLAVPISTDNGSGAALNCYSNEVGAFDPDTVVAVQRYADSLSRTLRL
FT                   ALRMHSSDPYPAGLRSVLESRAVVDAAISLIMMQNRCSRESAMKLLHLASRNTDRRLHE
FT                   IARDMLTRSGDPDQGTGKHDWTP"
FT   gene            215278..216282
FT                   /locus_tag="AAur_0211"
FT   CDS_pept        215278..216282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0211"
FT                   /product="putative transcriptional regulator, lacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09811"
FT                   /db_xref="GOA:A1R1C0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1C0"
FT                   /protein_id="ABM09811.1"
FT                   /translation="MAVTMNDVARAAGVSLKTVSNVINNYEFIRPATKQRVLDAIDELG
FT                   YETNLTARSLRSGKTSMLGLVLADLSIPYYAELASDIMKAAWARGYRVLVEQSGNEAEH
FT                   EQAALQGQFRSLTDGLLFIPLALDAEQIIAAAGKKPLVLLGEFVQDPRLDMVLIQNQEA
FT                   AAAVTTHLLEGGRRRIAVLGAHDGDEAGSNGLRLRGYRAALAAAGVAYDPALVVPCDWR
FT                   RDAGADATARLLDSGVEFDAVFGLNDALALGALHELLVRGRKVPEEIAVAGFDDIDESR
FT                   FASPSLTTVAPGRAEIAERSVELLIQRIESKDAVANVEQPEAVFELRIRQSAP"
FT   gene            216317..217417
FT                   /locus_tag="AAur_0212"
FT   CDS_pept        216317..217417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0212"
FT                   /product="putative alanine racemase, N-terminal domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01168"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09054"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1C1"
FT                   /protein_id="ABM09054.1"
FT                   /translation="MNVIPAEVITPAVLIDVDVLDRNIERMAGNMRGRGLQLRPHVKTH
FT                   KTLEIARKQLAAGALGITVATIGEAEVFAADGVKDIFIAFPLWVEAPHAERLRALTAKC
FT                   RLAVGVDSAESATAMGRQLGVDAGSVEVLIEVDSGHHRSGVLPDEVVDVAEAAAAAGLS
FT                   VQGVFTFPGHSYKPGMPTGAASNENEALGLAATALTSAGFEVTTISGGSTPTALIDGET
FT                   VATELRPGVYVFGDAQQLELERCSWDDIALSVAATVVSRHEARGGNVRRVVLDAGSKIL
FT                   GSDRPDWATGYGRLPEYPEAKVTALSEHHATVVWPDSSELPPLGTRLRVIPNHVCLTMN
FT                   LVDQVIVVHGGAVAERWTVAARGRNN"
FT   gene            complement(217577..218098)
FT                   /locus_tag="AAur_0213"
FT   CDS_pept        complement(217577..218098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0213"
FT                   /product="flavin reductase-like domain protein"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08123"
FT                   /db_xref="GOA:A1R1C2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1C2"
FT                   /protein_id="ABM08123.1"
FT                   /translation="MTHHIPVPSEPVGELFRAAFRAHPAGVAIVTAAGPEGAVGLTASS
FT                   VASVAVEPATLAFSVTSGRSASVIAAAQTIVVHLVGADQLELVRAFADPSAPRFTDAMD
FT                   WEVLPTGEPLLREADWALRCEIIHRAPLGGSVLLAARVVEIRSNPSDSAPLVYHNREFH
FT                   TLLESVPALG"
FT   gene            218297..218599
FT                   /gene="ureA"
FT                   /locus_tag="AAur_0214"
FT   CDS_pept        218297..218599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="AAur_0214"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="identified by match to protein family HMM PF00547;
FT                   match to protein family HMM TIGR00193"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06851"
FT                   /db_xref="GOA:A1R1C3"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R1C3"
FT                   /protein_id="ABM06851.1"
FT                   /translation="MHLLPREQEKLMIVVAADLARRRQARGLKLNYPEAVAIISYELIE
FT                   GARDGRTVAELMSYGTTLLRREDVMEGVPEMIHDVQIEATFPDGTKLVTVHNPIR"
FT   gene            218608..218976
FT                   /gene="ureB"
FT                   /locus_tag="AAur_0215"
FT   CDS_pept        218608..218976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="AAur_0215"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="identified by match to protein family HMM PF00699;
FT                   match to protein family HMM TIGR00192"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06946"
FT                   /db_xref="GOA:A1R1C4"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R1C4"
FT                   /protein_id="ABM06946.1"
FT                   /translation="MIPGEYRLQPGSIACNSGRDAMVVEVVNRGDRPVQIGSHYHFAEA
FT                   NRALEFDREAAYGRRLDIPAGTAARFEPGDRKTVQLIELAGTREVHGLSNAVNGKLDGG
FT                   TAVAGEPRPGIAAERDHQ"
FT   gene            218973..220703
FT                   /gene="ureC"
FT                   /locus_tag="AAur_0216"
FT   CDS_pept        218973..220703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="AAur_0216"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="identified by match to protein family HMM PF00449;
FT                   match to protein family HMM PF01979; match to protein
FT                   family HMM PF07969; match to protein family HMM TIGR01792"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07828"
FT                   /db_xref="GOA:A1R1C5"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R1C5"
FT                   /protein_id="ABM07828.1"
FT                   /translation="MSFEIPRKQYAQLYGPTTGDSIRLADTELFLEIEKDYTVYGEEVV
FT                   FGGGKVIRDGMGQNGQLTRAEDIPDTVITNVIVLDYTGIYKADIALKDGHIFKIGKAGN
FT                   PQITDGVDIVIGASTEIIAGERKILTAGGIDTHIHFISPEQVPAALCNGITTMVGGGTG
FT                   PAEGTKATTITPGAWHISRMLQAAEGLPVNIGLFGKGHASAVEPLAEQIRAGAVGLKVH
FT                   EDWGSTTSSIDMSLRVADEYDVQIAIHTDTLNECGFVEDTIRAIDGRVIHTFHTEGAGG
FT                   GHAPDIIKIAGLPNVLPASTNPTLPYTRNTIEEHLDMLMVCHHLNPDIPEDVAFADSRI
FT                   RAETIAAEDVLHDLGIFAITSSDSQAMGRVGEVVTRTWQVADAMKRQRGALHDPSGAPH
FT                   GSAESDNFRLKRYIAKYTINAAIAQGMADVIGSVEEGKFADLVLWDPAFFGVKPELVIK
FT                   GGQIAYALMGDANASIPTPQPRTMRPMFATYGKALQQTSITFLSQAAIDAGVPAELGLQ
FT                   RIIKPVSGIRNLTKADLKYNGETPDIAVDPETYKVTVDGVEVTSQPSDVLPMAQRYFLF
FT                   "
FT   gene            220712..221185
FT                   /gene="ureE"
FT                   /locus_tag="AAur_0217"
FT   CDS_pept        220712..221185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureE"
FT                   /locus_tag="AAur_0217"
FT                   /product="Urease accessory protein ureE"
FT                   /note="identified by match to protein family HMM PF02814;
FT                   match to protein family HMM PF05194"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07070"
FT                   /db_xref="GOA:A1R1C6"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R1C6"
FT                   /protein_id="ABM07070.1"
FT                   /translation="MIIEKILGNLHQQPDAYASHHKEKVVLPSTLLVKRIQRVTTDHGK
FT                   ELGIRLPAGTGDLRDGDILAIDQHNIIVVSVLPTDVLVIKARTIHEMGVVAHSLGNRHL
FT                   QAQFFDGSSEYGAEVMVCQYDHTVEDYLKSVGVPYDRQERVMPVPFRHAEHSH"
FT   gene            221384..222055
FT                   /gene="ureF"
FT                   /locus_tag="AAur_0218"
FT   CDS_pept        221384..222055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureF"
FT                   /locus_tag="AAur_0218"
FT                   /product="urease accessory protein UreF"
FT                   /note="identified by match to protein family HMM PF01730"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09149"
FT                   /db_xref="GOA:A1R1C7"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R1C7"
FT                   /protein_id="ABM09149.1"
FT                   /translation="MSATYQLALQQLTDSALPTGAFAHSLGFESYIHRGLVRDESTFST
FT                   WLQAFVSQQLSYSDGLALRFLFEGVDVGLLDGVLSAQLLAREVREASLKMGGRLLEIGG
FT                   EVFPSAELEAYRGLVRAGSASGHQPLAFGVIARSLGVPLEEALSAYLFATVTSLTQNAV
FT                   RAIPLGQNAGQRVLRQAHDAVAAAIHVVAQLCWDDFGAVSPGLEISQMRHERQRARMFM
FT                   S"
FT   gene            222077..222694
FT                   /gene="ureG"
FT                   /locus_tag="AAur_0219"
FT   CDS_pept        222077..222694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /locus_tag="AAur_0219"
FT                   /product="urease accessory protein UreG"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM TIGR00101"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08583"
FT                   /db_xref="GOA:A1R1C8"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1C8"
FT                   /protein_id="ABM08583.1"
FT                   /translation="MTEPIKIGVGGPVGAGKTQLVERITRHMSRDISMAAITNDIYTIE
FT                   DAKILAANGILPENRIIGVETGGCPHTAIREDTSMNTAAIEELKTRHPDLQIIFVESGG
FT                   DNLSATFSPELVDFSIYIIDVAQGEKIPRKAGQGMIKSDLFIINKTDLAPHVGADLAVM
FT                   ERDSKEFRGNKPFCFTNLKTDEGLDEVLNWIRRDVLMLDLAS"
FT   gene            222856..223728
FT                   /gene="ureD"
FT                   /locus_tag="AAur_0220"
FT   CDS_pept        222856..223728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="AAur_0220"
FT                   /product="urease accessory protein UreD"
FT                   /note="identified by similarity to SP:Q07400; match to
FT                   protein family HMM PF01774"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07529"
FT                   /db_xref="GOA:A1R1C9"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R1C9"
FT                   /protein_id="ABM07529.1"
FT                   /translation="MGPDSTLALGEGAVRGRLELGVCLRGGRSVASRQFHEGALRVLRP
FT                   HYLDESGQVGYVMVNPGGAYLGADLFLIDVTVENNAALLLTTQSATKVYRTPGSFAEQR
FT                   MSVRLGEGSRLELMPDQLIAYREASYRQNSRISLHPTSSLIMAEVITPGWSPDGASFKY
FT                   QEVRLRNEIWIDDENGAKLLALDNLLIRPPLGDVTGMGFMEGFSHLGSLVVVDPRVNQG
FT                   LADELDLIARDFDAYTGMSLTATIAGSTGLVLRSLSNSTEELNNLLGACAGVLRERWYG
FT                   QAPLNLRKY"
FT   gene            223728..224774
FT                   /locus_tag="AAur_0222"
FT   CDS_pept        223728..224774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0222"
FT                   /product="putative high-affinity nickel-transport protein"
FT                   /note="identified by match to protein family HMM PF03824"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08915"
FT                   /db_xref="GOA:A1R1D0"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D0"
FT                   /protein_id="ABM08915.1"
FT                   /translation="MTALTEFATMYRERETLSLRTRLLFTFGAVAALHLAAVVLLLAGT
FT                   AGGAQPLALGLVITAYVAGIKHSYDWDHIAAIDNSTRKFVAQHKDPVSVGFAFSLGHSS
FT                   VVILAGLLVVAGATLIGQFMEDGTTGNKVLGLIGSGVSGLFLLAMGLFNGSAFVRASSV
FT                   YRQVQRGGDVRPEDLEAKGLIARLLAKPLSKVERPRNIYVIGFLFGLGFDTATTIGLLV
FT                   ITTTASLAGVSPLALMALPLAFTAAMTLCDSANGVAMMKMYKSAIHNPRRKLGFNALIT
FT                   GISAVSALFISVITLGGFANSAFELQDPLTTWLGSIDLGDAGLILVGLFVIVWAVASLR
FT                   GRGAGSGT"
FT   gene            complement(224771..225748)
FT                   /locus_tag="AAur_0221"
FT   CDS_pept        complement(224771..225748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0221"
FT                   /product="putative beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07857"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D1"
FT                   /protein_id="ABM07857.1"
FT                   /translation="MVETGPAADWARKQVDLKRVPVAVLGIASSQGIEDIVAFGTDDGR
FT                   PATADDHFALFSVTKPISALTVMRQVELGKLSLGASLGDALPGFGAGRTDTVTLEQLLS
FT                   HRSGISDPVLDGGTPLREALTSAEQAFYAGSLVQYCNIAFEGAAAMAEWAGGVPFEDQL
FT                   LSLAADTGAQGLTFGTECNPHTVHGTEAAGLDVQAMYKNRHPGAGLFGTAADLLNLGSE
FT                   LLRGSGKAVRPATLAAMRRPRTTEVSHITTRPKPIRHTGLGFQMPANESELFAQGIYGH
FT                   PGWSGTEWWMFPEQDRCVVFLTNVLDTPDLGVDTNELFNAVAVS"
FT   gene            225907..226416
FT                   /locus_tag="AAur_0223"
FT   CDS_pept        225907..226416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0223"
FT                   /product="putative RNA polymerase sigma (70) factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07373"
FT                   /db_xref="GOA:A1R1D2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D2"
FT                   /protein_id="ABM07373.1"
FT                   /translation="MLSERELAFIAIHKDSYPSVFKFVCRRVESVDVAEEIAADVYRIV
FT                   WQKWSDDSRPDLPYLLTVARNLVGNAYRSRDRRLALQEKLRTTAVQRFGDDSENVAVQD
FT                   ALESLREKDRDILQMAYWDGLGTADIAKVLQCSESAAKVRLHRARTAFRKQLPAGANST
FT                   TQKMGV"
FT   gene            complement(227540..230329)
FT                   /locus_tag="AAur_0224"
FT   CDS_pept        complement(227540..230329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0224"
FT                   /product="alpha-amylase family protein"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06947"
FT                   /db_xref="GOA:A1R1D3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D3"
FT                   /protein_id="ABM06947.1"
FT                   /translation="MLSRSYRPNNCPQRPLLNRIAAVVMTTAVLTASAVLPAGAAPAPT
FT                   PDHAAQHSIRGGISDQNFYFVMADRFSNGTTANDDGGLGADPMVSGFDPTRKGFFNGGD
FT                   LKGLQDQLDYIQGLGTNSLWLTPSFKNKAVQGDGTLANSSAGYHGYWVTDFTQIDPHLG
FT                   TNAELKTLIDAAHARGMKVYFDIITNHTADVIQYQETASAPYISKETEPYRTAAGEVFD
FT                   DRDYAGTQDFPPLDAATSFPYTPVVPDAEKDVKVPSWLNDPTLYHNRGNTNFAGEDSLY
FT                   GDFFGLDDLFTENPKVVNGMMDVYKTWIRDFGIDGFRIDTMKHVNDEFWQQFGPQVLSY
FT                   AKEQGKDEFFMFGEVFDTSKTVTSKFTTKNQMQAVLDFGFQGAARSFASQSSKATGLAD
FT                   FFNGDDWYTDADSNVYQLPTFLGNHDMGRIGTFIAQDNPGASDSELVERDELAHELMYF
FT                   SRGNPVIYYGDEQGFTGAGGDQDSRQTMFASKVQEYLDDDLLGTSSTHATDNFDTQHPL
FT                   YKKISELAALAAEHPTLRSGAQQNRYAADGAGIYAFSRIDAKEQREYIVAVNNSETAQT
FT                   AAIPTYEAKQPFKLVYGDAAKHAKTGQDAKLTVTVPPLSAVVYEAAGRLAKSTAAPAVV
FT                   LKKPVTAAGDASRLKVTADVDGNSFYEVTFQSRTPGGEWTAIGTDDNAPYQVFHDVSSV
FT                   ETGTSVEYRAVVLDNRGQTSASEPKSGVVGEPTQPESVTVVGSLNTELGCTEDWQPSCE
FT                   QGLMSYEPTHRLWQLSVPNLPSGTYEFKAALNGTWDENYGAGGELDGPNVAFTHSGGAV
FT                   TFLYDHATNLISAVTAGQQPAAVSVPGSLNSELGCAGDWMPDCAQAQLSLDAADGLWKL
FT                   SVPNLAAGSYEFKAAINGSWAENYGLAGAANGSNIALKHDGGPITFRYDPASHLVTVR"
FT   gene            230650..230847
FT                   /locus_tag="AAur_0225"
FT   CDS_pept        230650..230847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0225"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10051"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D4"
FT                   /protein_id="ABM10051.1"
FT                   /translation="MKSIALLRERATRVMPTGSHCPASGLWSPDSDPDAVQVFAEGHIL
FT                   PAHDGVPTVWRRRTAAEVSA"
FT   gene            230844..231074
FT                   /locus_tag="AAur_0226"
FT   CDS_pept        230844..231074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0226"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06573"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D5"
FT                   /protein_id="ABM06573.1"
FT                   /translation="MTSTILNRPADYRHVPAAEWTELTSGDPVWIYDVAWGAGTGRVDD
FT                   VSKHQELLWVILEPTGRRLICGTDDVEVWTA"
FT   gene            complement(231149..232171)
FT                   /locus_tag="AAur_0227"
FT   CDS_pept        complement(231149..232171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0227"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09229"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D6"
FT                   /protein_id="ABM09229.1"
FT                   /translation="MWVGSYTADRDGKGEGIVALSADDDGKLTSLGLAIAANSPSFLAL
FT                   HPSLPVVYAVAEEGKTVRAYRRTGDSGLEAFGDPWPAGEATCHVAADPQGRFIVATCWG
FT                   DGQVILYELDHDGAITSRTSAAAAVDPHTATSPDGERPSRAHSSLMLPDGRVMTTDLGH
FT                   DLVRVWQYSPGVGLQTDHQVILPKGSGPRHMARHHSGTVFVDTEYSVEVAAIRMEPDGT
FT                   YELTTMVPASATGAKDGDAGAEIALSPDGRFAYVGVRGSNRICILKVSHSGGELEPVAE
FT                   VPCGGEWPRHHLVREGWLYVANEGSDDVVSFKLDSETGLPDGPVSRVETGSPSVLVPAV
FT                   "
FT   gene            complement(232195..233025)
FT                   /locus_tag="AAur_0228"
FT   CDS_pept        complement(232195..233025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0228"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09745"
FT                   /db_xref="GOA:A1R1D7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D7"
FT                   /protein_id="ABM09745.1"
FT                   /translation="MTLAPLIELNDGHKIPQLGLGTWPLNDAQVADAVVEAVSHGYRHV
FT                   DTAVKYGNEKGVGNGIRACGVNREELFITTKLDGEFQGSGKAAAGLDGSLERLGLDYVD
FT                   LLLIHWPLPRRGDFVDTWKTFEELQASGKVRSIGVSNFKPAHLDQLLRQTDVVPAVNQI
FT                   QVSPTIPRPAARAFNERNGIITESYSPLGASSDLLNAPVLADIGKKYGKTPGQVVLRWH
FT                   VQQGLVAIPKTANPQRMRENLDIFDFELDHDDLTRLQTLDAGPDAGVDSDVQGH"
FT   gene            complement(233089..233937)
FT                   /locus_tag="AAur_0229"
FT   CDS_pept        complement(233089..233937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08735"
FT                   /db_xref="GOA:A1R1D8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D8"
FT                   /protein_id="ABM08735.1"
FT                   /translation="MLHADVRDAAAVREVLRGREFDAVADFISFTPDQARAGLELFRGR
FT                   TGQYVFISSASAYQKPPTLLPIRESTPLKNPFWQYSRDKIACEELLYEAYREQDFPLTV
FT                   VRPSHTYDRTKIAMVGGWTDIHRMRAGMPIMVHGDGTSLWTLTHSRDFAKAFVGLLGRP
FT                   QAVGESYTITSDEFLPWNQIYRLFARAAGVEEPELFHVSSDTIAAHSHELGPNLLGDRS
FT                   HSVVFDNSKIKALVPDYRATIPFADGAREIVEWHDTHPELQTVSEDFMELSDRLYEWSR
FT                   R"
FT   gene            complement(234123..235094)
FT                   /locus_tag="AAur_0230"
FT   CDS_pept        complement(234123..235094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0230"
FT                   /product="putative sugar-phosphate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06910"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1D9"
FT                   /protein_id="ABM06910.1"
FT                   /translation="MQYTHLGRSGLKVSRLCLGTMNFGPQTDEATAHSIMDSALDSGIN
FT                   FFDTANVYGGTGHRGWTEEIIGRWFAKGGERRERTVLATKLYGTMTDRPNESKLSALNI
FT                   RRALDASLKRLQTDYIDVYQFHHIDRDTPWDEIWQAIEVGVQQGKILYSGSSNFAGWHI
FT                   AQAQEAARRRNYTGLVSEQSIYNLFRREVELEVIPAAQQYGLGLIPWSPLQGGLLGGVL
FT                   KKEEQGVRRTEGRALETLKKHEEQIRQYEDFADELGHAPGDVALAWLLHQPAVTAPIVG
FT                   PRTQEQLDAAIRALDVSLNEDALKRLDDIFPGHKPAPEDYAW"
FT   gene            complement(235119..235940)
FT                   /locus_tag="AAur_0231"
FT   CDS_pept        complement(235119..235940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0231"
FT                   /product="putative 2,5-diketo-D-gluconic acid reductase"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07303"
FT                   /db_xref="GOA:A1R1E0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E0"
FT                   /protein_id="ABM07303.1"
FT                   /translation="MPELTLNNGVTIPQLGFGVFQVPAEETQKVVEDALEAGYRHIDTA
FT                   AAYRNEAGVGAAVAASGIPREELFITTKLRNGEQGEAYDAFQRSRDALGLEVIDLYLIH
FT                   WPVPSQGLYTQAWKEMEKLYQDKQIRAIGISNFLSEHVDTLLKEAEVVPAVNQIEVHPT
FT                   YQQGELATKCRDLGIAVEAYSPLGQGKDLNAEQVALVAAAHSTTPAQVILAWHLAQGTI
FT                   VIPKSADSKRMRENFGAADLTLTESELAAITALEAGARIGSDPAVAAFTQL"
FT   gene            236125..237003
FT                   /locus_tag="AAur_0232"
FT   CDS_pept        236125..237003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0232"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06441"
FT                   /db_xref="GOA:A1R1E1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E1"
FT                   /protein_id="ABM06441.1"
FT                   /translation="MGQSAEFGKFLKVMRARLSPEDAGSQESSGARRVPGLRREEVARL
FT                   SGVSTDYYTRLEQGRNIHPSKAVLDSVARALRLDAGEHAHMMDLLEHCASSAGNPGPAQ
FT                   KVRPGLRQLLDAVGDVPAMVLGRRADVLAGNQMAHLLFTDFPSLPAAERNLTRWIILDP
FT                   SAGQLFRDWKTVAAEAVGALRMDVGRHPNDPRTNQLVGELAVHSEHFRQWWAGHRVASR
FT                   SAGTVRLHHPIVGDLELNFETLSLPDDPDQMLRVYSAKPGSPSSDALTLLSLGDVGTKA
FT                   KDREPARRDGS"
FT   gene            complement(237057..237266)
FT                   /locus_tag="AAur_0233"
FT   CDS_pept        complement(237057..237266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0233"
FT                   /product="putative protein of unknown function (DUF1458)"
FT                   /note="identified by match to protein family HMM PF07311"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09230"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E2"
FT                   /protein_id="ABM09230.1"
FT                   /translation="MAGHTYSVSEIVGTSTEGVDDAIKNGIATASQTLRNLDWFEVKEI
FT                   RGHLEDGAVADWQVTIKLGFRLER"
FT   gene            complement(237376..238182)
FT                   /locus_tag="AAur_0234"
FT   CDS_pept        complement(237376..238182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0234"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06893"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E3"
FT                   /protein_id="ABM06893.1"
FT                   /translation="MSDAPFSPETAIVTGSDSGIGRATAVALAKAGMNVGITWHSDQQG
FT                   AEETAEEVRGLGRKAVVHPLDTTDARGTAAAIDKLAEELGGVDVFVNNSGTGDGTKFLE
FT                   LDYDTWMSTLDTNLNGAFVAMQTAAKRMVKAGRGGRIIAVTSVHEFQPRVGASAYDASK
FT                   HGLGGLIKTMALELAEHGITANNVAPGEIATPMTGQEDEDPKQKERPGVPLGRPGDARE
FT                   IAAVIAFLASPESSYVNGASWPVDGGMLQMGPQAGSHITSNDWRES"
FT   gene            238343..238774
FT                   /locus_tag="AAur_0235"
FT   CDS_pept        238343..238774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0235"
FT                   /product="putative universal stress family domain protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06469"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E4"
FT                   /protein_id="ABM06469.1"
FT                   /translation="MSEVIVVGVDNSETAKRAAVAAAKLATALGAELHVISGFSDDRIE
FT                   EFGSGSDRITVSSADSAEYVARKVSEELDVPAGNIKYFAARGTPANALINYAETNNASL
FT                   IVVGNKRMKGLGRVLGSIANSVAHGAPCDVYIVNTDVEA"
FT   gene            complement(238845..240296)
FT                   /locus_tag="AAur_0236"
FT   CDS_pept        complement(238845..240296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0236"
FT                   /product="putative pectate lyase"
FT                   /note="identified by match to protein family HMM PF00544"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06902"
FT                   /db_xref="GOA:A1R1E5"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E5"
FT                   /protein_id="ABM06902.1"
FT                   /translation="MADAQGLNIRRRTLLSAGLAAGTLVSTGLFGPAASAAAPTGVKSN
FT                   GFNEAGLPINGGHGGAWSVAPTGFAGVSAHGRAGTTGGAGGRLVHANTPEDLRQFAKSA
FT                   EPLVVILHGELLFTQYEKLTVTSNKSFLGAGEGAAVVNAGFKLVNVSNVVFRNFTVRDS
FT                   YIPGDFAGKRPDNDRDGIQVDTSTHIWVDHMHFTRLGDGLVDIRKDCDNVTLSWNVFSD
FT                   HNKALGEGWTQNVVTRLTLHHNWIRNTHQRNASLDNTAASHVYNNYLENISSYGMLGRN
FT                   AALLLVEGNYFRDVRNPLHHQGPGGALAARNNVFDECTGNVGEERGGAFNPPYSYSLAP
FT                   TKALPSLVRAFGGPLGGTEPALRKVITVALDGTGDFASIRAAIGAVPANNPAAVTVLVH
FT                   PGIYHEPAVIWGDRRNITLAGATGNAEDVILSNSEGVTLLVAADGSALRDLTITSDIPQ
FT                   SGHVLLITGRGVTRSNVTVLNGTTG"
FT   gene            complement(240298..242280)
FT                   /locus_tag="AAur_0237"
FT   CDS_pept        complement(240298..242280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0237"
FT                   /product="putative pectinesterase/pectate lyase protein"
FT                   /note="identified by match to protein family HMM PF00544;
FT                   match to protein family HMM PF01095"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08514"
FT                   /db_xref="GOA:A1R1E6"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E6"
FT                   /protein_id="ABM08514.1"
FT                   /translation="MRLRRLLGAATAVVILGSLTAVPARAEPIHSGTESPAAPAALWKQ
FT                   RPDGFASLPGNGLDGTTGGQAGRHVSVSSLEELKTHAAAEEPLVIFLKGSITAQDYVKI
FT                   PVASNKSFIGTGAGVELINAGFKLINVSNVIFRNFTVRDSYIPGDWDGKRPDNDRDGIQ
FT                   LDTSHHVWVDHMKFERMGDGMIDTRKDSDYLTYSWNVFADNNKALGVGWTGNAVTKMTI
FT                   HHNWIRNTVQRNFSLDNTAAAHVYNNYLQDIGQYGMMGRNAAKVVLEGNYFTAVADPVV
FT                   AKDPATEIVNRDNIFESTRGRKDNVGSAFDPTQFYSYAKDDSARVPELVTGSAGPRENK
FT                   APSTTAEVTVALDGTGDFGSVQAAIGSIPVGNTQPRTITIKPGFYREAVNVWADRPNVT
FT                   LQGATANPADVVISYDTPANGAKFFGGTWGAAGSATLNVLAENTTVRNLTVENAYDEAV
FT                   HGGSQALAVRTVADKITFDNTRFLGNQDTYLADTTGRDATARTYLKNCYIEGDVDFLYG
FT                   RGTAVFDGCTIHSLDRGSDTNNGYIVAPSTKDSNPYGFLIVDSTLTSDAAPGTVSLGRP
FT                   WFASSDPNAHPMAVIRDSNLGSHIAEQGWSDMSGHAWTEGRFAEFNNTGPGAYINEFHP
FT                   QLTPEEGLKFTKDTFLGDWTPAAGA"
FT   gene            complement(242331..243227)
FT                   /locus_tag="AAur_0238"
FT   CDS_pept        complement(242331..243227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0238"
FT                   /product="putative ABC-type sugar transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07981"
FT                   /db_xref="GOA:A1R1E7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E7"
FT                   /protein_id="ABM07981.1"
FT                   /translation="MALLDLPLKRKLAKQDQPEDALTGTPVSRFSRHLILCLVGLVMLY
FT                   PLMWLISSSMKPSNDIFRQLGLWPENWDFSNYAQGWTALDQPFHVYLINSMIVVIFSII
FT                   GNIFSCALAAYAFARMEFTGRKLFFALMLGTLMLPGHVLLVPQYIIFSQLGWLDTYLPL
FT                   IVPNFMATNAFFIFLMVQFMKSLPKELDDAAQIDGCGPFRTFIRVILPLCVPAMATTAI
FT                   FTFISTWNEFFGPLLYIQNQDLYTVPLALRAFMDSEGQSMWGPMFAMSVVSIAPIIGFF
FT                   IAGQKYLINGIATTGLK"
FT   gene            complement(243237..244184)
FT                   /locus_tag="AAur_0239"
FT   CDS_pept        complement(243237..244184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0239"
FT                   /product="putative ABC-type sugar transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09100"
FT                   /db_xref="GOA:A1R1E8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E8"
FT                   /protein_id="ABM09100.1"
FT                   /translation="MTVLTKQPPGAPAPAAAGGTPRLRPSRRRKQRSGYLFLLPWFLGM
FT                   LFTVIPFFASLYLAFTDYNLFTEPNFVGLANFQAMFEDPRLIQSLKVTFIYTFVSVPIS
FT                   LAVALLVALVLNRGLQGLSIYRSVYYLPSLLGGSVAIVMLWRYIFGNDGIVNGFLGIFG
FT                   IQGPAWVTDPQFSLSTLIVLNVWTFGSPMVIFLAGLRQVPGMYYEAASIDGASKWRQFR
FT                   SITLPLISPIIFFNLIMQLIGSFQTFTQGYVMSGGTGGPADSTLFYNLYLYQKGFTEFE
FT                   MGYASAMAWLLLMIIAIFTAINFIASKFWVFYDN"
FT   gene            complement(244218..245531)
FT                   /pseudo
FT                   /locus_tag="AAur_0240"
FT                   /note="putative ABC transporter substrate-binding protein,
FT                   authentic point mutation; this gene contains a premature
FT                   stop which is not the result of sequencing error;
FT                   identified by similarity to RF:ZP_00412030.1; match to
FT                   protein family HMM PF01547"
FT   gene            245848..246711
FT                   /locus_tag="AAur_0241"
FT   CDS_pept        245848..246711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06852"
FT                   /db_xref="InterPro:IPR029475"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1E9"
FT                   /protein_id="ABM06852.1"
FT                   /translation="MGSFQLHGATVARVNNGVDLATVLAPRPYLHPLRTLAGAPLTEAG
FT                   PDDHPHHLGLSLAFSDVNGSNFWGGSTYTGHGPALLANHGRQVSSGWSYQPGKAGGTVT
FT                   WMDMKGQELATEQRSYTCQDHPDPNSWSLLFDSLIQPAGDVEQLWVSSSAVKGREGAGY
FT                   GGIFWRFRTGDGPAGVLCSQGTGTETAHGSLSPWLVVKTRQHGRDVSVVLAQNPAELRP
FT                   WFVRTEGYVGAGPAVAWSEAARVDRNRPLQLSLHAIIHDGHISSSHHVEELLLQHFSSS
FT                   SPDRTP"
FT   gene            246717..248297
FT                   /locus_tag="AAur_0242"
FT   CDS_pept        246717..248297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0242"
FT                   /product="xylosidase/arabinosidase"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF04616"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08102"
FT                   /db_xref="GOA:A1R1F0"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F0"
FT                   /protein_id="ABM08102.1"
FT                   /translation="MGNRHRIPVYNNPILNGDWPDPDAVQVEGTYYLIASSFNRVPGLP
FT                   VLRSKNLVDWEHAGHALPELPQTNHYSLVRHGSGVWAPALRHHDGKFWIFYPDPDHGIF
FT                   VLSAEKAEGPWSVPHLLYPGRGLIDPCPLWDDDGTAYLVHGWAKSRIGVKNRLTVHRMS
FT                   PDASRLLDHGTHVINGEELPGFTTLEGPKFYKRDGWYWIFAPAGGVATGWQSVFRSRSP
FT                   FGPYEERRVLEQCDSPVNGPHQGAWVTTPEGEDWFLHFQDRGAYGRVVHLQPMGWGEDG
FT                   WPWMGKTADDGGPGTPVLSHPYPVGTSPEDVAPPSSDNFTSPALGPQWHWQANPRDEWL
FT                   STCGGGHLILRPQANDPINLRELPNVLAQILPGEPSTFTTTLELDDVPVGTRAGVVVLG
FT                   QRYAWLGLVRTENGYVLGSGTGSEGPYEQQMGRAVALPGPSIELQIRTDETPRATFAWR
FT                   VGPTDPWQIPIWDFDVVEGRWIGAELGIFAASPLGSREHGSVRVGPVRVDTAPVRRATT
FT                   QRIAAPVSP"
FT   gene            248294..249322
FT                   /locus_tag="AAur_0243"
FT   CDS_pept        248294..249322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0243"
FT                   /product="putative transcription regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07402"
FT                   /db_xref="GOA:A1R1F1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F1"
FT                   /protein_id="ABM07402.1"
FT                   /translation="MSSRTAPLTTPRPKIADVAAAAGVSVPTVSKVLNGRSHVSESTRA
FT                   RVQQALEELDYTKRNSPSEPGLLQLVVNNFDSPWVLETMEGVEAAATRLGYTVAYTRAV
FT                   NATAENWQKLREPSGNRLDGVMLLAPRQGSPLVELARTLNIPAVAIDPEGSQGLQIPSV
FT                   SPASFSGALRAVSHLLELGHERIGIITGRVHSPGHGRARYAAYAAALHEAGLPVLPEFV
FT                   RDGDFSIESGLRLGGELLDLPERPTAIFTGSDLQALGVMNAAGQRSLKIPGDLSIVGFD
FT                   DIAQAALTSPPLTTVRQPLAQLASMAVGMLTEQIEQQGLATSAALEVATELVVRGSTAP
FT                   PK"
FT   gene            complement(249383..251059)
FT                   /locus_tag="AAur_0244"
FT   CDS_pept        complement(249383..251059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0244"
FT                   /product="putative acetolactate synthase, large subunit"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08559"
FT                   /db_xref="GOA:A1R1F2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F2"
FT                   /protein_id="ABM08559.1"
FT                   /translation="MSGQVRVSTLVGRTLAKLGVGHVFGVVGSGNFDVTGTLMAEGIPF
FT                   TATRHEGGAATMADAYSRMSGKVGVVTTHQGCGLSNAITGIGEAAKSRTPMIVLTADTQ
FT                   AAAIRSNFKIDQDALARSVGAVAERIHSPATAVADTVRAFRTAVNERRTVVLSLPLDVQ
FT                   SGAAADEVSAVVVPQPLKVRPDTGAVEQLAALIAKAERPVFVAGRGGRGARDEILALAR
FT                   HAGALVATSAVASGLFNGDSHNLGISGGFSSPATAEFINGADLIVGWGCALNMWTMRHG
FT                   RLISAGTTVVQIDVEDSALGANRPISLGVLGDSALTAADALAALAGVQPEPAEKYRTET
FT                   NALAIKQGSRWRDVETEDLSTATAIDPRVLTRELDTLLPAERIVAVDSGNFMGYPSQYL
FT                   AVPDEYGFCFTQAFQAIGLGLYTAIGAAVAQPQRLPVLGAGDGGFLMGISELETAARLK
FT                   LPLVCIVYNDAAYGAEVHHFASEHTEAELSSVVFPDTDIAAIARGFGAEGVTVRSVGDL
FT                   DAVRPWIAAYEAGTQTRPLVIDAKIASDGGSWWLAEAFQGH"
FT   gene            complement(251056..251847)
FT                   /locus_tag="AAur_0245"
FT   CDS_pept        complement(251056..251847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0245"
FT                   /product="putative cyclase family protein"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09696"
FT                   /db_xref="GOA:A1R1F3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F3"
FT                   /protein_id="ABM09696.1"
FT                   /translation="MSVLAGLTAALSSGSVEIIDLTTPLSSETPILNLPQPFANTVGLS
FT                   VSPVSNFDDAGPAWAWNDVTVGEHAGTHLDAPVHWITGKDGKSVDQIEPHRLVGAIVVI
FT                   DKTTEVSADPDFLLEPEHFEQWQQEHGAFPENCWVIFRTGWAARGADAAAFVNADDAGP
FT                   HTPGVSAAGAKWLAGNASISGFGVETVGIDAGQAGGLDPMFPVHSFLLGADKYGVTSLR
FT                   NVDRLPVTGATLVVAPLPIVGGTGSPSRVYALVEKGAVEKA"
FT   gene            complement(251855..253504)
FT                   /locus_tag="AAur_0246"
FT   CDS_pept        complement(251855..253504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0246"
FT                   /product="putative dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06418"
FT                   /db_xref="GOA:A1R1F4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F4"
FT                   /protein_id="ABM06418.1"
FT                   /translation="MDHPLDVAIIGSGINSLVAAAELALAGKRVCIIERSDRLGGFIHS
FT                   AERTLPGFIHDTFSSWHPLFVSGGAYGALGKELHARGLEYCNTSGPVTAGVAADPVTGA
FT                   HRVIIAHRDPAETAAAFKEPRDGAAYLAMLDDLGRNAETVFGAFGAELRSFGEVAKIAF
FT                   GAVRRGRFSGTEAFVRDSVMSGRNYVRSRFDGWEADQLWSPWLLHAGLGPDQATGGVML
FT                   PVMAMSMHGFGLPVVKGGASQFVAAFESLLRDNGVRIMLGAEADEILVGPDASGKGRSA
FT                   TGVRTSQGVVSAGTVLANVSPQALYTRLLRQPPAGTAKAAERYQNGRGAMQIHLALDKP
FT                   VEWLDPRLNTVPLVHISNGSDSTGIACAQAEAGLLPNEPSVVVGQQCVLDPSRAPEGKA
FT                   TLWLQLQEVPFTPVGDAAGQLDVAGGWTDELKHGYLERVLARIEQFAPGTRATVLASDI
FT                   LAPTDLSSANPNAVNGDPYGGSAELFQNLLWRPFPAAAGHQTAVEGLWHIGASTHPGPG
FT                   LSGGSGHLVAQKLTAKPSRFSRIQSALKPSKR"
FT   gene            complement(253529..255271)
FT                   /locus_tag="AAur_0247"
FT   CDS_pept        complement(253529..255271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0247"
FT                   /product="putative monooxygenase component B"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10099"
FT                   /db_xref="GOA:A1R1F5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041654"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F5"
FT                   /protein_id="ABM10099.1"
FT                   /translation="MRKIAIVGAGESGAQLALGLQRDGYAVTLLSDRSAAQIRTGKVMS
FT                   SQCMFSTALDAEAHMGTALTEFYESGAVPGITSIRLRVDSDEPIEWEAPLDGPARSIDQ
FT                   RIKSALWIETFVAAGGDFRIEKVTPRMLEELAHDYELVIVSTGKGEIGQIFPRDKAKSP
FT                   FDRPQRVLALNYVTSDDGASAAGTGGAGDAIRMSMAPGVGEFFTFPGLTVSGPCRMMVF
FT                   EGVVGGPMDRWADVGTPEEQLERSLEILRDHFPHEAENFAAAELTDSGATLLGRITPTV
FT                   RFAVGELGNGKLVFGLGDAVVLNDPLTGQGSNNATLAAKYYLDSIIRRGQQPFDRAWME
FT                   RTFDEFWRGWGQWAVEWTNDLLKPRRDHQKTLLREAADHPALAASIVSGFDDPRTSYPW
FT                   WFDPTAAADFMQARKEDDAAAFDVRDFRGALGQFATGVTVVTTVSADGRKVGMTANSFT
FT                   SVSMDPPLVLWCPSKRAPSLGDFEDATHFAINILASDQHVLSRQFATPATDKFAGVETA
FT                   DGIAGVPLLEGAVATFQCRTVARHDAGDHVIYVGEVESYNHQDGAPLVFHGGKYHATAS
FT                   HPDF"
FT   gene            complement(255299..256540)
FT                   /locus_tag="AAur_0248"
FT   CDS_pept        complement(255299..256540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0248"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07034"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041654"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F6"
FT                   /protein_id="ABM07034.1"
FT                   /translation="MTQRHITIVGAGQSGLQLGIGLLDAGYQVTTISNRTPEEIHEGKV
FT                   ASSQCIFHNALEHERALGLDFWPDAPTVDGISFTIPHPELPGEKAISWASRLDNHAKSI
FT                   DQRVKFPRFMEEFTARGGELVFEDAGVAELEKYTQNSDLVIVAAGKGEIAQLFTRDAER
FT                   STYDAPQRALALTYVKGLTPREDYSAVSFNLIPGVGEYFVFPALTTTGPCEIMVFEGVP
FT                   GGPMDSWKGLSPEEHLENSKNILKTFLPWEAERATDVELTDPNGVLHGRFAPTVRHPIA
FT                   TLPSGRQVLGLADVVVLNDPITGQGSNNASKCAASYLDSITRYGGGAYDANFMQATFER
FT                   YWDYAQHVAHWTNALLAPPPPHVLELLGAANSEPAIAHRFANGFNHPPEFQDWFMYPDK
FT                   AASYLADLSAAKVS"
FT   gene            complement(256585..257373)
FT                   /locus_tag="AAur_0249"
FT   CDS_pept        complement(256585..257373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0249"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07464"
FT                   /db_xref="GOA:A1R1F7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F7"
FT                   /protein_id="ABM07464.1"
FT                   /translation="MSGLDGRTAIVTGGATKVGQGVVTSLRDAGATVVVADIAPDGDTL
FT                   TKALGEGIHYSHTDITDDAAVSELVEETVALYGGLDILVNLACTYKDDGAASGRADWLE
FT                   ALNVNLVSAVVASNAARPHLKASGHGAIINFTSISSSVAQTGRWLYPASKAALVQVTRS
FT                   MAVDFAEDGIRVNSVSPGWVWSNIMDSLSNGNLEKTDSVAAPFHALKRVGRPHEVGDVV
FT                   AFLASDQASFVTGADWAVDGGYSALGPERAEETIPLLAAN"
FT   gene            complement(257497..257646)
FT                   /locus_tag="AAur_0250"
FT   CDS_pept        complement(257497..257646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0250"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07974"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F8"
FT                   /protein_id="ABM07974.1"
FT                   /translation="MKNIKVVHDRRDEWDQRHFELWAAELQARETHLTSAAWVGWHEEE
FT                   EDPA"
FT   gene            257870..258793
FT                   /locus_tag="AAur_0251"
FT   CDS_pept        257870..258793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0251"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09387"
FT                   /db_xref="GOA:A1R1F9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1F9"
FT                   /protein_id="ABM09387.1"
FT                   /translation="MATTDVDEAHAKIAELFCSHELAPRTRASLMDMKLRSLHRGDVGI
FT                   EFLDYGADVRIEPEGLQDFHLVQIPLAGHASMQVGARTVESNPRMATVPPIDRPFSMSW
FT                   DGGSPHLIVYVRRSAVERVAGQLYGNDAVDLGYGMDLSGAAGRAFLRAVVELHDDMISR
FT                   PQFAAPAFVQGLLADSMVSRLLMAMQPPAGEARNAEAEGRLVRECRELLERHAFEELTV
FT                   PDIAECLGVSVRTLQTALRAETGATPSELLRSIRLDRAREMLLEANPREQSVTAVAEQC
FT                   GFTHQGRFSALYVKAFGELPSESLRR"
FT   gene            complement(259246..259947)
FT                   /locus_tag="AAur_0252"
FT   CDS_pept        complement(259246..259947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0252"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09764"
FT                   /db_xref="GOA:A1R1G0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G0"
FT                   /protein_id="ABM09764.1"
FT                   /translation="MARKSLVGVVADELLDRIIAGEFPPGTVVPGELELSAKHEVSRMT
FT                   VREAMKTLEAQRILSVERGRGTFVNPLNQWASLEAVLRAASEGTKDAAAAIQLIELRRM
FT                   LETGACELAAERISDDELTALKDHVEKMQAAHEINDLPAFVEADLAFHDVILHASGNVF
FT                   VAVLFEPLHRVLEARRAETSAFPEIQEHAIGHHRKIAAALESRNPNEARLAMDAHMQQT
FT                   LDDLKTYVLEA"
FT   gene            complement(260022..260825)
FT                   /locus_tag="AAur_0253"
FT   CDS_pept        complement(260022..260825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0253"
FT                   /product="hydrolase, alpha/beta fold family domain protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10212"
FT                   /db_xref="GOA:A1R1G1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G1"
FT                   /protein_id="ABM10212.1"
FT                   /translation="MADAGIPLPFVDVRTPAVSAGEPTPAVLIHGWASGSVYWEPLANK
FT                   LLDAGRTVWILDLPGYHTGDDLPPDFEWTLDSAAASVAAALDARAGGPVHVVGHSMGGS
FT                   VSLTLAAARPDVVATITLVGMAPVPQNQGFKKVLTSQLDQGFFDSATKTKLMNAWYGEL
FT                   SAADMERLSTGFDAPFPVLSASAVAAMTGVEPSVPGRVHAPLLVIAGTGDRVRPIEQMR
FT                   VFVAESQQRQLRAIPGAGHNVHWEQPEKCAAALIGFWETSRPPPA"
FT   gene            260955..262448
FT                   /locus_tag="AAur_0254"
FT   CDS_pept        260955..262448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07643"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G2"
FT                   /protein_id="ABM07643.1"
FT                   /translation="MTLEADVLAAFPAEVQIPAQLVADAVAASSATSPRVLVVLDDDPT
FT                   GTQSVADLAVLTRWDVADFTWAFTHIRENQTKPAVYVLTNTRSLDPAEAAARNEEVVRN
FT                   ALAAAAGNSGGPRLRLGFVSRSDSTLRGHYPLEPDVIAATVAAETGEATDGVVIVPAFP
FT                   DAGRVTIGGVHYMRGDAGSLTPVAETEFARDASFGFINSEMAKYVEEKSQGRFPAGDVI
FT                   VLDLNIIRAGASAQDPAISAKAIADALESASNSTPIVADIVTENDFRALALGLEEAERR
FT                   GKKLLYRVGPPFVRGRIGQEIRTALTSTEAYAGNTPSTAGGLIVVGSHVGVTTRQLNDL
FT                   TAEHSSAHIIEIDVEKLLDAEADAYIATVVSDVVDALRKGDVIVHTSRLLIKTDDAAAS
FT                   LKIARTVSAAVVSVVNRTLKTFPPRFVIAKGGITSSDVAAHGLEIRHAIVRGPMLPGIV
FT                   SLWEPVDGPAKGIPYIVFAGNVGDDQSLTQVTRKLSATF"
FT   gene            262489..263391
FT                   /locus_tag="AAur_0255"
FT   CDS_pept        262489..263391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0255"
FT                   /product="putative 3-hydroxybutyrate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM PF03721"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07734"
FT                   /db_xref="GOA:A1R1G3"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G3"
FT                   /protein_id="ABM07734.1"
FT                   /translation="MTSSDYTITVLGLGAMGLPMATRLASELTVHGFDIAEPRLELAAA
FT                   AGIKTFASAREASQDADALLLAVRNGEQLNDVLFGENGVAAVLKPGAVVILGSTVGTEA
FT                   IPATVAKLAEYGVSLVDAPLSGGPKRAGEGDLLIVVGAEPEALEKARPALELLASTLSI
FT                   VGDKPGDGQALKTVNQLLCGVHIAAAAEAMALADALGLDQAKTLAALEAGAAGSFMLSN
FT                   RGPRILEAYSEDGAEVLSRLDIFVKDMGIVGKATRAAGLAAPVAAAAEQLYLLGQAQGL
FT                   AAADDSAVIKVVAPSKRTA"
FT   gene            263575..264978
FT                   /locus_tag="AAur_0256"
FT   CDS_pept        263575..264978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0256"
FT                   /product="putative gluconate transporter"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08197"
FT                   /db_xref="GOA:A1R1G4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G4"
FT                   /protein_id="ABM08197.1"
FT                   /translation="MELGTPLLLTIAAAGIALLLVLIIRFKIQAFVALLAVSILVAVAA
FT                   QIPLKDIFTVVTTGVGSTMGKVALLIALGAILGRMIEVSGGVQSLATHFTEKLGAKRVA
FT                   IALTAVGFLVAIPVFFEVGVIVLVPIVYAFAKIANVHPIKFGLPMAGIMLSIHVAVPPH
FT                   PGIVAGAGVFGADIGLITLISLIICIPLGFLSYWVASIMNRKDYELLPGVKQQVDEFGS
FT                   DSLVHVGHDGPGARAIAPPRPGLIMFLIAAPIVQILLGTVGTLTLAKDNYWYGVAAFIG
FT                   NPFFALLVAVALSFFLLAVRRNWSLKETGEIFEGALPPIASILMVVAAGGVFGEVLRAS
FT                   GIGAALSHTLDSLGLPVIVLGFIISLALRAAQGSATVAIVTTTGLLTSAVMEGGYTPAQ
FT                   IAVIVIAIGFGSLGLSHVTDAGFWTVIRYYGLTVSDGLKTWTVLTTILGLAGFALTYVA
FT                   WILVGGLGH"
FT   gene            264978..265853
FT                   /locus_tag="AAur_0257"
FT   CDS_pept        264978..265853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0257"
FT                   /product="putative fructose/tagatose bisphosphate aldolase"
FT                   /note="identified by match to protein family HMM PF01116"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08336"
FT                   /db_xref="GOA:A1R1G5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G5"
FT                   /protein_id="ABM08336.1"
FT                   /translation="MRTKLDHLVNSALASGSAVPAFTCYDFTTALAVVGAAEESGLGVI
FT                   MLVAPKTASTPNGLRLIAALRGLADTASVPVSVQLDHASDLRVIRDSVAAGADAVLADG
FT                   SSLPYEDNIALVREVRAALDAQGASDVVLEAELGGLAGDEDKAFGAEDSEHDAGTSGAG
FT                   LTNPAQVADFVERTGAQLLAVAVGNVHGKYKGEPNIRWDVLQEVAAKTGVPLVLHGASG
FT                   IPADELAKAPSMQVGKVNFNTELRTGILATLETETAAHRADGENLQGLLARWNGSAATF
FT                   AGATLELLSA"
FT   gene            265905..266297
FT                   /locus_tag="AAur_0259"
FT   CDS_pept        265905..266297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0259"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06993"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09044"
FT                   /db_xref="GOA:A1R1G6"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G6"
FT                   /protein_id="ABM09044.1"
FT                   /translation="MILASLIFATIAALLHVYIFTMESITWTKPATWKRFSLTSQADAE
FT                   TTKPLAYNQGFYNLFLAIGALIGIIAVWAGAPQVGWTLVFSSCGSMLLAALVLAASGKK
FT                   YLRAATLQGTTPLLAVVLGVLAVTLG"
FT   gene            complement(266294..266713)
FT                   /locus_tag="AAur_0258"
FT   CDS_pept        complement(266294..266713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0258"
FT                   /product="putative glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09981"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G7"
FT                   /protein_id="ABM09981.1"
FT                   /translation="MTTSIFVNLPVSDLEASKAFYTALGYTINPNFTDETAACVVFSDT
FT                   IYAMLLTHAKFSEFTKQPIADTQNSTAAIVALSADSREDVDALAAKALEAGGSETYDAQ
FT                   DLGFMYSRAFRDLDGHHWEVLWMDEAAAQAGPPEH"
FT   gene            266980..268335
FT                   /locus_tag="AAur_0260"
FT   CDS_pept        266980..268335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0260"
FT                   /product="putative acyltransferase family domain protein"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07108"
FT                   /db_xref="GOA:A1R1G8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G8"
FT                   /protein_id="ABM07108.1"
FT                   /translation="MEMDEHQPASPAAVVHRDPAIDLVRFICLLLVVAAHCMMVSPVLQ
FT                   KDGTVVTVNVLMEQSWFTPVAWGLMIVPLFFVLGGVTGLQSWRRLRAHGGTGFDFAQLR
FT                   LLRLVRPAMAVLAVMWGGLWVALLLGVHPAVIQLMTAGAAMPLWFLAAYLTAQLSIPVM
FT                   ARLHERAPFLTFAALVALIITVDSLRGAIPVLAFANMVFLWCAVQQLGFLMADGFFEKR
FT                   SRGWLIGAVVSSNLLLGLVTGVAVYPGNMVVNLNPPNFSLLLLGISQTATLQLLQGGIR
FT                   RIADVRWIQGVMAVAGRRSMTVYLWHLPLLVGMSGLLLLTDVPKPLAGTPEWWWARIPV
FT                   FFAVVTLMVPVVWIFGRLENRPTAASHARGPTRTAVVTAAVVVLIPVADAAFNGLTLAL
FT                   LGGGAACFALSVLLLGRVPTPLLPPPVREGAESPERRRPTLPEPDLRANLET"
FT   gene            268332..268688
FT                   /locus_tag="AAur_0261"
FT   CDS_pept        268332..268688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07726"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1G9"
FT                   /protein_id="ABM07726.1"
FT                   /translation="MTEYKDSLAESFKAGVTTVRNDKFHRYELHVDGELAVISQFLDKP
FT                   GHIDFIHTETKPQFNGQGLAKVLAHFALDDVVASGKRIIPHCPYIAAYLKKHEGYEQDV
FT                   DWPAEMPVGEPDNE"
FT   gene            complement(268693..269274)
FT                   /locus_tag="AAur_0262"
FT   CDS_pept        complement(268693..269274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08209"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H0"
FT                   /protein_id="ABM08209.1"
FT                   /translation="MGIRRSRPFRKLMRATHHHTPRVPWAIVRGLPLRRSALLARKKNA
FT                   GHISLVYGADRPLAIPGDTVIFTAWITNDSTSHVRDINLVPRSFTNEGMEMLQYTSEPV
FT                   ERDLRIRLLAPGQSVMRSFTYLVTDSDHLHGGSLVSAMQVRATCRRGVITDEHDAIVSL
FT                   SGTRRDWPFKTTRAGQPRRSPKRSNASVLV"
FT   gene            269418..271022
FT                   /locus_tag="AAur_0263"
FT   CDS_pept        269418..271022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0263"
FT                   /product="putative RNA polymerase sigma (70) factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08205"
FT                   /db_xref="GOA:A1R1H1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H1"
FT                   /protein_id="ABM08205.1"
FT                   /translation="MDQLTAAAASGESPASTMAARSDSQIIELVREGATDAFDVLYQRH
FT                   FKVAHFVARAQSDNPSDADDVVAESFAAIFQQLTEGKGPKEFFRSYLLTVVRRTAHDRN
FT                   RKARRMPTAADDAILDSAVLDSDPVLDDLESSIMARAFKSLPERWQAVLWHLDIEGLKP
FT                   AAAAPLVGLTPNGVSSLALRAREGLRQAYLQQHISQTVGDCNEYASQLGKYARNALKRT
FT                   SEEKVRSHLDGCARCTALLMELNDVQGGMRAILFPLLTGIAFTPGAFAALGSAATAGGL
FT                   QAAAGSTAVSGQAGAVAARTASQMWKLTAAIVVGVLALAGVLVWFLQPSADTESAVASD
FT                   AASPAAPAAQETSSPSATPSSTPEPNPEPAATSTPEPTAVVIPPTPLPQRSAAVVDSGA
FT                   VFSTPVPASVALAAPAAQTVDGTFSVIPGSDKTERDLHVGFSLQGEGAPSTGEAVFTLP
FT                   DQATFVAGRTVAPAGWTCGNAASNMRQIRCTTESMDRENLAFTLGVALPPAAETGTVNY
FT                   RFGGNGIVSKTFANSFR"
FT   gene            271207..274080
FT                   /locus_tag="AAur_0264"
FT   CDS_pept        271207..274080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0264"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09883"
FT                   /db_xref="GOA:A1R1H2"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H2"
FT                   /protein_id="ABM09883.1"
FT                   /translation="MIYRGPQKLLAAIVATAITFLGVGSALAPPALATLPGSPGVAQPG
FT                   TPVYTETFANQNATASALSILSYMGGTAAANQTYTADTPYTPAGGQCDGWILNSFTPLA
FT                   TSDAGCLRNQPGGWEQIQQMSVALGLAQGQTAAQAASNQALSEYTNSASGNIAAGVQFR
FT                   TEANTIPAIAGHYYAVSGYFAQVNCHAAHASQTFSLLINGTRQVLSAGLDPCGSSTQPS
FT                   VQVTKLQSAAYQIPVGTNPSLGLELRNETATGIGNDVAFDLPQIVDVTPQLDKSFTPAL
FT                   IAPGGTSKVTLTITNTDDLKAKNDWSITDTLPAGLTVAGTPNMGGTCVQAAGTNPLEKW
FT                   AVAGSNTVSVIGGDLAQGMTACTITVDVTAAAEGTYVSGPANIVTNLNPPANATLSVRS
FT                   PRLALSKALGAPRLSDSHQFTTHIRTGSATGPVISSTANATTAGAGSTIEPNTGVTGEY
FT                   VANAGTPYYLTESGTNLSGYSNAITCVDANGLQSGLPSGAPFAGSLEIVPRAGADISCV
FT                   LTSTAHPVPTMECSVSADASDIQQSPVVGDRITYTFASKNTGNVPLTNVSITDPLAGLS
FT                   ALSYTWPGIPGELLPGQTVTATATYGITQEDIDAGHLANSATTTGTPPAGPPLATPPGT
FT                   TDTPLTQAAAMEFSKSADASAVLHPSVAGDVMTYTFTAKNTGNVTLTDVSIEDPLAGLS
FT                   ALSYSWPGAPGTLLPGETVTAKATYGISQADIDSGHVVNSATTRGTPPSGTPMTPPPGE
FT                   TDTQLTPGAGMRFTKTADASAVGDPAKVGDPITYMFTVKNTENAPLTHVVVNDLMPGLS
FT                   ALVYTWPGDAGILLPGEEVTARATYAVTQADIDAGHVVNTATATGTPPTGPVVATPPAS
FT                   VVVTFPPVGPNQSDGPRDGASRPDGPRDGPGQSDGPREGDGSPLGPSQSEGPLASTGVV
FT                   HNVLPISLIVVGAGLVLFLSGYRRTRH"
FT   gene            complement(274123..274482)
FT                   /locus_tag="AAur_0265"
FT   CDS_pept        complement(274123..274482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08769"
FT                   /db_xref="GOA:A1R1H3"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H3"
FT                   /protein_id="ABM08769.1"
FT                   /translation="MKDHVHEHIGFREIDEDGNALPAVSPHVPELADPAQKRASPNPFI
FT                   IVLWVLDAGLLGFGFWALTEAAAAMAGPTQFNTSAQLSFMLMSYTPYVLLGGLLLTAAL
FT                   LFWHAVQWQRKRPAS"
FT   gene            274825..276330
FT                   /locus_tag="AAur_0266"
FT   CDS_pept        274825..276330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0266"
FT                   /product="putative amino acid decarboxylase,
FT                   pyridoxal-dependent protein"
FT                   /note="identified by match to protein family HMM PF00282"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06965"
FT                   /db_xref="GOA:A1R1H4"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H4"
FT                   /protein_id="ABM06965.1"
FT                   /translation="MELALAATNQLFNARNSPSYVAQVLQGVNAVSTKVQRTAQPFTGV
FT                   GHAELKAKVGAVDLERPLPDTAAALEELDELYLKDAIYFHDSRYAAHLNCPVVIPALVG
FT                   EAVLSAVNSSMDTWDQSAGATMIERRLIDWTAERIGFDADADGVFTSGGSQSNFQALLI
FT                   ARNHAVAKLRATNGDARLPHLLDRLRIFTSVDSHFSIQKSASMLGLGFDAVIAVPTTED
FT                   HRMDPAALAAALAEAHDAGLVPMAVVATAGTTDFGSVDPLSELAALVRAYDSWLHVDGA
FT                   YGGGLIVSGRHRHLLSGIHLADSVTVDFHKTFFQPVSSSAVLVRNGSMMGHVTYYADYL
FT                   NPESAAKAEIPNQVDKSIQTTRRFDALKLWLTLRIMGADAIGALFDEAIDLAARVGTLL
FT                   AEDAEFELAAAPQLSTLVFRYRPMVDGAALDEDAADVLNPAIRAAIFASGEAVVAGTKV
FT                   AGRHYLKFTLLNAEASLRDIQEIIELIRRTGDSLLANTTEAAA"
FT   gene            276327..277670
FT                   /locus_tag="AAur_0267"
FT   CDS_pept        276327..277670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0267"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09498"
FT                   /db_xref="GOA:A1R1H5"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H5"
FT                   /protein_id="ABM09498.1"
FT                   /translation="MSTQDNGKIYDVAGIGVGPFNLGLAALSEPVENLDCVFLDRRESF
FT                   DWHPGMMLEPAHLQVPFMADLVTLADPTSPFSFLNFLKQTGRLYRFYIRENFYPLRAEY
FT                   NQYCQWVAGQLESVRFSTDVLDVTYDDGVYRLSVQGPDGAEVLLARKLVLGTGTSPYIP
FT                   DSCAGIVDAGGLVLHNADYLSRKSELQSKRSITIVGSGQSAAELYYELLQEIDVYGYQL
FT                   NWVTRSGRFFPLEYTKLTLEMTSPEYVDYFHSLPGEQRDSLIKSQKNLYKGINSDLIDD
FT                   IYDLLYTKSLSGMVDTQLHTHSSLTAAEWDPATGTHTLQLHHEEHGQSYSLESEAVVLA
FT                   TGYSYKEPAFLAGIHDRIRRDSKGRFDVERNYGTGVEPGEIFVQNAELHTHGFVTPDLG
FT                   MSAYRNSCILREITGREVYPIERSIAFQQFGAPAPVSAELPAAVGATA"
FT   gene            277667..278257
FT                   /locus_tag="AAur_0268"
FT   CDS_pept        277667..278257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0268"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07035"
FT                   /db_xref="GOA:A1R1H6"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H6"
FT                   /protein_id="ABM07035.1"
FT                   /translation="MSFTFRPVEPVADAPVLHSWVSQEYARFWGMVSATEQDVVEEYSK
FT                   IAESGHHQAFLGLDDGVPAFLMERYRPESSPLADVYEVQPGDVGMHLLVSPPAGAPQPG
FT                   FTTSVMQSVMAELFVDPATRRIVVEPDARNHKIHVLNEKVGFRPHGVVTLPAVDPAEDH
FT                   KQGLLSFCTREDFLATLTPILAAPAAATRGESL"
FT   gene            278254..280095
FT                   /locus_tag="AAur_0269"
FT   CDS_pept        278254..280095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0269"
FT                   /product="putative siderophore synthetase component"
FT                   /note="identified by match to protein family HMM PF04183"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08244"
FT                   /db_xref="GOA:A1R1H7"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H7"
FT                   /protein_id="ABM08244.1"
FT                   /translation="MTTTAHNATTTAVDTVSHLTPGRWAAANRHLVRKAIAEFAHERIL
FT                   VPELIREEGAGVGLYKVVSDDAATEYRFRARPLQLEHWSVTAESIVRLRDGQELPVDAL
FT                   DFIAEFHEALAIRQEMLPVYLEEISSTLASHAYKQGKPFTSAQLAAGITGGADRAADFQ
FT                   AIEHSMTEGHPCFVANNGRLGFGIADYHAFAPETGATVKLQWIAVHRSKAVFTSSAGLD
FT                   YRTHFEAELGPAILAWFNAELSASGLDPEDYLLMPVHPWQWDNKLTVTFAAEIAQRHIV
FT                   NLGTGEDSYQAQQSIRTFFNTDFPEKAYVKTAMSVLNMGFMRGLSPQYMKATPAINDWL
FT                   QELIGNDQELQNRGLAMIRETAAIGYHNHYYEAASAKGSPYRKMLSALWRESPLPLLKD
FT                   GQQLATMASLLHVDSSGNSVVSALISRSGLAPTEWLRRYFEAYLVPLVHCLFEYELAFM
FT                   PHGENVILILEDGVPVRAIMKDIAEEIVVMGDRLELPEEVSRVKAEIPAEEMVLAIFTD
FT                   VFDCIFRFLGAILVEDGTLREDEFWGTAAAVLREYQQRHPELADQFAMHDLFAPDFELS
FT                   CLNRLQLRNNQQMLDISDPSGGLQMAGRLANPLAKFA"
FT   gene            complement(280152..281471)
FT                   /locus_tag="AAur_0270"
FT   CDS_pept        complement(280152..281471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09675"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="InterPro:IPR039469"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H8"
FT                   /protein_id="ABM09675.1"
FT                   /translation="MVNSFLQGPLVLNNNGAWCWFQDERALIDPAANTLLVGSVAAPEG
FT                   QGGAERGGNIEVAVVNLATGQSRVHVLHERLEADDHNAPALFIRPDGRYVAMYAKHKTD
FT                   NYSRWRVSTKPHDASEWEPEQQFDWTELADGRGATYSNLHALSAEGRVYNFVRAINDDP
FT                   TLMISEDDGSTWSYGGKLFTRPKIGYVNGYTRYVSNGTDRIDLITTDHHPRDFNNSIYH
FT                   GYIQGDGLHDAEGKVVSKPVIGSAGINQAALTTVFEAGSTLDGDVLTHGWTTDLRRRGT
FT                   ELAAILTCRANDVNGPLQREQMLDVDDHRLLYARFDGVRWKLHPLAVAGPGLLPHEQDY
FT                   TGLGAVDPNDLDRVYISAPVDPRTGKATEHYEIYRGVTSDAGASWTWEAITEGSTVDNL
FT                   RPMVVPGDPSVHAVCWFRGSMASSQAYETEIVALVDAPRG"
FT   gene            281530..282309
FT                   /locus_tag="AAur_0271"
FT   CDS_pept        281530..282309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0271"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09285"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1H9"
FT                   /protein_id="ABM09285.1"
FT                   /translation="MTTRANELTALVTGATAGLGAEFARRLAEAGHHLVLVARDEQRLK
FT                   ETAEELERDFSISAEVLSADLTTDVGVSAVADRLRDATRPVDVLVNNAGIGLLKSFERN
FT                   ELDEERRHLRLHVQTPMELSHAALEVMLARGKGRIINVASVAAFANRGTYSAAKAWQVT
FT                   FSRWANITYAKSGVQVTAVCPGFTHTEFHDRMGMDKSVAPRFLWLTAERVVREGLEDNA
FT                   QGKGVSIPTRRYKVVSFFARILPAKLTSGPPRRPLEP"
FT   gene            282398..282829
FT                   /locus_tag="AAur_0272"
FT   CDS_pept        282398..282829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0272"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09083"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I0"
FT                   /protein_id="ABM09083.1"
FT                   /translation="MKNKSLALVGAIVLSGLLLSGCSGAGSTGFQALEREATAADNPPE
FT                   DLDLGEIHMEKILLVAEANGKKYYLGQGKQARPSCLIVESVDPYFWHSGCTDSIQGEML
FT                   RISGPDQKSAVLVSDDYDTKQLESSGLTKIHPNILVVTD"
FT   gene            complement(282835..283953)
FT                   /locus_tag="AAur_0273"
FT   CDS_pept        complement(282835..283953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0273"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10102"
FT                   /db_xref="GOA:A1R1I1"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I1"
FT                   /protein_id="ABM10102.1"
FT                   /translation="MGGDTANFQRQALTDWWCSPVPGLMVHARELHRLGPANNDRLSAV
FT                   RVALSVAVPGLFLLLIGRPDLMMYAVFGALTGMYGRNETHQLRLKHQAQAALFLVGGLT
FT                   IGVFLSVNHIHSWWLVLVATLFAGFGSLYADSVRLKPIGPFFGILALGACASVPTNVPF
FT                   TTAVLIGAASAAFSIVVGFTGWLRRRTWEAGAARDVPVLRGPLRQAALVHAARYSLAVS
FT                   AAGTIGVLSGSGHPHWAMAAAAVPLAGADLPSRVHRGIHRIVGTFLGLAIVAVVLFPGP
FT                   LSPLQYFPGQTAVVLAVLVVLCQFPTELFMARHYGWAMVFFTPVVLLIAQLAAPMDPGV
FT                   LVMERAIETFVGAVVGIAVAVLVRAPRSRASS"
FT   gene            284121..284543
FT                   /locus_tag="AAur_0274"
FT   CDS_pept        284121..284543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08521"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I2"
FT                   /protein_id="ABM08521.1"
FT                   /translation="MTQSREKAVGGVTTGLISEGETVTWQAWHLGVRFRMTSRITRMEA
FT                   PSSFSDEQVKGPFKYLRHTHEFRPDGSGTLMVDTVEFAAPFGPLGRLVEKLILARYLQN
FT                   LIEKRNGFLVAQTPQAPTPQAQTPQAPTPQAQDPRQ"
FT   gene            284540..285055
FT                   /locus_tag="AAur_0275"
FT   CDS_pept        284540..285055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0275"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07166"
FT                   /db_xref="GOA:A1R1I3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I3"
FT                   /protein_id="ABM07166.1"
FT                   /translation="MIRLAHADDLLILQEIERAAGQAFRALGMDSIADDEPLSIDELNS
FT                   YATAGRAWVSVDGLDYPVAYLLADIVDGAGHVEQVSVHPDQAHQGLGRELLHAARVWTR
FT                   GHGMQRQTLSTFRDVPWNAPYYRRLGFDVLDAGSWGPQLAHLMEHEAELGLTRWPRVAM
FT                   WRPAVPPK"
FT   gene            complement(285056..285457)
FT                   /locus_tag="AAur_0276"
FT   CDS_pept        complement(285056..285457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09638"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I4"
FT                   /protein_id="ABM09638.1"
FT                   /translation="MREVPVGSIHHLEIWVPFLERAREEWGWLLGELGYEPFQEWPTGC
FT                   SWKLNGTYVVVEQTDAITGTSHRRTDPGVNHVAFHAGTRENVDRIRALGADAGWYEMFE
FT                   SKYPHAGGPDHYAAYLLNTDSYEVELVAE"
FT   gene            complement(285467..286090)
FT                   /locus_tag="AAur_0277"
FT   CDS_pept        complement(285467..286090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0277"
FT                   /product="putative protease synthase and sporulation
FT                   negative regulatory protein"
FT                   /note="identified by match to protein family HMM PF04299"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06335"
FT                   /db_xref="GOA:A1R1I5"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I5"
FT                   /protein_id="ABM06335.1"
FT                   /translation="MYTPAHFAASEEAVASLLHDSEAANLVTMTEDGLLATLLPFVYEP
FT                   TVGEHGALHAHMARNNTQWSMPATGEALMIVQGSDAYISPSWYASKAQHGRVVPTWNYS
FT                   TAHVYGELVIHDDAQWLARHVRRLSDQHETGMPQPWSVDEAPERFIAGQLRAIVGVELL
FT                   ISRVEAKTKLSQNRTPADVDGVIAGLRAVGDSASAADVERARTS"
FT   gene            complement(286098..287018)
FT                   /locus_tag="AAur_0278"
FT   CDS_pept        complement(286098..287018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0278"
FT                   /product="putative Integral membrane protein DUF6"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06772"
FT                   /db_xref="GOA:A1R1I6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I6"
FT                   /protein_id="ABM06772.1"
FT                   /translation="MSPNSSATTLSRPVVSTRTSTGIWWGLLGVVAFSFTVPLTRVAVE
FT                   GMSPLFIGAGRAVVAAILAALALGLTRQRFPQGIQWLRLAVVAGGIVAGFPLLTTFALT
FT                   STSASHGAVVIALLPAATATVAVIRGRERPRPLFWVLTAVGVIAAVVFALVQSGGFGSL
FT                   HWADLLLLGAVVAAAIGYAEGGLLARELGAWQTISWALVVAAPVMILLTVLSLGSGAPS
FT                   ATPIQWLSFAYLGVVSMFLGFFAWYRGLAIGPMAQVSQIQLVQPVMTIAWAGLLLGESM
FT                   TWTTIVGGLAVIVCAGAAVRVRLRK"
FT   gene            287017..288432
FT                   /locus_tag="AAur_0279"
FT   CDS_pept        287017..288432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0279"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08418"
FT                   /db_xref="GOA:A1R1I7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I7"
FT                   /protein_id="ABM08418.1"
FT                   /translation="MNHDSSSRIVSRVKEWIAGAAPGAKLPSTRQLVAEYQASPVTVQK
FT                   ALRTLTAQGLIESRPGVGTFVRAYRTARPSDYGWQTAALRAAQTARPLNSAAMRSATND
FT                   VIAFHSGYPDRELLPERLVRAALTRAARGDAALSRPPAQGLPELQTWFAHELSTSTPVG
FT                   VTPPQPSDVVVLPGSQSGLSSIFRGLVGHGQPLLVESPSYWGALLAAGQAGVNVIPVPS
FT                   GPEGPDPDELERAFEESGARLFYAQPNFANPTGAQWSAERGEEVLRIVQRHGAFLVEDD
FT                   WAHDFGITAPSVPLAAKDDSGHVVYIRSLTKSVSPSIRIAAIIARGPARERIMGAQAAE
FT                   SMYVSGLLQAAALDVVTQPGWQTHLRGLSHQLQSRRDLLVTSLREHVPQAHLSHLPKGG
FT                   LNLWLRMPDGFDVDQLTKDCEAAGVLIAAGTEWFPAEPEGPYIRLNYTGPNPGAFPEGA
FT                   RIIGEAVKAQLGA"
FT   gene            complement(288562..290196)
FT                   /gene="proP"
FT                   /locus_tag="AAur_0280"
FT   CDS_pept        complement(288562..290196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="AAur_0280"
FT                   /product="proline-betaine transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08546"
FT                   /db_xref="GOA:A1R1I8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I8"
FT                   /protein_id="ABM08546.1"
FT                   /translation="MPTDQSNTVSPDGARNATGNQVLAGPTPAATNAAHAVKNATKKTK
FT                   LRPKRRLKESDVNVVNKPMLRKALGGTIVGNTMEWYDVGVFGYLITTMGPVFLPEADPS
FT                   VQTLFLLGTFAATFIARPLGGVVFGWLGDKVGRQKVLAATLMLMAASTFAVGLLPGYAQ
FT                   IGIWAAALLVILKLIQGFSTGGEYAGATTFVSEYAPDKRRGYFASFLDMGSYIGFALGA
FT                   ALVSVLQLTLGQTAMEEWGWRIPFLIAGPLGLIAVYFRSKIEESPQFQATLDAQEASAK
FT                   DAASQDAAVAKGPIGIIKAYWRQIVLAMILAAAANTVGYALTSYMPTYLTDSKGYDPVH
FT                   GTLLTIPVLVIMAVCIPLTGKLSDRIGRRPVLWIGAGSTIVFAIPAFLLIGIGDIWSTL
FT                   AGLALIAFPVTFYIANLASALPALFPTSSRYGGMGIAYNFSVAIFGGTTPFIVQGLIEG
FT                   TGDDMMPAYYLMATSIVGAVAIYFLRESAQRPLPGSMPSVDTQAEARELVATQDTNPLI
FT                   NLDEMPFDGRPIDDAVFGKSDKDLTPA"
FT   gene            complement(290484..291368)
FT                   /locus_tag="AAur_0281"
FT   CDS_pept        complement(290484..291368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0281"
FT                   /product="putative modification methylase, HemK family"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM TIGR00536"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10296"
FT                   /db_xref="GOA:A1R1I9"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022446"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1I9"
FT                   /protein_id="ABM10296.1"
FT                   /translation="MPHTLTKTRQICEPLTCSFFQPLKDSSSASMANVTRRASIATTLR
FT                   AAGCVFAEDEAQLLIDAAHHPEQLNRMVDQRLSGQPLEHIVGWADFCGKRMSVGPGVFV
FT                   PRRRTEFLVREAAMIAKPLTARRRAVVVDLCCGSGAIGAALNDLLGSCELHAADIDPAA
FT                   VQCARRNVEPRGGTVHHGDLYGALPRELRGKVDILLANAPYVPTESIGMMPPEARLHEP
FT                   RVALDGGADGLDVQRRIALGAAQWLGPGGAVVMETSGQQALETARILGEAGFIAEVASD
FT                   EELEATVVIGSSR"
FT   gene            291660..292064
FT                   /locus_tag="AAur_0282"
FT   CDS_pept        291660..292064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07350"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J0"
FT                   /protein_id="ABM07350.1"
FT                   /translation="MHRPAGKAPARGTSPPPPAASRLRPRRRSAGKPADRHMEIQAHWK
FT                   GRTMTANHDSERINPEVASHLVESMDMAPMPEPTTIAVALGADQSKQWPDGNGKRRHPK
FT                   ERDQAHGRMGQGAAVTAIHRTSRPQMPHSS"
FT   gene            complement(292208..294763)
FT                   /locus_tag="AAur_0283"
FT   CDS_pept        complement(292208..294763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0283"
FT                   /product="ATP-dependent DNA ligase domain protein"
FT                   /note="identified by match to protein family HMM PF01068;
FT                   match to protein family HMM PF04679; match to protein
FT                   family HMM TIGR02777; match to protein family HMM
FT                   TIGR02778; match to protein family HMM TIGR02779"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08006"
FT                   /db_xref="GOA:A1R1J1"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033649"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J1"
FT                   /protein_id="ABM08006.1"
FT                   /translation="MAGKQQERVNVEGHELTLTNLNKIIYPETGTTKAEVLEYYAAVAP
FT                   FLIPAAANRPVTRKRWVNGVGTAENPGQVFFQKNLEDSAPKWIPRAAIQHSDHTNVYPM
FT                   VNNLATLTWMAQIASLEIHVPQWQVDPSGKPLRPDRFVLDLDPGPGAGLPECVEVAKLA
FT                   RSILQDMGMDPVPVTSGSKGIHLYTGLDGTLKSEQVSAFAKELARALESDHPELVVSDM
FT                   KKSLRHGKVLVDWSQNSGNKTTIVPYSLRGKAHPTVAAPRTWRELSSPSLEHLDYVAVM
FT                   KRVKTGKDHFAPISERHLPPHGEDENDDDGTAGSSSGTGRSRERVVTVENRLAKYVGMR
FT                   DPGKTPEPFPSSSAVSASPQSAGSSSDQPKPGDPPPPGGIFVIQEHHARRYHLDLRLEH
FT                   HGVLASWALPRGIPETPDRNNLAVHTEDHPMEYANFAGVIPKGEYGAGTMTIWDRGEYT
FT                   CEKWRDGKEVIATLTGEPGGGLGGTKRFALINTGQNWLIHLMKEQPGGRRGTQPAANAA
FT                   APKSAPAQPQPQPMPNYSPMLATSGTTADLRGDDWLYELKWDGIRAIITGTESRIRLMS
FT                   RNGNDLTAAYPELTDRACWPDGDFVADGEIVALGKGSRPDFGRLQLRMNLVKAADIERA
FT                   RATVPVQLMLFDLLYDDGTDLSGLPFHERRERLSGFAERWRVGCPLHLSAVLDHDVEDL
FT                   MTSAAELGLEGVMAKKADSRYVIGRRSRSWIKLKLEQSQEVVVGGWRPGAGARAGTFGA
FT                   LLLGIPDGDKLHYVGRVGSGFKDWQLRDIMEKLEPLAIVESPFADIPREDAAGATWVSP
FT                   ELVAEVTFGEWTGPGRLRHPVWRGWRPDKSAGEVTLAGS"
FT   gene            294784..295668
FT                   /locus_tag="AAur_0284"
FT   CDS_pept        294784..295668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0284"
FT                   /product="Ku protein"
FT                   /note="identified by match to protein family HMM PF02735;
FT                   match to protein family HMM TIGR02772"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07375"
FT                   /db_xref="GOA:A1R1J2"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J2"
FT                   /protein_id="ABM07375.1"
FT                   /translation="MLLTGCMRAIWKGSIAFGLVNVPVKLYSATEDHDIGLHQVHNKDG
FT                   GRIRYQRKCEICSEVVAYEDIDKAYEEEGRTVVLTSAELKSLPEENSREIEVVEFIPAE
FT                   QLDPIMYERSYFLEPDSKSPKAYMLLRQTLEDTDRIAIVQYALRQKTRLGALRVRGDVL
FT                   LLQALLWGDEVREAKFPSLETDIKISDKELEMSSALVESMAHDFDPDEYTDDYQAQLKT
FT                   LIEAKLEKGEALDTEATFGVVEGEGEGGDVIDLMEALKRSLDKKRGKEKADDDAAAASK
FT                   TASKPKARAKKKA"
FT   gene            complement(295729..295995)
FT                   /locus_tag="AAur_0285"
FT   CDS_pept        complement(295729..295995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06485"
FT                   /db_xref="GOA:A1R1J3"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J3"
FT                   /protein_id="ABM06485.1"
FT                   /translation="MPGKKNSSLKDPKLYEELRDDGASKEKAARISNAAAAKGRKEVGS
FT                   KGGKSGDYDNWTVDKLKSRAKELGLKGYSAKKKSELISMLRNH"
FT   gene            complement(296047..296832)
FT                   /locus_tag="AAur_0286"
FT   CDS_pept        complement(296047..296832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10256"
FT                   /db_xref="GOA:A1R1J4"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J4"
FT                   /protein_id="ABM10256.1"
FT                   /translation="MAAPPRHPKRRRLRQRHCKGRVSPMLRPVKHPDTSGKDKTPARHW
FT                   VKDHGLLLVNAGLFVVFLGGMIISGAATYSEEQQAHGQPATGIPDFLTSGSFWEAVFEN
FT                   WESEFLQMAMYVVLTVFLFQRGSSESKPVDKEAPQDQDPRDAKKSPKTPWPVRRGGWVL
FT                   KVYEHSLSGLLGLLFLASFTLHAVGGAAAYNEEQLSHGLPEVSTWEYIASSQFWFESFQ
FT                   NWQSEFLAVAVLVGASVYLRERGSPESKPVAEPHYETGA"
FT   gene            complement(296766..297428)
FT                   /locus_tag="AAur_0287"
FT   CDS_pept        complement(296766..297428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07513"
FT                   /db_xref="GOA:A1R1J5"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J5"
FT                   /protein_id="ABM07513.1"
FT                   /translation="MFVLTHCFLLGYPMRPRHKRSRNADSSDRSPEYGRRPPEPHGGAQ
FT                   MVEPEQAPRIGRNESTEERMDRNWMELIQELRVLQTGVQILGGFLLTLPFQERFELLDD
FT                   WQRSLYLVNVMVAALTTVLIVLPVSVHRRLFRRGLKATLVSSADVVTKWALAGVALLIV
FT                   GSATLVFDFTAGRTAGLVAAGFIILVLLLLVVGTPLWLHRRAIRNGDGYGNGIAREE"
FT   gene            complement(297725..297946)
FT                   /locus_tag="AAur_0288"
FT   CDS_pept        complement(297725..297946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10177"
FT                   /db_xref="GOA:A1R1J6"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J6"
FT                   /protein_id="ABM10177.1"
FT                   /translation="MGIGDSSKIPPERNVLTMNTLLIIAGVVAIVLLLVGGFSQALNWL
FT                   LWVGVILLVIAAIGWLLSFMSGRRGHTV"
FT   gene            298106..298684
FT                   /locus_tag="AAur_0289"
FT   CDS_pept        298106..298684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0289"
FT                   /product="putative DNA-binding stress response protein, Dps
FT                   family"
FT                   /note="identified by match to protein family HMM PF00210"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09563"
FT                   /db_xref="GOA:A1R1J7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J7"
FT                   /protein_id="ABM09563.1"
FT                   /translation="MKGLLKSSPDDWAVAADIQRHVFRSHERPREEHMKASQQLADNLQ
FT                   IVLTDLIELQLQGKQAHWNIVGPNFRDLHLQLDELVLATRQFADDTAERMRALHALPDG
FT                   RSATIAKGTRLEEFPAGLVNTKNAVKLVTDRVERAVQTMRDVHDEVDEEDPTTADLLHA
FT                   FIARLEQLVWMINAEIMNAGAAVTDPDEA"
FT   gene            298729..299688
FT                   /locus_tag="AAur_0290"
FT   CDS_pept        298729..299688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09265"
FT                   /db_xref="GOA:A1R1J8"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J8"
FT                   /protein_id="ABM09265.1"
FT                   /translation="MPRLKRSDLSKPGIVRRKVGKGFSYRHPDGSLVSKEDRQRINALA
FT                   IPPAWTDVWISPYEHGHILATGVDAAGRSQYIYHPGWRERKDTEKFIRAAKLGLVLPTV
FT                   RRNVTVHLQDATEPRQQTLAAAVRFMDLGALRVGSEIYMKQNGSYGLTTLRCRHARVDG
FT                   PDVFLKFPGKSGQLWDTSIHDPALAAFLEPLVGRPGKERLLAYQANGSWVSVDASMINE
FT                   YLRGIAGEAYTSKDFRTWKGTAAAAMYLIKSGHTGTPRQAIVRAIKETSELLGNTPSVA
FT                   RSSYVDPRIIEAFLSEELKEVKPTEASIAAYLNGEAPR"
FT   gene            299776..300333
FT                   /locus_tag="AAur_0291"
FT   CDS_pept        299776..300333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0291"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08692"
FT                   /db_xref="GOA:A1R1J9"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1J9"
FT                   /protein_id="ABM08692.1"
FT                   /translation="MILLAIVVCEVAFWVAILAGLAARYLLRRPRLGGALLILAPVIDA
FT                   VLLALVAVDLLGGGTASWQHGLAAIYIGVSIAYGKRMVAWADAHFQHRFAGGPAPERLT
FT                   GARYTVKCWRDVLLTALAVVIASATLGAIILLVNDAERTSALSGFFRILGIIFAIDFLW
FT                   AVSYTIWPKKAARPVPATTSSH"
FT   gene            300340..300927
FT                   /locus_tag="AAur_0292"
FT   CDS_pept        300340..300927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0292"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09289"
FT                   /db_xref="GOA:A1R1K0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K0"
FT                   /protein_id="ABM09289.1"
FT                   /translation="MPRRIDAEARTAEIAEASLRVLERDGLAGLSVRGVAAEAGIAAAS
FT                   LRRAFATQHALREYCLQLIEDRVTARVAALELAGRALVDELLLQLLPLDKERRMELVAQ
FT                   VQLGVLSLTDSELRPAAIRLSDAVNRACRAAIQILTEAGQFSKGRDPQYEEQRLRALLD
FT                   GIAMHGLWSGELPDTSPMLSMLARHLDELAGP"
FT   gene            complement(301009..301284)
FT                   /locus_tag="AAur_0293"
FT   CDS_pept        complement(301009..301284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0293"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07915"
FT                   /db_xref="GOA:A1R1K1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K1"
FT                   /protein_id="ABM07915.1"
FT                   /translation="MPERTATIASRVGLHARPAAIFAEAAGDLDLDVTIARQGEPEDDA
FT                   MDAASILSLMSLGASHGDVVVLRAEGEGADAALDSLVKILETDHDA"
FT   gene            complement(301359..303392)
FT                   /locus_tag="AAur_0294"
FT   CDS_pept        complement(301359..303392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0294"
FT                   /product="PTS system, fructose-specific family, IIABC
FT                   components"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM PF02379; match to protein family HMM TIGR00829;
FT                   match to protein family HMM TIGR00848; match to protein
FT                   family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07471"
FT                   /db_xref="GOA:A1R1K2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K2"
FT                   /protein_id="ABM07471.1"
FT                   /translation="MTQLITPQLVTLDQNLGDSPADVIRVLAGKVAASGRASEVEGLFA
FT                   DAFAREQKTATGVPGGIAIPHCRSAAVQEPALAMARLSHKVDFGAKDGPADLIFFIAAP
FT                   DGADQEHLKLLSKLARSLIKKDFTAALRAAATEQDIVDLVDGALADKPAAATASAAAPA
FT                   EAAPAAAAASTTTTAAPKRIVAVTACPTGIAHTYMAADSLVAAAQEMGVDLQVETQGSS
FT                   GAKPLDPAVIAAADAVIFAVDVDVRGKERFAGKPVINAPVKRGIDEPTKMVQEALAAAD
FT                   DPHARRVPHFGAEEQAERAEEEKGEHIGQKLKRALLTGVSYMIPFVAGGGLLIALGFLL
FT                   GGYEITEVADKVVLENNFGNLPEGGLAIYLGAVLFKIGALSMGFLVPALAGYIAYAIAD
FT                   RPGIAPGFVAGAVSGFMGAGFLGGIVGGLLAGYIAHLIGTWQVPRWLRGLMPVVIIPLL
FT                   ASIVASGLMFLVLGGPIAGLTVALNNWLTGMSGASAVVLGIILGLMMCFDLGGPVNKVA
FT                   YAFAVAGLSAGSADNQAPWLIMGTVMAAGMVPPLAMALATVLNKKLFSLAERENGKAAW
FT                   LLGASFISEGAIPFAAADPLRVIPASMVGGALTGALCMATGVTSQAPHGGLFVFFAIGN
FT                   LPMFIIAIVAGMVVSALAVIALKRFAVKKPVEAEAAPATVSV"
FT   gene            complement(303389..304381)
FT                   /gene="fruK"
FT                   /locus_tag="AAur_0295"
FT   CDS_pept        complement(303389..304381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="AAur_0295"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06975"
FT                   /db_xref="GOA:A1R1K3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K3"
FT                   /protein_id="ABM06975.1"
FT                   /translation="MIVTLTANPSLDRTVELPGALARGEVQRAVAVHQESGGKGVNVSR
FT                   ALVASGLETLAVLPGADSDPVLSGLHDGGVPFAALPIGQALRSNVTLTEPDGVTTKINE
FT                   PGPELSDDQQDALIGLLLERSRGASWVVLAGSLPPGVPADFYATIARRLRSNSDGTATP
FT                   SIAIDSSGAPLAAALVGDASGKPDLLKPNAEELAELAAAAGFTNVSTADELEADPAKAA
FT                   EAAAAVVASGVGAVLATLGSKGAILVTADGAWLATHPPIRAVSTVGAGDSALAGYLLAA
FT                   TQGGSAQDCLRQAVAHGAAAASLPGSTVPAVHQTTPDAVTITALQKDSQ"
FT   gene            complement(304378..305169)
FT                   /locus_tag="AAur_0296"
FT   CDS_pept        complement(304378..305169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0296"
FT                   /product="putative transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06538"
FT                   /db_xref="GOA:A1R1K4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K4"
FT                   /protein_id="ABM06538.1"
FT                   /translation="MFAEERQQLISALVAERGRVSVTDLADRFSITTETIRRDLAALEG
FT                   SGNLRRVHGGAVPSDRFSTREESILERAVQRQVEKLRIAHAALALIPQLTAGSILLDAG
FT                   STTETLADLLAQQTPSRNGNDELVVITHAIPIAGKLSSTQGIALQILGGRVRGLTQAAV
FT                   GQSTVEAAHKLRPDIAFVGANGIHATFGLSTPDPEEAAVKAAFVTSARRVVALADSSKL
FT                   DAETLVQFATLKDVDTLITDIEPSAELAAALADAGVDLVIA"
FT   gene            complement(305636..305890)
FT                   /locus_tag="AAur_0297"
FT   CDS_pept        complement(305636..305890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08262"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K5"
FT                   /protein_id="ABM08262.1"
FT                   /translation="MRSYTISSGATGRDSMHAESQRKDPLTTGGKLRSAGKRSLPDPPD
FT                   PDNLPIDYPGSGWDSSRYPATVPGSLRPQHSAHRRSARS"
FT   gene            complement(305905..306357)
FT                   /locus_tag="AAur_0298"
FT   CDS_pept        complement(305905..306357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07088"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K6"
FT                   /protein_id="ABM07088.1"
FT                   /translation="MMPRYRSMPAQPASRVPDEAHQPPDEPLWCSRCNTDQHLLVNSIQ
FT                   SHYPPAPNMVDVAYECHACRYSYEHVASVRRVAAVLNRPGVPQGVLQFGGQYLHCGEPM
FT                   KTKSCELRRIQAPLVLTPGAQLRMYEVLINTRILGCHCGFRMEIPD"
FT   gene            306513..307286
FT                   /locus_tag="AAur_0299"
FT   CDS_pept        306513..307286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0299"
FT                   /product="ANTAR domain protein"
FT                   /note="identified by match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06473"
FT                   /db_xref="GOA:A1R1K7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K7"
FT                   /protein_id="ABM06473.1"
FT                   /translation="MDEINVELALPDAASAPDVVSVPEQLQDLVVDSEDVAGFLDELAK
FT                   FSAAAVSEAVGLDVLCGITLSRRRRTATVAGSTHEARLIDEVQQAYGDGPCLEAMRSHG
FT                   TVHVPDTSTEERWSEYCSVIADRGHLSALCVPLELDEGATAALNFFAPQPNVYDEATIR
FT                   NCELYASQAERSLRLAVRIGVKQQHADDLQDAMQSRTVIDLACGIIMGQNRCTQEEAFQ
FT                   ILKKASSTRNQKLREVAESLVTSVAKQAPVAHFEP"
FT   gene            307989..309143
FT                   /locus_tag="AAur_0300"
FT   CDS_pept        307989..309143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0300"
FT                   /product="putative glutamate-cysteine ligase family
FT                   2(GCS2)"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02050"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09426"
FT                   /db_xref="GOA:A1R1K8"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R1K8"
FT                   /protein_id="ABM09426.1"
FT                   /translation="MGRVAVRTFGVEEELLIADPVDGMPLALASGILDVAGFSETDNSS
FT                   DAGPSLKSEFKQEQIEVNSLPCRTAKELRAEIRAGRALADSAARAVGARVAALATPPVF
FT                   HATPTAGNQRYAAMGTEFGLISREQLTCGFHVHVSIESPEEGVAVLDRMRHWLPVLLAL
FT                   SANSPFWMGADTGFASYRTQIWNRWPTAGPMDVFGSADGYRQVLSELLGTGVPLDEGMI
FT                   YFDARLSRGHPTVEVRIADVCLYAEDALTIAILARALVETSASEWRKGEPPSGVMTPVI
FT                   RMANWKASRFGVTNQLLHPLEQAPFAAADVAGALLRHIRRALTESGDLALARTGVANIL
FT                   RRGTGERLQRQAYGRRFRLSDVVSTAIASTHNYGERSDAGLLSR"
FT   gene            complement(309186..309587)
FT                   /locus_tag="AAur_0301"
FT   CDS_pept        complement(309186..309587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0301"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09931"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1K9"
FT                   /protein_id="ABM09931.1"
FT                   /translation="MNISLKYAHVTVNDVDESLAFYRDALGFDVRNDVGSDGQRWVTIG
FT                   SDAQPDLELVLSPPHAGRSQADGDAIQELLTKGVMPMLVFTTDDLDATFEKLRASGAEV
FT                   LQEPIDQPWGPRDCAFRDPSGNMIRINQG"
FT   gene            complement(309607..310053)
FT                   /locus_tag="AAur_0302"
FT   CDS_pept        complement(309607..310053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0302"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08760"
FT                   /db_xref="GOA:A1R1L0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L0"
FT                   /protein_id="ABM08760.1"
FT                   /translation="MTPQELANLAHLRRARDFIDREYARPLDVPTMAAGALMSPAHFSR
FT                   QFKAAYGESPYNYLMTRRIERAMALLRAGTSVTDACMEVGCTSLGSFSTRFTEIVGINP
FT                   SEYRAREHHAVKAMPNCIAKQHTRPERNGKSPQNLSRIEEAPAS"
FT   gene            310112..310735
FT                   /locus_tag="AAur_0303"
FT   CDS_pept        310112..310735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0303"
FT                   /product="putative phospholipase/carboxylesterase"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06990"
FT                   /db_xref="GOA:A1R1L1"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L1"
FT                   /protein_id="ABM06990.1"
FT                   /translation="MPMESVVWSKPENQRKGTPLLVMMHGYGTSEQRMVDLFPHLPGEF
FT                   SCAALRGPKAIGDHYGWFLLDYFLTNDFADVIASTNSVFSWINSVKDNHSSVSLLGYSQ
FT                   GMAMASTLLRLRPHAFKATVGLSGFVLNNDLLALSESFDSPPPFFWGRDKADPVINEDA
FT                   IAHTEEWLNANVALTARTYPGMGHRIEAPELVDVSAFLKYYVLG"
FT   gene            310923..311942
FT                   /locus_tag="AAur_0304"
FT   CDS_pept        310923..311942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0304"
FT                   /product="putative transcription regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07543"
FT                   /db_xref="GOA:A1R1L2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L2"
FT                   /protein_id="ABM07543.1"
FT                   /translation="MVRTHRVTIQDVAVLSGLSICTVSRALRKLPNVSEKAQRQVAEAA
FT                   SKLGYKASAAASRLAGGSTGLVAIVAPTATAWFFAQAVEAAEEVFGDSGYDTVLISLRN
FT                   KASVRQQFFADLGNLAQRVDGLLLLNIDLAPNEVEALEACGLAVASVGMRNVPWDNVGI
FT                   DDEHAAWQATQHLLGLGHWDLAVLSSNEHSVVTETPRFRGFRRALDEHHLTVHPDLVVG
FT                   AGPSIDDGRRAMTELMTRGGRPTAVFAHCDEAAFGALMALREHGLSVPKNVSVIGIDDH
FT                   PMSWFLGLSTVAQPVADQGAFAANLLCERLLNTESPHQPSNHLLDTKLIERKTTRHKR"
FT   gene            311951..312682
FT                   /pseudo
FT                   /locus_tag="AAur_0305"
FT                   /note="haloacid dehalogenase-like hydrolase; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00702; match to protein family HMM TIGR01509"
FT   gene            312714..315068
FT                   /locus_tag="AAur_0306"
FT   CDS_pept        312714..315068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0306"
FT                   /product="putative trehalose/maltose hydrolase (possible
FT                   phosphorylase)"
FT                   /note="identified by match to protein family HMM PF03632;
FT                   match to protein family HMM PF03633; match to protein
FT                   family HMM PF03636"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06666"
FT                   /db_xref="GOA:A1R1L3"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L3"
FT                   /protein_id="ABM06666.1"
FT                   /translation="MALISSDRLRFPCEPWKLVENIHVPGDEGTLETLFALGNGHLGIR
FT                   GSHSTAGDGELPGTFINGFHEIWDIKHAENAYGFARTGQRIVYVPDANNFTVSIDGEAL
FT                   SLAESTVLDYNRSVDFSTGVYEESITWACRSGATVSTVERRAVGFDSRGCLGLELSLTA
FT                   DRDVSADITSGVVNRQDQPVEDHSVHDPRRSGRHAGRVLLPLHLQGADGSLRLAWETSE
FT                   SRQRVAMAVDHWISAEGQPFETLVAEDESSVRYVLAIHDGDTFRLEKSVSYVVAGSTDA
FT                   EDRGEILAAEAEANLVSFSDILDQSKAHYAEYWTTADISIGGQPEMQQAVRWGLFQLAQ
FT                   ATARAGVAGIPAKGVSGSGYEGHYFWDQEVYLLPYLTYTNPCGARKVLESRHAMLPDAR
FT                   VRAKELSVDGALFPWRTINGLEASAYYAAGTAQFHIAAAIAFAANRYQWASGDDTFRGE
FT                   LGADLLIETARMWASLGFFGKDGMFHIHGVTGPDEYTAVVNDNLYTNVMARFNLRAAAA
FT                   LEHEGVAETERMVWRQAAERMSLPYDPHLQVFSQDNDFMTLEPWDWNTPKSKYPLLLNF
FT                   HPLVIYRHQVLKQADTVLAMFLQWQDFTAEEKQRAFDFYDPITTGDSTLSACVQGIMAA
FT                   EVGYGDVALQHFTEALFIDLDNSHGNTIDGVHIASTGGIWSSLVCGFAGMRDQGEVLRF
FT                   DPRLPVEWEGLSFRLKVQGRLLAVDLAQGSIALTLVPEADYSQEPLRIDVRGYDVTVGA
FT                   ETVAVPLETVPVPPPSIFPSVFPTAGLPIIR"
FT   gene            complement(315134..315487)
FT                   /locus_tag="AAur_0307"
FT   CDS_pept        complement(315134..315487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07075"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L4"
FT                   /protein_id="ABM07075.1"
FT                   /translation="MAPNSLKAEILLAHGVAPSAASVARRRAAENHGHHRVANKPDALL
FT                   GAIAVRQLFHRWPLVPSRELERIRHVLIHCDQLGSPDTHHLSEPAQALLDLINGELDRR
FT                   AVAKTRQETASSN"
FT   gene            complement(315685..317157)
FT                   /pseudo
FT                   /locus_tag="AAur_0308"
FT                   /note="putative drug resistance transporter, EmrB/QacA
FT                   subfamily; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF07690; match to protein family HMM
FT                   TIGR00711"
FT   gene            complement(317246..317701)
FT                   /locus_tag="AAur_0309"
FT   CDS_pept        complement(317246..317701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0309"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08302"
FT                   /db_xref="GOA:A1R1L5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L5"
FT                   /protein_id="ABM08302.1"
FT                   /translation="MGEKPVDHVALAVCMIDISSDIRRKSLNETGLRPISNGVLEILRV
FT                   VESHPGVTVAEVAARLGRQLSNVSVQLRELVAAGLVTRVKDVADKRYVSLHPTDESKRI
FT                   KSLLEGAWADALTKASDRLLPEEREKIAASLPALERLASFLAEPEHH"
FT   gene            317764..318519
FT                   /locus_tag="AAur_0310"
FT   CDS_pept        317764..318519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0310"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08904"
FT                   /db_xref="GOA:A1R1L6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L6"
FT                   /protein_id="ABM08904.1"
FT                   /translation="MINQQQLWDDEAAGQYDTPGEGMFSPEVLGPTVEVLSGLAKGGSA
FT                   VEFAIGTGRVAIPLSEAGIPVSGIELSHAMIARLREKVGEHRIPVVQGDMTGARAGENF
FT                   SLAFLVFNTIANLLTQEEQIRCFENAARHLIPGGRFVIELWVPQLRSLPPGHGGTVEVA
FT                   QPGYLLVDTYDVLRQHVISHHVHFGPELTDGHEARVGRTPHRYIWPSELDLMARLAGFE
FT                   LESRWADWDRSEFTAESRSHVSVYRLIER"
FT   gene            318896..320014
FT                   /locus_tag="AAur_0311"
FT   CDS_pept        318896..320014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0311"
FT                   /product="putative phenylalanyl-tRNA synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06932"
FT                   /db_xref="GOA:A1R1L7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004530"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L7"
FT                   /protein_id="ABM06932.1"
FT                   /translation="MPTYLSPDELHNALKVRDLSNPDHRPHAMQLLLRDVVRALRDKGD
FT                   VTARTIRHSPLVSVADNYDRLGFSPADVTRDQRYSRYISPTVMLRSHTSASIPSLLRGL
FT                   DPEGSIDELWAIPGLVYRRDSIDRTHVGTPHQVDLWRVSSRTALSPRHLQDMVEALVTA
FT                   VLPGADWRAVPAVHPYTHRGLQIDVRMDGEWLELAECGLMSPKLFLDAGLEPGSWSGLA
FT                   LGMGLDRALMLRKGIPDIRLLRSADPRIQQQMMDLKPWEPVSPMPSISRDLSIVVGEDL
FT                   DAELLGDRVRTALGDRAEDLESVELLALTPCGSLPPAAQERLRIREGQSNALIRVVMRP
FT                   LTRTMTDRQANQIRDDVYLPLHEGPVKELIAG"
FT   gene            320133..320468
FT                   /locus_tag="AAur_0312"
FT   CDS_pept        320133..320468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0312"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07853"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L8"
FT                   /protein_id="ABM07853.1"
FT                   /translation="MTRRLAALSAVPLLLLLVGCGAVEEAATNAASDAASKVATAAADE
FT                   VTKQVCAVVQDGLVSVQDKQLLAGLVSAAGAAGVPAEITTPLNQIAEAGDEVPAESVQA
FT                   LKDACTP"
FT   gene            complement(320503..322020)
FT                   /locus_tag="AAur_0313"
FT   CDS_pept        complement(320503..322020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08542"
FT                   /db_xref="GOA:A1R1L9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1L9"
FT                   /protein_id="ABM08542.1"
FT                   /translation="MQPIRATQTPSGDAFDRASEPLPGDSTPPSSGPPSAYSAPRVSDL
FT                   FALLGSVSLGDSSTELIDQLRGLEDLKSAITGLQARIAVAFDLAQRREQETAGVPASER
FT                   GQGVGAQLALARRESPNKGSRLLGLAKALVLEMPRTLAALESGQLNEWRATLLVKETAC
FT                   LSVEDRCAVDEELAPDTGTFEGKGDRAIIASAKAAAYRRDPRSVAQRASHAATERTVSL
FT                   RPAPDTMTYLTALLPVAQGVAAYAALTRAADSARSNGDSRSRGQVMADALVERVTGTPG
FT                   GISGINLDVVMTDRTLFQGDSEPARLKGYGIVPAEWARTLLVELQAVEASGLATGQEGA
FT                   SDPDCDFKVWLRRFYTAPGTGELLSMDSKARLFPTRLRRFIEARDDTCRTPYCDAPIRH
FT                   IDHVVTWHSGGTTTLTNGAGLCEACNHTKENLGWTAKPLNDDVHTFELRTPTGHSYKSK
FT                   APPLPGCHTAQGRERGDHLSQTTVAAAAATPANWGSPQQESRDLTRI"
FT   gene            complement(322230..323063)
FT                   /locus_tag="AAur_0314"
FT   CDS_pept        complement(322230..323063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0314"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06934"
FT                   /db_xref="GOA:A1R1M0"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M0"
FT                   /protein_id="ABM06934.1"
FT                   /translation="MHDIAPPTRKEAHNMATRSSDLRRQIAVTVSLVVCIVGSMIGVGV
FT                   FGGTPIAQAAGGALAADSTLLAPATPAFSIWSVVYTGLAAFTVWQWLPSQRANPRQRSL
FT                   GWIVAGSMLLNAAWVLSVQAGWLLVSVVVILALLVTLVVAFLRYSHSRAGSWVEAVVVD
FT                   GTLGLYLGWTSVAVCANIAAALKASGFGGFGLRPEIWSVAVLVVVAIVGIALAIKGHGR
FT                   LALAAAIAWGLAWITVGRSTDAPESFPTAIAAAVAAALVLGAAITVRARAVLAER"
FT   gene            323091..323663
FT                   /locus_tag="AAur_0316"
FT   CDS_pept        323091..323663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0316"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07666"
FT                   /db_xref="GOA:A1R1M1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M1"
FT                   /protein_id="ABM07666.1"
FT                   /translation="MLVNQALRLSKEQRMDAEGHAKGYWYGKDPGQKAIAIDVLNALRD
FT                   YRASEQAMRRRTRSSMGMGEKDLLALRYLFEAEAAGKVMKPKDLGDKLGITSASMTTLI
FT                   DRLVESGHIRREPHPTDRRALILKATPGSDQEVRHTLGGMHRRMLDAACALSPDESQVV
FT                   VNFLQHMREALDTIDEDPEDPEKSTAS"
FT   gene            complement(323658..324575)
FT                   /locus_tag="AAur_0315"
FT   CDS_pept        complement(323658..324575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0315"
FT                   /product="putative lycopene elongase"
FT                   /note="identified by match to protein family HMM PF01040"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10108"
FT                   /db_xref="GOA:A1R1M2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M2"
FT                   /protein_id="ABM10108.1"
FT                   /translation="MWLTRKRSGESNRAGNLKGLVPQALLASRPVSWINTAYPFAAAML
FT                   LTTREIDWVLIVGTFYFLIPYNLAMYGINDVFDYESDLKNPRKGGIEGALLQPRLHRPM
FT                   LWLAAITNIPFLLVLAFAGGPAAWISLAVSAFAVVAYSVAGLRFKERPVLDSLTSSTHF
FT                   VSPAVVGLALAGADVTPGLVILLAAFFLWGMAAHAFGAVQDIEPDRQAGIGSIATVIGA
FT                   RRTVRLAVGLWLVAGLAMLATPWPGPLAAIIAIPYIVNCAPYWKVMDTTAARTNVAWRR
FT                   FIWLNYGSGFLVTLIFILQWSLTS"
FT   gene            complement(324860..325210)
FT                   /pseudo
FT                   /locus_tag="AAur_0317"
FT                   /note="putative C50 carotenoid epsilon cyclase; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            complement(325210..326862)
FT                   /locus_tag="AAur_0318"
FT   CDS_pept        complement(325210..326862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0318"
FT                   /product="putative phytoene desaturase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593; match to protein
FT                   family HMM TIGR02734"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07316"
FT                   /db_xref="GOA:A1R1M3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M3"
FT                   /protein_id="ABM07316.1"
FT                   /translation="MTRTVVIGGGIAGLATAALLAHEGHEVQLLEQRDHVGGRAGSLER
FT                   DGFRWDTGPSWYLMPGVFDHFFNLLGTSTAEQLDLRTLSPAYRIFSEPNHDGVRPDPLT
FT                   IPLGSDQVLETFESVEPGSSKELASYLVSARHTTEMAERFFLYNPFTKMQALLQPEVVR
FT                   SLPKLAQLLLTPLDKYVSQRFQHPVLRQVLGYPAVFLGTSPSAAPAMYHLMSALDLGDG
FT                   VQYPMGGFRALVERLEALAVDAGVRIHIGAEALKITTREATHPKKLGRFDGLNLPSGLT
FT                   GKDSREVTGVKWRDSSGAEHYSVADLVVSGADLHHTETQLLGVRDRSYNKKYWQSRTSG
FT                   PGAVLVMLGVKGSLPDLPHHSLFFTRDWEANFASIFGDDPSIPDPASIYVCKPSATDAG
FT                   VAPQDHENLFVLVPIPADPSLGGGGADGSGDVMIERTADAAIDQISQWANIPDLRERVV
FT                   ARHTIGPADFARDYNSWRGGMLGPAHTLRQSAMFRAQNASKRVRGLYYAGATTAPGVGV
FT                   PMCLISAELVLKRIRGDHSTGPITVRPVASRIG"
FT   gene            complement(326859..327764)
FT                   /gene="crtB"
FT                   /locus_tag="AAur_0319"
FT   CDS_pept        complement(326859..327764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtB"
FT                   /locus_tag="AAur_0319"
FT                   /product="phytoene synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF00494"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08680"
FT                   /db_xref="GOA:A1R1M4"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M4"
FT                   /protein_id="ABM08680.1"
FT                   /translation="MSVAADTSFTHFTRTAERAANQVISAYSTSFGLACRLLGSRHRQH
FT                   VRNIYALVRVADELVDGVTAEAGLSYQEQCDALTHFIAETHRAVKLGYSSDLIIHAFAQ
FT                   TARTAGIDDSLIDPFFDSMRMDLGERSEAPAAPLRFDSDAHDGYVHGSAEVVGLMCLRV
FT                   FMRDENIDDGDAAALEYGASRLGAAFQNINFLRDLADDTTRLGRSYLGTSDHLEDRDRM
FT                   EWVSTIRAQLADANAVIPMLPRDARAAVRSALALFQALTDRIEQTTVDELYRHRVRVPD
FT                   AVKAGLAARAVASTWMELHR"
FT   gene            complement(327761..328870)
FT                   /locus_tag="AAur_0320"
FT   CDS_pept        complement(327761..328870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0320"
FT                   /product="putative geranylgeranyl pyrophosphate synthase"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08084"
FT                   /db_xref="GOA:A1R1M5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M5"
FT                   /protein_id="ABM08084.1"
FT                   /translation="MTITSNAVRGRTDLCTAIENELSGLIDKRASAATAYGADFARLWA
FT                   LAGQNVLGGKFVRPLLLMETYDALHKHGPAEPHQRETAISIAAAIELLHYAFLLHDDVI
FT                   DGDLVRRGHPNLIGSLLAEAGETARTDGADGARAGSGLHWAQTGGILMGDMLLAATHQA
FT                   FARAELPHELRLRLLDLLEHTINETVAGEQLDVGLGDGIIAPDLQTILMMCGYKTATYT
FT                   FELPLRAAATLAGADFAVENALATAGRHLGLAFQLQDDLLSTFGDPRRHGKDPFSDLRE
FT                   GKETAIIAHARTTTVWPDIEPFFGRPELSVGDGEHVRRHLSDCGAEVFVQGLIEEQLQA
FT                   FNNQLTSTIPASVRNVLLDLAGQLEGRQS"
FT   gene            complement(328867..329421)
FT                   /gene="idi"
FT                   /locus_tag="AAur_0321"
FT   CDS_pept        complement(328867..329421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idi"
FT                   /locus_tag="AAur_0321"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 1"
FT                   /EC_number="5.3.3.2"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR02150"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06566"
FT                   /db_xref="GOA:A1R1M6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R1M6"
FT                   /protein_id="ABM06566.1"
FT                   /translation="MNATEMVVLLDDAGTPIGEAPKAGVHTLDTPLHLAFSCYLINDVG
FT                   EVLLTRRSPEKKTWPGVWTNSFCGHPGPGEEFEDAILRRAQFELGVDANKIELVLPHFR
FT                   YRAIDPTGIVENEVCPVYVARITGVLNPNPAEVADWAWISPALLADALEHTPSAFSPWL
FT                   GLQFPQLLEANALPLQAGAEA"
FT   gene            329524..330111
FT                   /locus_tag="AAur_0322"
FT   CDS_pept        329524..330111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0322"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06384"
FT                   /db_xref="GOA:A1R1M7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M7"
FT                   /protein_id="ABM06384.1"
FT                   /translation="MSSPEEIPEEAGTPVSAGIYHLDANDPHQELVDRSGLSEADVQQV
FT                   SDLMASLARLREAEQRLSDASLRYMKLNQSDMRALHYLIVCANHGVIATPGAIASRLHI
FT                   STASTTKLLDRLERAGHVTRRAHPSDRRALAIAITPETHEAAMRTVGRQQAKRFLAAAR
FT                   LTPEERETVMRFLDDMAQEIEVADEAWAGSGA"
FT   gene            complement(330120..330800)
FT                   /locus_tag="AAur_0323"
FT   CDS_pept        complement(330120..330800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0323"
FT                   /product="putative CAAX amino terminal protease family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08464"
FT                   /db_xref="GOA:A1R1M8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M8"
FT                   /protein_id="ABM08464.1"
FT                   /translation="MATAAFIDHRLMRHLALIAAGMTIFSLVPLNADLSTEHMALMGGA
FT                   LALAVLVPWVVSRFAYREDIIKFPVNTGRKWPLAAKLYLIGVVALGYFILPVYLIRTGV
FT                   YQNWPDASDPDIFWRLFLGVNAVGIWDELFFICTTFTLLRQHFPDWLANLLQAVVFSSF
FT                   LWEIGYQSWGPLLTFPFALLQGYTFKLTKSFTYVVSVHLLFDFVLFLALVHAHNRDWLP
FT                   IFLY"
FT   gene            331113..332231
FT                   /locus_tag="AAur_0324"
FT   CDS_pept        331113..332231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0324"
FT                   /product="putative EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09647"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1M9"
FT                   /protein_id="ABM09647.1"
FT                   /translation="MAQDAGSFKPESGSSPKDDAAAADDAVKAPASEDMTMREQVLDIV
FT                   ESILADSDARSEGARNNLRALVEARPGNPERALLEHLLETRKTPASAAKVPVQREVASL
FT                   HLESSDTARTVSVPVSHEVREGIQSILADKLLLTAFQPVHALPGGEVVGVEALTRFVGE
FT                   DGAGADVWFNEAAAAGLGTELEIAALHCALTAAHDVPDNMSVALNLTPATSSDPRVRNL
FT                   LAAAALAPDRIIVELTGSLESVEGQTGDHGLGPLRTLGLRLAISASGAALVSMERIEQL
FT                   RPDIIKLDRHLIEGIESSDGQKIRARAIVELAREIGADIIAEGIETAAELDEVTALKVT
FT                   AAQGYLLGRPSVHPLDWSAWSIRAQTEAQPAG"
FT   gene            332347..333651
FT                   /locus_tag="AAur_0325"
FT   CDS_pept        332347..333651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0325"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08095"
FT                   /db_xref="GOA:A1R1N0"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N0"
FT                   /protein_id="ABM08095.1"
FT                   /translation="MDSFFSMLAEIRGKTIPTRLAARMNSPRGLLGGFVVIHLVFLVFA
FT                   AVLSLRGEAFSDTFIYRDWALAGFNDANLTGGPSPWVYPILALIPMGLAAIAGPGPFFF
FT                   LWVLLTTLLNGWAVLKLTDRGRRQEAIPAAWWWLVFVFLMGWLGFARVDGLTAPIVLVA
FT                   LVYGVTRPFVASVLLSVATWVKVWPAAVMLALFAVVRKRLHVVAAGIATTAVVVGLAAA
FT                   VSAVPKLLNFLTQQGDRGMQLEATFTTPWLWLSVLGVGDSRMYMNTDINSMQVDGPGTA
FT                   LMSVLMQPLLLLAAAAVAGLTFWALHQGKLNGGVDRTELLLSGALTLVTAFIVFNKVGS
FT                   PQFMVWLAPAVAVGLAHNWKEWRVPATMLIVIAVATYFIYPLFYDALSHNNPWMALVLT
FT                   IRNVLLVVLFFWSARRLYSLGRKPSVVTAPAAKEH"
FT   gene            333560..334948
FT                   /locus_tag="AAur_0327"
FT   CDS_pept        333560..334948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0327"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08759"
FT                   /db_xref="GOA:A1R1N1"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N1"
FT                   /protein_id="ABM08759.1"
FT                   /translation="MWFSSSGRRVACIHWAASHPWSPPQLPRSTKISATFFDQLVRLRS
FT                   RVLPPAVIAWFARPGSVWWGFAVVHFYFLCWMASFFLSGNTFSDTEQYRQWAMDGYNPE
FT                   NLSGKISPWVYPVLAQIPIFLAGIAGPDLYLLMWTLLITALNALGLWYLTRGPRRVSGI
FT                   APAWWWLFFTVFMGYLSFARVEGITTSIVLIALICAAQRPVVASVLLSIATWIKVWPAA
FT                   VLVPIIIASRNRLQMIAAGVGVTAVVGFGTYLAGGFSHILDFLINQGERGMQLEATFST
FT                   PWVWLSVFNVAGSKMADNTAINSTEVYGPGAEVAAFLMQPLLIVAAIAAAILLIRALKR
FT                   GAEREELFLEGALMMTTAFIVFNKVGSPQFIIWLAPVIIAGLTHDWNRWKVPAALLMAI
FT                   AMTTFVIYPLFYTPLIHAHPVMAAVLTTRNVLLVVLLWWSVQRTVELGRRVNRDGAPVV
FT                   PKAL"
FT   gene            complement(334945..336552)
FT                   /locus_tag="AAur_0326"
FT   CDS_pept        complement(334945..336552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0326"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06724"
FT                   /db_xref="GOA:A1R1N2"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N2"
FT                   /protein_id="ABM06724.1"
FT                   /translation="MTAGSTPRPLPGTAAATNQPSSTATKAPQPAAPATKPVAYPAILQ
FT                   GFLGSLFMFAGSIGIGWIANGSPMIRHPIVIALRTEGWGVTVSAVLLTVGAMLLVRSWL
FT                   RLGQRMGSWEGNSLKTIVAAIGAWSLPLLFAVPVYSRDVYAYIGQGRLMMEGQDPYDVG
FT                   ISALNNWFALGADPAWAEARTPYGPYFLWMAHAVVAVTGAQPDVSVLLFRLLAAGGVLL
FT                   CVVYVPKLAELHGINGARALWIAVANPLFLISFVASAHNDAIMVGFAVAGTYFAATKRP
FT                   LLGILLVTLSIGIKPATVLLLPFIGLMWAGAGASWPRKFGIWAATASISFAILVVSGIP
FT                   YGLGLGWAWAITDPTPGFTGYSPSGFLGQQIEFLGNALGLPGNAMADVLRAAMKWGAVA
FT                   LVLVLMFRGDHSRVVRRMALAFAAIVLLSPIIQPWYILWFVPFLAVTGIRDDWQMRCLY
FT                   VGVTFFVVFGAQDQLSVWSFVEVSVDLSSLAFAIALLFAFYLVFLDIHTRRLLVQGKLS
FT                   RWVGQTDRRLLHRPPTIR"
FT   gene            complement(336739..337611)
FT                   /locus_tag="AAur_0328"
FT   CDS_pept        complement(336739..337611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0328"
FT                   /product="GDSL-like Lipase/Acylhydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07729"
FT                   /db_xref="GOA:A1R1N3"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N3"
FT                   /protein_id="ABM07729.1"
FT                   /translation="MAQGGSGSFGAGLHPWSRYVALGDSFTEGLGDPEPRSPGGLRGWA
FT                   DRVAEELSTGHQDFAYANLAISGRLLHQILEEQLGPAIELQPDLITLNAGGNDLLFHRS
FT                   DPDKLALELDAGVESLARTGATIVLFTGPDWGATPVLGLARGKVAIYNENIRVIAARHD
FT                   ALIADLWALRQLTDPRMWDADRLHFSPLGQHTIAIMVLDTLNVPHSLEPLTPKALPERN
FT                   WREARAGDMVWAREHLFPWVVRRLTQRNAGDGRHPKRPEPGPVFGAAMPPGSFVGSDPR
FT                   NLTAKDDSL"
FT   gene            complement(337683..338420)
FT                   /locus_tag="AAur_0329"
FT   CDS_pept        complement(337683..338420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09880"
FT                   /db_xref="GOA:A1R1N4"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N4"
FT                   /protein_id="ABM09880.1"
FT                   /translation="MVARHDLATDPGLQEDLLQARRGTAFFARKLNELTDAQLDGGTRL
FT                   PNWTRRHVVAHVGYNARAIARLVEWAATGVETPMYSSTEARNQEIDFGATLSPIALRNL
FT                   FDHSAVHLSVEWRDLPDANWSNEVRTAQGRTVPASETVWMRTREVWVHAVDLDNGATFN
FT                   HIPAPVLERLLRDITGAWKTRGTDTGLLIKVTDTTLTFGDTSAADPTIISGPLPAVVEW
FT                   ATGRGTTGVTAGHGAVPDAPQWI"
FT   gene            complement(338420..339256)
FT                   /locus_tag="AAur_0330"
FT   CDS_pept        complement(338420..339256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0330"
FT                   /product="putative 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09577"
FT                   /db_xref="GOA:A1R1N5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N5"
FT                   /protein_id="ABM09577.1"
FT                   /translation="MRLLTLRTETAAGKGTVAVRQDGATLTEIPGFADVGALLADPAWE
FT                   QKAKAANGATHALDGADLAAVVPAPGKIICVGHNYRNHIKEMGRDIPEYPTLFAKYQES
FT                   LIGPNDDLALPQESDTVDWEAELAVIIGKKGRRIAEADAAEHIAGYAVLNDISMRDYQF
FT                   RTIQWLQGKTWENSTPFGPALVTKDEFTAGPLMTSAVDGEVQQSTPTGDLVFTPEFLVS
FT                   YISTIITLNPGDVIATGTPGGVGHAQDPKRYLQEGQLLVTTIEGLGQLNNRVVKEA"
FT   gene            complement(339253..340395)
FT                   /gene="gtdA"
FT                   /locus_tag="AAur_0331"
FT   CDS_pept        complement(339253..340395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtdA"
FT                   /locus_tag="AAur_0331"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.4"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10158"
FT                   /db_xref="GOA:A1R1N6"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N6"
FT                   /protein_id="ABM10158.1"
FT                   /translation="MSISAENTTHESVAASHTLPEPTPEEQANLEQLYKDFEAEHLIPL
FT                   WTEIGDLMPMVPTPKAVPHVWRWNDLYPLAARAGDLVPVGRGGERRAIALANPGLAGAP
FT                   YATPTLWAAIQYLGPREVAPEHRHSQNAFRFVVEGEGVWTVVNGDPVAMRRGDFLLTPG
FT                   WNFHGHHNDTDQPMAWIDGLDIPFVHYADAGFFEFGTERVTDEATPDISRSERLWAHPG
FT                   LRPLSGLEDTTNSPIAAYRWEHTDAALREQLLLEDEGHPATVSQGHAAVRYSNPTTGGD
FT                   VMPTIRAEFHRLRAGATTEPLREVGSSVWQVFEGTGTVVLNGETKQLAKGDLFVVPSWQ
FT                   EWSLHADNDQPGFDLFRFSDAPIFERLNFNRSYTEGRKNA"
FT   gene            complement(340490..341314)
FT                   /locus_tag="AAur_0332"
FT   CDS_pept        complement(340490..341314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0332"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06398"
FT                   /db_xref="GOA:A1R1N7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N7"
FT                   /protein_id="ABM06398.1"
FT                   /translation="MQNKRGAQSGRKPVQKRPTYSIEAVDNALQLLQLLRDGGALRLKD
FT                   AAAELGVAPSTAHRLLAMLVYRGFAVQDENRRYVPGPAMGVGPAGLSWTRQLRDLALPH
FT                   MELLSARLDETVNLMVRVGTKVRFLATVEGSNVLRIGDRQGTVMPADRTSGGKVMLAEL
FT                   EPAMIEQLFRSHNAEIGGDTIPDGEYAAFLRELDSIRSNGFAANFEGTEEGVSALGMAL
FT                   RNRHGQVVGALSVATPATRFRKVFDAGLVTALRQTCRQLEIDIAANPAEPKQ"
FT   gene            341333..342631
FT                   /locus_tag="AAur_0333"
FT   CDS_pept        341333..342631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0333"
FT                   /product="putative benzoate MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06524"
FT                   /db_xref="GOA:A1R1N8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N8"
FT                   /protein_id="ABM06524.1"
FT                   /translation="MADRRPDSGGMNHTLPAAASQRPTAGTIGPRFSKGSALAVLVCWL
FT                   LVVFDGYDLIVYGTVQSSLISETGWGLTKATAGTVGSMAFLGMMIGAIFAGRMADSWGR
FT                   RKTILGCAIAFSVFTVLCAFAPNATVFGALRLLAGIGLGGLVPSANALVAELVPAKWRS
FT                   TIATLMMSGVPIGGSIAALVGIPMIPAFGWQSMFLVAVLALVIVVPLGLKYLPETLART
FT                   GTAGKEPAGFRSLLRAPYLGASMLFAFATIATLFAWYGLGTWLPNLMQLAGYNLGSALT
FT                   FALALNLGAVAGSVITAWAGTRFGPIPTAIAAAAVAAVGLSVLVAGPPVTVVYLALVLA
FT                   GVGTHGTQCLIIAAVASHYPDHLRGTALGWALGTGRIGAVIAPQVGGLLLAAGLGVNSN
FT                   FLAFAGAAAIAAVLLAAVGLKIKSKISQGASNV"
FT   gene            342624..343874
FT                   /locus_tag="AAur_0334"
FT   CDS_pept        342624..343874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0334"
FT                   /product="putative aromatic-ring hydroxylase
FT                   (monooxygenase)"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494; match to protein
FT                   family HMM PF03486"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08180"
FT                   /db_xref="GOA:A1R1N9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1N9"
FT                   /protein_id="ABM08180.1"
FT                   /translation="MSEYATSTDVLVVGGGMAGLAGALALRENGANVTLVERAPEFGEV
FT                   GAGLQMAPNASRVLKRWGLLEKALEIGVQPKHLVFRDAITGEELTRQSLRGEFEERYGA
FT                   PYVVIHRSDLHRVLLEGCEAAGVKLVNDVMVESVETVNGRGIVRTAAGVDYEADVVIGA
FT                   DGLKSTLRPLVATDEPVSSAYVAYRGTVPITSETPATDLEDVVVYLGPDCHLVQYPLRK
FT                   GELLNTVAVFKSPSFERGEEQYGGVDELQAAYKDCVPAVQAALANLGTSIRWPMYDRDP
FT                   IENWVAGRMVLMGDAAHPMLQYLAQGACQALEDAAVLQDVSAGTVFTADGVNPAAWDEA
FT                   LTAFNSARAARTARVQRTARVWGESWHVSGLARTLRNLLFKSRNDNNFQYNDWLYGSAG
FT                   EGLPTPDAPKVASAASA"
FT   gene            complement(343906..344850)
FT                   /locus_tag="AAur_0335"
FT   CDS_pept        complement(343906..344850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0335"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08251"
FT                   /db_xref="GOA:A1R1P0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P0"
FT                   /protein_id="ABM08251.1"
FT                   /translation="MKAINETNLRKIDLNLLVVFHVLMQERHVTRAAAKLHITQGAVSA
FT                   ALGRLRLLFDDPLFQKSRTGMVPTAKALALAPRIGQSLKTVSDLVFQDEQFEPTTSNRT
FT                   FHIAMSDDLEAVFVPKIVTEAIRSNWNVKFSFHQTNSVLWQEALDDPRMDLVMCATPPQ
FT                   VPAAYHHSVLFASSYTCLYDGQRMKLSEPLSLEDYAGSGHLRVSYDAQRGFVDEILESQ
FT                   GYERKAVASISHFAGAVAVLRAADLIATIPTYTAKAFSDAAGLTMSQPPVPMPRFTISL
FT                   IWEVPKETQPEHVWLRKMMQACANPDGWPSVFG"
FT   gene            344929..346257
FT                   /locus_tag="AAur_0336"
FT   CDS_pept        344929..346257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0336"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08558"
FT                   /db_xref="GOA:A1R1P1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P1"
FT                   /protein_id="ABM08558.1"
FT                   /translation="MNRAAALKEPKASPTVPQLAGTDIRKRQVAVGIGNFMEWFDFAIY
FT                   GYFVAVIGAQFFPAGDPAPEVLASLAVFAVGFIARPLGAVVLGPIGDRHGRKLVLVITV
FT                   LGMGLTTALIGVIPSYASIGVAAPILVVILRCIQGMMVGGEWSTAATYLGESAPANKRG
FT                   LHASLVTATAGLAFLVGTVVAAVINGVLTPQEVSAWGWRVPFIASLVMAVVAIFIRQKL
FT                   GETPVYEEMARRREESKPAPLPLAVKMRAFVLTLAFSALFGVSLYYFITYANNHLSGVV
FT                   GMPRVEALTACGIALAVYVVANPLLGRLSDRIGRRPLVLLSALGLTILSVPIFFALNSG
FT                   IFAVVLLGLIVLGVLVAMAAVMNVVLLVEVFPASIRSTGSALGYNVALAVLAGPGPLVA
FT                   ASLIKATGNNVAPAFYLAGVSLAALIVLWMMLPETKNKDISEG"
FT   gene            346299..347228
FT                   /locus_tag="AAur_0337"
FT   CDS_pept        346299..347228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0337"
FT                   /product="putative nitrilase"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08899"
FT                   /db_xref="GOA:A1R1P2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P2"
FT                   /protein_id="ABM08899.1"
FT                   /translation="MTKVAVVQAASVPFDAQAAVDKAVDLIRECAESGAELAVFPEAFI
FT                   GGYPKGSTFGSTIGNRSAAGRKLFEKYYSAAITLDGNEVTQLVTASRESNVFVVVGVIE
FT                   RLGNTLYCTALMISPDGGLVGKHRKLMPTSVERLVWGFGDGSTLDVVDSPAGRVGTVIC
FT                   WENYMPLLRQAMYAQGVEIYCAPTADDRPSWQHSMVHIAIEGRVFVLSACQTITKDAYP
FT                   ADYEFEFEIGNNVMHGGSMIVDPLGNVLAGPVFDEETILYADVELSKKRESHLDMDITG
FT                   NYARPDVFSLSVDTKAKNSVEFNGAATV"
FT   gene            complement(347271..347741)
FT                   /locus_tag="AAur_0338"
FT   CDS_pept        complement(347271..347741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0338"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09463"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P3"
FT                   /protein_id="ABM09463.1"
FT                   /translation="MQGERKDGLTRRPVLKRPGGKPASNNVCPHDPTCRAVVRLPMCPE
FT                   IVGQRSGWRTIRELDTTVPHVPAITVDHFHPHDESSVAGKLSAVLELQKAVPIGPEESG
FT                   PDQPGHMKANLLIGMSTHADSSYIGSQPAVLGGRIVRNGFQCALSGALGRKG"
FT   gene            complement(347805..348611)
FT                   /locus_tag="AAur_0339"
FT   CDS_pept        complement(347805..348611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0339"
FT                   /product="putative transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10004"
FT                   /db_xref="GOA:A1R1P4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P4"
FT                   /protein_id="ABM10004.1"
FT                   /translation="MTPATQQANGRPDPRAPYADQRREFILAALRANGRADAADMALEL
FT                   GVTNETVRKDLVALEQLGLLRRVHGGAIPVGRLSYEPPVTARTTLSEEKELIARAALQH
FT                   LPDNGSVLVDGGSTTAKLAEILPRDRALRIYTNTLSIATALMDAPLLTVYTLGGRVRPV
FT                   TSAEVDGWAARALAEINVDVAFLGTTAVSLERGLTTHDPSEAAIKRLMLSSARRRILLA
FT                   DHSKFGKVSNCKHADLADIDLLITDAGINPEMLESLRSTGLGIEAV"
FT   gene            complement(348801..349853)
FT                   /locus_tag="AAur_0340"
FT   CDS_pept        complement(348801..349853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0340"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06710"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P5"
FT                   /protein_id="ABM06710.1"
FT                   /translation="MAVRPQPPHLIRPTAHTRPCRQRPGTYQVTPIRRNENMQKRTLGR
FT                   TGLSVSPVCVGTSALGSHPTQYGYEVSHATAVQTIRRVLEGPFNFIDTSNEYGHGGDSE
FT                   RRIGEALAEVGGLPANIVLATKVDPIVGTTDFSGDRVRKSVEESLERLGLDKLQLVYFH
FT                   DPEKITFEEGTAPGGPLEALIDLKNQGVIDHLGVAGGPIDLELKYLATDAFDVVISHNR
FT                   YTLVDQTAEPLIQDAAARGVAFVNAAPFGGGMLVKGPDAVPNYCYSPASPAIVERVRKM
FT                   EQLCKAHDVPLAAAALQFSTRDPRVASTIVGMSDPRRVAQTADLAEWDIPAGLWDELIP
FT                   LAQAGSGELG"
FT   gene            complement(349766..350776)
FT                   /locus_tag="AAur_0341"
FT   CDS_pept        complement(349766..350776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06894"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P6"
FT                   /protein_id="ABM06894.1"
FT                   /translation="MEKQWGIPTFRTLQEAVRSLNPDLAVTCVPREANPEVVRALVGLN
FT                   IPVLSETPPAADLPALLGLWRDVGSSVLVQVAEQHPYLPFFCAVRRLLDSGKFGEVSSA
FT                   SMSWTHDYHAMAILRSVLAMGHDSVKILATSQQSPLMNGPDRQGKPERKRVEEVRSTLA
FT                   LLSSGSATGFYDFTETQWFNPLRGRHFQLRGSHAELTGDRLTCLNDDGDPVSARIERRQ
FT                   LGIDGNLEGADLDTLSAAGEVLYVNPFRGARLSDEEIAMATCLNNTRPENREHGYSLAD
FT                   ACQDHYLSLLIHEAAGSGGSITSEPQPWQSVPSLHTSSGQRLTPARAVSGLEPTK"
FT   gene            complement(350923..352113)
FT                   /gene="adhT"
FT                   /locus_tag="AAur_0342"
FT   CDS_pept        complement(350923..352113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhT"
FT                   /locus_tag="AAur_0342"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07582"
FT                   /db_xref="GOA:A1R1P7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P7"
FT                   /protein_id="ABM07582.1"
FT                   /translation="MACPRGEAPWHEHRKAHGTRTPHSAVEQLTPCRETPADVRPGPDV
FT                   RNPHQTLQNPKGRRMYAAVLRAPGPIENHPLVYGEVPEPEPGPGEVSISVLACGVCRSN
FT                   LHMVEGDWLPGTPAALPIIPGHEVVGRVKAVGPGVDNFAVGDRIGVQPIWSTCGRCGHC
FT                   IGGYEQRCRQRQITGETRDGGYAEVMLANAAFACKIPDSLSDTEAAPLFCPGITAYGAV
FT                   KKAQPRPGQNVAVFGVGGVGHLALQMAGLTGAHVNAVSRSASARALAEQLGAHGAYVPA
FT                   GSDGGRELRDGSQDAAIVFAPSDLAVAEALRVIKPGGVVVLGVAQSLGVMDIGDEKTVV
FT                   GTVLGTRQDMADVLTLAVDGKLHAVHEDFPLSEANLVLQRLKKGQLHGRAVLVPGA"
FT   gene            complement(352026..353114)
FT                   /locus_tag="AAur_0343"
FT   CDS_pept        complement(352026..353114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0343"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06976"
FT                   /db_xref="GOA:A1R1P8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P8"
FT                   /protein_id="ABM06976.1"
FT                   /translation="MVDPYAIVALSNTVHTIKKREDAIENTKRICDFMDPAVMVAATDG
FT                   APVKLVVLPEMAIQGMLPDFKAGNRDAHEAFAMTIPGPETEILGQKARQLNTYIAAELY
FT                   LVRDDDFPGHLFNVAFIIDPNGDVIYKRYKSTSDAYEGGALGTTNPHDIWDEFIQKRGN
FT                   GSLLDAFFPVAKTEIGNIGYIICHEGAYPETSRGLAMNGAELIIRGTLIEPQVGMGMWE
FT                   LQNRAHAMFNQAVVIAPNLGPQRNDDGSMFDLFGGQSMIVDHKGRVLVKNEGVSAGDSF
FT                   VSTVVDLEALRRSRAANGVTNWFKDLRTEMYAGIYEQPIYEKNQYINELPAEGWLAREA
FT                   KRRGMNIGKLMERGLLTAPSSN"
FT   gene            complement(353196..354893)
FT                   /pseudo
FT                   /locus_tag="AAur_0344"
FT                   /note="putative gluconate dehydrogenase; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF00732"
FT   gene            complement(354886..355482)
FT                   /locus_tag="AAur_0345"
FT   CDS_pept        complement(354886..355482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07239"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1P9"
FT                   /protein_id="ABM07239.1"
FT                   /translation="MSASNEATMTRWLFLTEAEAETVDAVCERIFPSGDGKPGARETKV
FT                   ITYIDRTTADEDEALRRCYRDGVEALNALTSELYGQRFAALSDERKDEVLERIESSPAP
FT                   ESNAAPEPDAAPERPEEEGLLATFFALVWEHTIQGMFCDPQYGGNHDALGWQLVGFPGA
FT                   QWGYDAEQMQPGFDSKTIPIKTLEDLRRELRRKDA"
FT   gene            complement(355469..356614)
FT                   /locus_tag="AAur_0346"
FT   CDS_pept        complement(355469..356614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0346"
FT                   /product="putative D-ribose ABC transporter permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06704"
FT                   /db_xref="GOA:A1R1Q0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q0"
FT                   /protein_id="ABM06704.1"
FT                   /translation="MATNTTQIPPARRHTPSLPSALTSLRTFVASLGSKGYLLAVGAIV
FT                   LLVGSALSQHFMTSRNLISVLITASVVSVLAVGQYLVIVTGGIDLSVGAVAAVSSVIAG
FT                   LALQQGTPWPVALLLALLAAGLIGVFNGLMIVYGGITPFIVTLAMMSIARGVAYMLQTG
FT                   RQVAIEDQGFLAAFTSGVGPMPAPVMIALLVTIVFAVVMSQTRFGRRLFALGGNPEAAR
FT                   LSGLPIKRDIIGAYFLSSLLAGLGGVMIAAQLTEGSAIIGEGYELNAIAAVVVGGASLF
FT                   GGTGDPVSAVLGGLIIAVILNIMDLLGIQAQPQLVVKGAVILLAVLFTSGVGNKLPGAL
FT                   RKLIFQNRYTGKSATEGTPGGAVPAMDAASTKNKEETDVRQ"
FT   gene            complement(356649..358193)
FT                   /locus_tag="AAur_0347"
FT   CDS_pept        complement(356649..358193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0347"
FT                   /product="D-ribose transport system ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08192"
FT                   /db_xref="GOA:A1R1Q1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q1"
FT                   /protein_id="ABM08192.1"
FT                   /translation="MTAPVGLALRPLIAVSGVSKAYPGTQALANINLEVMPGEIHGIAG
FT                   QNGAGKSTLVRILSGVERPDSGTILIDGEAVTLDNPQAAHRARIMTVHQELSLVPHLSV
FT                   AENIYVGELPRTAGGTIHWSRVRSQAREQLLRLGFDIDVRATVASLPIAHRQAVEIAKA
FT                   LTRDARVLILDEPTATLPRHDLNQLFDLLQQLKKLGLAIIYISHHFDEMYAICDRISVF
FT                   RDGQRVGLHDGDEKQHDAILQSMLGGVSPERSAKLQVGPGDMPRLGTGRTDGEVALSVR
FT                   GLRDGHDLHGVDLDLHKGEVLGIAGLSGNGQSQLASALFGAEKSQHEAFLVNGRERRRQ
FT                   DPAHSIALGIGLLPEERKTQGLILTMSITRNITLASLPRFSPGYFLSKAKEQKAAIGMR
FT                   DALAIKTAHVSEAVGNLSGGNQQKVALAKWLVSGVSTLIIVEPTRGVDVGAKLEIYELI
FT                   RTFADQGGSVILITSEIDEALMCDRVLILSRGQTAGSVSRSEIEQRGEAAILDRFN"
FT   gene            complement(358206..359279)
FT                   /gene="rbsB"
FT                   /locus_tag="AAur_0348"
FT   CDS_pept        complement(358206..359279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="AAur_0348"
FT                   /product="D-ribose-binding protein precursor"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08554"
FT                   /db_xref="GOA:A1R1Q2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q2"
FT                   /protein_id="ABM08554.1"
FT                   /translation="MVTKRTTRLAFISSLSAATLLALTACGGSAPASTSSEEKGLIGIS
FT                   MRFIAGNAWLSTMSDGAVKSGTSKGWTMEAVDAQGSAQTQIQQMRTFINKGAKAIIIEP
FT                   VGDRNVASGIEAAKAAGIPVIVVNDRVSEELAKKVACNVHDDGEATAELVGAKAAEAAV
FT                   AKKGQNSTINLYIQALFPQELVTESRENGFMTGWNKYMAQHPTVQTKRIPNNYGEALPD
FT                   KTLTAMRNVLAGNPDLDVVFNQTDVVMPAVIEALKGAGRMDQNGKTEVILAGFDGGMEV
FT                   IKSMAKDPASPVVADGLNQPALQAAFAVDEAIAAVTGTPTGKCEGSPATRILPALAVTP
FT                   ENAGQYISGDLAFAGAE"
FT   gene            complement(359365..360336)
FT                   /gene="fruK"
FT                   /locus_tag="AAur_0349"
FT   CDS_pept        complement(359365..360336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="AAur_0349"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09119"
FT                   /db_xref="GOA:A1R1Q3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q3"
FT                   /protein_id="ABM09119.1"
FT                   /translation="MIVTVSPNPSMDRTMCIDQLRHGDVIRSHRSYSEPSGKGVNVAVA
FT                   LHANSIDVVTVLPAGGFTGVQITEMLSDLGVPYIAVPIAQEIRSNVSLVEHNATVTKIN
FT                   EVGPSLDVAEATSLVREALEQVGAGDWLVLCGTLPDGAVERLYIDLVKGARGRSARVAV
FT                   DTSGKPLRTVLPYRPDLVKPNAGELAELTGRALETLGDVVDAAEELRRQGARTVLASLG
FT                   SDGAILLDDSGCYFGQARVDRVVSAVGAGDALLAGFLAGGANGPQALREGLAWAAAAVQ
FT                   QEGTLYRGRGPRTRVDISDDLDRNRALQEPCTAAGLPAGSLV"
FT   gene            complement(360333..361142)
FT                   /locus_tag="AAur_0350"
FT   CDS_pept        complement(360333..361142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0350"
FT                   /product="putative transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07429"
FT                   /db_xref="GOA:A1R1Q4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q4"
FT                   /protein_id="ABM07429.1"
FT                   /translation="MMRPLPDRNESRSESRVPFPEQRRGLILERLRAEGRAEVASIAEQ
FT                   LGVTGETVRKDLMALDQLGLLRRVHGGAVPVGRLTYEPAVSTRTGFIAEKTRIAKAALR
FT                   HLPPGGSVLLDAGSTTARLASMFPHDKELTVYTNTLSIATSLLNRPMLTVYTLGGRVRP
FT                   LTEAEVDDWASRSLSEINVDVAFLGANAISVDRGLTTPDPAEAAVKRLMLDSARRRILL
FT                   ADHSKFGCVSNCKHADLADLDLIITDSDLDGRELKAIQAAGVEVELA"
FT   gene            complement(361139..362512)
FT                   /locus_tag="AAur_0351"
FT   CDS_pept        complement(361139..362512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0351"
FT                   /product="putative carbohydrate kinase"
FT                   /note="identified by match to protein family HMM PF00370"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10255"
FT                   /db_xref="GOA:A1R1Q5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q5"
FT                   /protein_id="ABM10255.1"
FT                   /translation="MLLVGLDVGTTTVKAVVFDEHGTALAEGRADTPWSVSPQGVQLEA
FT                   AGLLEAAALALTCALASAPAGPVASIGITGMGESGVLIGPDGKEVGPVIAWHDRRDLAE
FT                   LESLRSDISGDAFSVRTGLPMTEQWSLTKHRWLLSHLPDTRRATMRLSIPEWIAFSLGG
FT                   APVSEFSLASRTGWLDLASRTWWTETLEWSGATRSLLPELVMAGTNLGAVSADAGLNSL
FT                   TGAVIAVAGHDHQAAVAGAGAHLPGDVLDSCGTAEALVRVIEPALSETALLELTSAGVT
FT                   AGWSVFEDKWTLLGGTQAGLVLRNVLTTLHLDSAAIADLDANPSQGDSPIQVTIDAGQG
FT                   VSIQGATGATSKADIWRAALDAVTRQAAEVHSLMTRAVGSPSRMVVTGGWSRSSGLLQS
FT                   KERVFGALTVSPVRESGARGAAFFGGLAAGIYGSAADFPSGAGQNPSTNTALQTEKAL"
FT   gene            362650..363501
FT                   /locus_tag="AAur_0352"
FT   CDS_pept        362650..363501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0352"
FT                   /product="putative fructose/tagatose bisphosphate aldolase"
FT                   /note="identified by match to protein family HMM PF01116"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06263"
FT                   /db_xref="GOA:A1R1Q6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q6"
FT                   /protein_id="ABM06263.1"
FT                   /translation="MALVHTGDLMRDAVGSGAGLAAFNVVSLEHGEAIVEAAEQAERSA
FT                   VLQISENCIKFHGGRLKPLVSGLAALAESSHARVSLHLDHIEDERILHEAAGTAITSVM
FT                   FDGSRLGFQDNVVATREAARWAHVRGWHVEAELGEIGGKNGAHAPGVRTDPIEAARFAG
FT                   DTGVDSLAVAVGSSHAMTAQTARLDHDLIARIRAEVGLPLVLHGSSGVPDDELVLAVAS
FT                   GMVKINLGTILNVAFTGAVRSALADPGVVDPRAYLGPARSGTAEVACRLLRVVSTKPVA
FT                   AP"
FT   gene            363498..364403
FT                   /locus_tag="AAur_0353"
FT   CDS_pept        363498..364403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0353"
FT                   /product="putative aldose-1-epimerase"
FT                   /note="identified by match to protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09262"
FT                   /db_xref="GOA:A1R1Q7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q7"
FT                   /protein_id="ABM09262.1"
FT                   /translation="MSGHDYRISAAGYSAAVTQQGAAVRELTHEGRNLIVPFAIGEPMP
FT                   DYRGAVVAPWPNRIPDGRYIFRGVELTVPINEPSRAAALHGLVSHVPWTVLYHEPSRLG
FT                   LRHVVRPSKGYPFGLLLDVNYVVDEAGFHTTVSATNTGEAVAPYGTCPHPYLVAGPSPL
FT                   ETWSLELDAGTFLDVTPDRLIPVQRTSVDGTPFDFRSPHQLGGTAIDHAFTDLGTIPGG
FT                   DEVHLRLRDPGGTGVAMIWGEACPWVQLHTADHPIPERHRIGLAVEPMTCPPNAFNSGE
FT                   DLVSLLPGATHNADWTFRAL"
FT   gene            complement(364449..365276)
FT                   /locus_tag="AAur_0354"
FT   CDS_pept        complement(364449..365276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0354"
FT                   /product="putative helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09652"
FT                   /db_xref="GOA:A1R1Q8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q8"
FT                   /protein_id="ABM09652.1"
FT                   /translation="MKDERRKELGLFLRTRRTQALRSDYGLPPVGRSRERGLRREEIAF
FT                   LSGVSVTWYTWLEQGRDISPSRQVLESIARALHLSDTGLSYVLSLGGYSSAPPKGPVAA
FT                   DAPAHVQRLLDALDPNPSYALSPDWGIAGWNRAYEALYPNIGTFNASDRNLLWLVFTDP
FT                   YIRDLLPDWDVTSKRFLAEFRAETGQRLGDPDVEYQVERLKEASREFQESWDRYDILGF
FT                   ESRERQFHHPAVGVLQMEHHQVSPSDRPDLHIVVYTPAPGSDAGAQMQRLMGR"
FT   gene            365363..367225
FT                   /gene="ilvD"
FT                   /locus_tag="AAur_0356"
FT   CDS_pept        365363..367225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="AAur_0356"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08015"
FT                   /db_xref="GOA:A1R1Q9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Q9"
FT                   /protein_id="ABM08015.1"
FT                   /translation="MPALRSRTVTHGRNMAGARALLRASGVANTDIGKPIIAVANSFTE
FT                   FVPGHTHLAPVGRIVSDAILAAGAVPREFNTIAVDDGIAMGHSGMLYSLPSRDLIADSV
FT                   EYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGRVTLTDGSVRSL
FT                   DLVNAIADAVDESISDEDINLIEENACPTCGSCSGMFTANSMNCLAEAIGLALPGNGSV
FT                   LATHTARKALYEKAGATVVELVKRYYDGDDHSVLPRSIATAEAFDNAMALDISMGGSTN
FT                   TILHLLAAAQEAGVEYGLAEMDAKSRQVPCLAKVAPNVAGDKTYYMEDVHRAGGIPALL
FT                   GELNRGGLLHKNVHSVHSNDLDGWLDDWDIRGGKATEEAQALWHAAPGGVRSSTAFSQS
FT                   NEWTSLDTDAEGGCIRSVEHAFSKDGGLAVLRGNVAVDGAVVKTAGVDESIWIFEGPAV
FT                   VCESQDEAVEKILNKTVKEGDVVVIRYEGPRGGPGMQEMLYPTSFLKGRGLGKKCALIT
FT                   DGRFSGGTSGLSIGHISPEAASGGAIALVENGDIISIDITTRSLNLQVSDEILAERREK
FT                   LEVNGGYKPKNRDRQVSPALRAYAAMALSADKGAVRDVSLVENL"
FT   gene            complement(367222..369042)
FT                   /locus_tag="AAur_0355"
FT   CDS_pept        complement(367222..369042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0355"
FT                   /product="putative pyruvate oxidase"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08089"
FT                   /db_xref="GOA:A1R1R0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R0"
FT                   /protein_id="ABM08089.1"
FT                   /translation="MTQRTVSDLIAERLQAWGVERVFGYSGDGINGFMGALSRAEDKIE
FT                   FVQARHEEAAAFMAVGHGKYTGGVGVVTSTQGPGAVHLLNGLYDAKMDSVPVVAIIGQQ
FT                   STTVLGSAYMQEIDLLTLFKDVAAQFAQLASSPEQVPMLIDRAFRTALETRSPCVVIVP
FT                   HDIQTAEAPELKQEHGIVVTAPVWHPARVMPREEELDAAADILATGERIALFVGQGARG
FT                   AQEEVAALAEKLDAGITTSLLGKPYVDETLPFSVGTMGHLGTTASAFLLENCDTLLIIG
FT                   SNDPWTEFYPKPGTAKAVQIDIDGRKIANRYPVEVGLVGDAAETLTALNQRLASRNQPS
FT                   RTQWRSDVEEQVRAWRRLSEERANVPAEPVNPELVVRELNGRLPDNAQVSIDVGSCVYW
FT                   YVRQLILPRGVPAHLSGTLASMGCAIPYGLAAKLAHPDQPLVALAGDGGMQMLGVAELI
FT                   TVAHRWRDWTDPRFVVCVFNNRDLAEVSWEQRETEAEPRFTASQEIPDFPYAAYAKLLG
FT                   LAGIRVEDPAKLGDAWDYALSADRPAVIEVLTDPGIPLLPPFPAGAEKLEGMRSALAQE
FT                   GAEGEHARQLLDIYAEGESRLRDSQGKQQP"
FT   gene            369149..369922
FT                   /locus_tag="AAur_0357"
FT   CDS_pept        369149..369922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0357"
FT                   /product="ANTAR domain protein"
FT                   /note="identified by match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10057"
FT                   /db_xref="GOA:A1R1R1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R1"
FT                   /protein_id="ABM10057.1"
FT                   /translation="MTESGTLPTIRLMETTGSAEHIRSLHELVVGSSDIHGILNGVTGF
FT                   ACDAMSKVAGENIDCALTLRRRKRTATVAGSSERAVQLDMIEQGLGEGPCLEALDVGHP
FT                   VLLADVATDTNWPLYSAALAAEGIHSALGVPMDLGETSQAVINFFAPTAGTFTEAVIAE
FT                   AAAFADVAGSTLRLAIRIETVEQLNADLKTAMSSRTVIDLACGVIMAQNRCSQDEAFEF
FT                   LTKASSHRNKKLHAVASDIIAHLTGGSDNHLRFED"
FT   gene            complement(370042..370302)
FT                   /locus_tag="AAur_0358"
FT   CDS_pept        complement(370042..370302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09364"
FT                   /db_xref="GOA:A1R1R2"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R2"
FT                   /protein_id="ABM09364.1"
FT                   /translation="MKLPLGLAVPAFTEASDIHLLIMVGLVFLTGVAGAATVSLLLLLA
FT                   PLATLFLGRNKPGRKTDVKQKKPDGGATRLPPPLTLGDEAA"
FT   gene            370781..371152
FT                   /locus_tag="AAur_0359"
FT   CDS_pept        370781..371152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0359"
FT                   /product="domain of unknown function (306)"
FT                   /note="identified by match to protein family HMM PF03724"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08849"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R3"
FT                   /protein_id="ABM08849.1"
FT                   /translation="MAQTRIFRTVSLAFVAAALLAGCAGSGTSPFVGVWGDTSDTKQPS
FT                   LDLKSDGSVSGTDGCNRLMGSWTEDGKTIAFGGFASTRMACEGVDTWLSNAATAKIQED
FT                   GKLAVFGQGGAQIGTLAGK"
FT   gene            371196..372212
FT                   /locus_tag="AAur_0360"
FT   CDS_pept        371196..372212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0360"
FT                   /product="putative glutaminase"
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09210"
FT                   /db_xref="GOA:A1R1R4"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R4"
FT                   /protein_id="ABM09210.1"
FT                   /translation="MVNSNVEGVEQSVSTGTLPGWEQVDSLVAASHDRNRGCKDGAVAD
FT                   YIPVLAQADPELFGVCVVEVDGGVHVTGDADVEFSIQSISKAFVYALVCEEFGHAAMAD
FT                   LVGVNNTGLAFNSVIAIELNDGHPMNPMVNAGALATTALMPGSAPDKQWDAIHSGLSAF
FT                   AGRDLVLDEVVYRSEAVTNTRNRAIARLLESYGRIGRDPLEVVDVYTKQCSLRVSARDL
FT                   AIMGATLADGGVNPVTGKRVVSAEVCRDTLAVLAANGLYERSGEWLFEIGLPGKSGVSG
FT                   GLLTVSPGKAGIGAFSPRLDPAGNSVRGQQATAYLSRVLGLNIFASQAYAPNESRGY"
FT   gene            complement(372214..372621)
FT                   /locus_tag="AAur_0361"
FT   CDS_pept        complement(372214..372621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0361"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08266"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R5"
FT                   /protein_id="ABM08266.1"
FT                   /translation="MAAGTKDDPWQLTTPPGSSDYTMYKDEAADPPAIVCQVGSTKLLY
FT                   QLRAIEDLHAWLLEQGDWVPLGAADEGKDAAPGTVEAWGRSEDNPVGGWYGLRKGYRGR
FT                   FGMYMPPLLEALGLAELTHEKRNNTMRAIAK"
FT   gene            complement(372652..373983)
FT                   /locus_tag="AAur_0362"
FT   CDS_pept        complement(372652..373983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0362"
FT                   /product="putative transmembrane efflux protein (MFS)"
FT                   /note="identified by match to protein family HMM PF05977;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06954"
FT                   /db_xref="GOA:A1R1R6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R6"
FT                   /protein_id="ABM06954.1"
FT                   /translation="MASLRALRPFAHREFRVLISALSISIFGSGMWAVAMVYEVIHLGG
FT                   GPLELSLVATAASIGLVGFVLAGGIAADRFPQRLLIIAVEGANLAVIATITALAMFNVL
FT                   QLWHLAIGAFVLGVGQAFFFPAYSAMLPRILPADDLLAANGLEGTVRPVLQQAAGPALA
FT                   GILVAVLSPAHAVAGVAVCHLLAFGIVNLLSRQPPDDPGLADTGPDNAVTGAPASRKSS
FT                   LFKDLREGFSYTIRTPWLLWTLIWACLSVLFLIGPIEVLLPFVVRDQLGGDSRTFGFLL
FT                   AVMGVGSAAAALATATVRLPRRYLTVMVVTWGLGSLPVAAIGFMDNFWVLGAAMLIFGA
FT                   TEGVGMVIWGTLLQRRVPRHLLGRISSLDFFVSLALMPVSMALAGPVAEVVPIWVIFFV
FT                   AGLVCPIMAFVALFAARMMSDEIENPLTSTTMASESADTQPDSV"
FT   gene            374061..375299
FT                   /locus_tag="AAur_0363"
FT   CDS_pept        374061..375299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08441"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R7"
FT                   /protein_id="ABM08441.1"
FT                   /translation="MRWRGGRLTGTKSGRNLSYEAPDGGTSSSSMSGPSAASWLWMPVS
FT                   CETQPSVSPSAGASVWCRMTCSVLFVAFITDTPCPCMDCFRECIQVYAEARPLWAPLCA
FT                   EYCPHTPMNGSRKAGAWHRLKQAVPRETTNCQGDVKMPKRPNPAVKIAQETAHNAVFDA
FT                   EGNAKPGVHNVLLRAVEVQRPLVLANLRRLQRRHPHDSPAQLAAKLERHYLLAISGGGA
FT                   AVGATAVVPGIGTAASLGLSALATVGFLETTALYASSLAELHGIRLTDPVRAQTMVMAI
FT                   MLGEEGTSMLGALSGQSLGRSKGVTNAWGRTLTKKIPGSGFGVIRDSIQRAFLKNLLKR
FT                   QGTAFLGRALPFGVGAVVGGAGNLMMGRAVVSTAKEAFGPLPDTVPGELLPNAPKNVLN
FT                   NPTLEGGNSGPER"
FT   gene            375283..376032
FT                   /locus_tag="AAur_0364"
FT   CDS_pept        375283..376032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0364"
FT                   /product="putative LamB/YcsF family protein"
FT                   /note="identified by match to protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09961"
FT                   /db_xref="GOA:A1R1R8"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R8"
FT                   /protein_id="ABM09961.1"
FT                   /translation="MDLNADLGESFGSWTMGDDASMFRIVSSANVACGFHAGDPLTMLD
FT                   SCRAAFELDVRVGAHVGYRDLAGFGRRSLDMTFDELFGDVLYQLGALDGMAHAVGASVD
FT                   YVKPHGALYNRIVRDAEQAEAVVAAVHAYDPGLPVLGLPGSAWLTLAEESGHPVFREAF
FT                   VDRAYLPDGTLVPRTQEGAVLQDPAAVVAQAVRLATRKEVLAIDGTVVPVQADSLCIHG
FT                   DTPGAVNMAAAVREGLEQAGVQIEAFA"
FT   gene            376054..376845
FT                   /locus_tag="AAur_0365"
FT   CDS_pept        376054..376845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0365"
FT                   /product="putative allophanate hydrolase subunit 2 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02626"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09410"
FT                   /db_xref="GOA:A1R1R9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1R9"
FT                   /protein_id="ABM09410.1"
FT                   /translation="MGAVVVEPGSSSMVLGPEQVLDRASMHLANGLLGNPDSAAGLEVL
FT                   LGGLKLRFVSGSAVAVTGAEGMVTLDGTELPLNKAVRVPPGAVLELGPAMFGIRYYLAV
FT                   QGGISAQGEAAQGEAIRAGAALTFGRPNNHGSPEVNHPARRALDPERPVVARVSRGPQA
FT                   QNDDAGTWLRLTSEPWILSPESDRAGARLVGRPLDVTSAPIPQAQPLVSGSVLLPSSGL
FT                   PVIALAGHPDTSQSPVIAVVRDEDLDVLGQARPGQMVHLLG"
FT   gene            complement(376948..377757)
FT                   /locus_tag="AAur_0366"
FT   CDS_pept        complement(376948..377757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0366"
FT                   /product="metallo-beta-lactamase superfamily domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07219"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S0"
FT                   /protein_id="ABM07219.1"
FT                   /translation="MLKQVAEGVLVHESEFIQSNCTVVQGRDGVLLIDPGITVNEMAGI
FT                   AEDLQRLGQPVVAGFSTHPDWDHVLWHPDFGDPPRYGTARCAASIRGVLSRPDWTDQVA
FT                   EGLPPEYAEQIPMDLLGLITGLPAGVDEIPWDGPTVRVLEHQAHAPGHAGLLVEESGVL
FT                   VAGDMLSDTLIPFLDLEAADPLSDYLEALQQFEAAAGDVFAVVPGHGSVGGSEQLLERI
FT                   SLDRAYVQALQDGRDPQDPRVGPAAPLYWMADVHSWQLQRLAEKRRG"
FT   gene            complement(377772..378200)
FT                   /locus_tag="AAur_0367"
FT   CDS_pept        complement(377772..378200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0367"
FT                   /product="putative lactoylglutathione lyase"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06649"
FT                   /db_xref="GOA:A1R1S1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S1"
FT                   /protein_id="ABM06649.1"
FT                   /translation="MPIKLENVGIAVRDLEETVAFFTDLGLTVVGRDTVSGEWADTAVG
FT                   LDGNHAKIAVLQTPDGNGQLELFEYIHPDAIETNPTLPNEIGMHRVAFSVDDIDHALEI
FT                   AAKHGCHPLRGVANYQDVYKLTYLRGPSGILVMLAQKL"
FT   gene            complement(378241..379587)
FT                   /locus_tag="AAur_0368"
FT   CDS_pept        complement(378241..379587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0368"
FT                   /product="putative membrane protein (DUF445)"
FT                   /note="identified by match to protein family HMM PF04286"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08708"
FT                   /db_xref="GOA:A1R1S2"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S2"
FT                   /protein_id="ABM08708.1"
FT                   /translation="MQVNSEQIPTEDVTNPNSTAGSAPARGRSAVVELSAGDMEKAAAL
FT                   LRMKRLALALLIAMAVIFTVAFAFQKQYPWLEYVRAAAEGGMVGALADWFAVTALFKYP
FT                   MGLKIPHTAIIPRRKDQIGESLSDFVESNFLSQEVVQDKLASIDIARKAGRWLSAPGGA
FT                   ERVAKEGGAVIRGAFTVLNDDDVQAVIEGMVRKHLLTPPWGPPVGRMAERIFADGHHHT
FT                   LVDLLVDRAADWVDANHATVNRLVSDRSPLWVPTFVDGLVGDRVYVELSKFVRAVQADQ
FT                   NHQVRQSIDAYLTDLAQDLQHDPAMIERAESIKAQILGDPEVRELASRTWGTVKNALLN
FT                   AVDDPDSELSQRFKSAVRDFGTRLVNDDELAGKINTWIGDAAGYLVNTYRSDIAGVISD
FT                   TVARWDAEETSQKIELQVGKDLQYIRINGTVVGALAGLAIFTVAHLLFG"
FT   gene            379638..380525
FT                   /gene="glpQ"
FT                   /locus_tag="AAur_0369"
FT   CDS_pept        379638..380525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="AAur_0369"
FT                   /product="lycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09591"
FT                   /db_xref="GOA:A1R1S3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S3"
FT                   /protein_id="ABM09591.1"
FT                   /translation="MTSDDFAPSRPKVYAHRGASAAFAEHTRAAYLKAIADGADGVECD
FT                   VHLTRDQHLVLLHDADLDRTSTGTGPVGEHTLEELRALDFSSWKGARIPEAYGGVSDQF
FT                   LTLPDLLDILRGAGREIGLAIELKHPSPYGLKLEERVLALLHEEGWTPEESRLDNILVS
FT                   FMSFDSDSVQRLLETVPGKHICQLVDNFTAKEIRQEFGLGFFTGGAVANVLRATQLDAE
FT                   RVLDEGQVGIAGPGIEYVREHARNVQRWLEAGRIFRVWTVDSEKDVALCQGLGIHEITT
FT                   NKPAQVLAQLMVSN"
FT   gene            380578..381012
FT                   /locus_tag="AAur_0370"
FT   CDS_pept        380578..381012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06365"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S4"
FT                   /protein_id="ABM06365.1"
FT                   /translation="MSFRWSAQATQTTSAVALSALLLASAAKHFRTPKFYFPVVPDYLC
FT                   RKDEPGSRPNGPLAVMSREEWVASSGLLEVTAAVGLLIPATRKVAADATTAMFAAFLAG
FT                   HIDALRRAYGPKGSAAERRIHTVRLPLQIPLILWSWSLRK"
FT   gene            381009..381767
FT                   /locus_tag="AAur_0371"
FT   CDS_pept        381009..381767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0371"
FT                   /product="putative azaleucine resistance protein AzlC"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09945"
FT                   /db_xref="GOA:A1R1S5"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S5"
FT                   /protein_id="ABM09945.1"
FT                   /translation="MSGSPAATRLRESPAFKVALSLSIATGLYGVSFGALSVASGFDFW
FT                   QTMVLSLLLFSGGSQFAFIGVVAGGGSGVAAMTASALLGLRNGIYGMQINAMLRPGGWK
FT                   RYLSAHVTIDESTATASGQSDPDEQRRGFWTAGIGIFILWNIFTAIGALAGDAMGDPKQ
FT                   WGLDGAAVAAFLALLWPRLKGREPWAIAAACALATILAVPFVPSGVPILVAAVVAGVIG
FT                   WFSHARMDEGLEPDVDPYAEKHQRGHGGNK"
FT   gene            381764..382075
FT                   /locus_tag="AAur_0372"
FT   CDS_pept        381764..382075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0372"
FT                   /product="putative integral membrane protein"
FT                   /note="identified by match to protein family HMM PF05437"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09493"
FT                   /db_xref="GOA:A1R1S6"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S6"
FT                   /protein_id="ABM09493.1"
FT                   /translation="MNLWLWILIACALAYLTKLVGYFVPAKLLESPRIMHVAGTMTIGL
FT                   LASLTVVNAVASGQGLVLDARIGALVAAAVALWLRAPFLVVVISGAAAAALLRLLGWG"
FT   gene            complement(382079..382708)
FT                   /pseudo
FT                   /locus_tag="AAur_0373"
FT                   /note="putative transcriptional regulator, TetR family;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00440"
FT   gene            382801..383133
FT                   /locus_tag="AAur_0374"
FT   CDS_pept        382801..383133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0374"
FT                   /product="putative Domain of unknown function DUF77"
FT                   /note="identified by match to protein family HMM PF01910"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08353"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S7"
FT                   /protein_id="ABM08353.1"
FT                   /translation="MLLAFSVAPSGQPASAANGGPTPDASVHDAVAAAVKIVRESGLPN
FT                   QTDSMFTTIEGEWDEVFDVVKRATEAVCRYGSRVSLVIKADIRPGYSGELTGKVERLED
FT                   AISATE"
FT   gene            383174..383845
FT                   /locus_tag="AAur_0375"
FT   CDS_pept        383174..383845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0375"
FT                   /product="putative O-methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01596"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08220"
FT                   /db_xref="GOA:A1R1S8"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S8"
FT                   /protein_id="ABM08220.1"
FT                   /translation="MIEHVTEPGWVDVEHYLTDVVVRPDPAHKRALTSAVEADMPAIEV
FT                   APNAGKLLRMLVQMSGARRVLEVGTLAGFSSIWMAQGLPDDGRIVTCEFLQKHADVARA
FT                   NVDAAGVGHKVDIRVGAALDTLPTLVGQESFDFVFIDADKENDSNYLDWAIRLGHPGTV
FT                   IVVDNVIWDGAILEPERDEVNAPGIVAMLEKMGQDPRLDATAIQTVGSKGWDGFAIARV
FT                   R"
FT   gene            383849..384352
FT                   /locus_tag="AAur_0376"
FT   CDS_pept        383849..384352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0376"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07032"
FT                   /db_xref="GOA:A1R1S9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1S9"
FT                   /protein_id="ABM07032.1"
FT                   /translation="MDFTIRPATVDDAEAMALMQVQSWKESYGHLLPPEFFEKQEAALP
FT                   DRIERYRAFIAAGHTRMLAHDPDGHLVGLGAAGPGQDEDGPCERELYMLYTLEHVHGRG
FT                   VGQALVDALIGDGPAYLWVLDDNPRAEAFYRRNGFVPDGKRQLCDPSWYSLPEHRMVRP
FT                   SVGL"
FT   gene            complement(384390..384791)
FT                   /locus_tag="AAur_0377"
FT   CDS_pept        complement(384390..384791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0377"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06805"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T0"
FT                   /protein_id="ABM06805.1"
FT                   /translation="MLSAAVGTTISAAVGTTISATVGTTISATIGTAISATIGTAISAT
FT                   IGTAVCTAVVDTWGAGCATVSGAFSAGVCATVGAPVSTAVCRAFLLAWILLWISHASSR
FT                   ESNGVTRLRFRRLLPGRSAPRPPVITISI"
FT   gene            384845..386011
FT                   /locus_tag="AAur_0378"
FT   CDS_pept        384845..386011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0378"
FT                   /product="putative cupin superfamily protein"
FT                   /note="identified by match to protein family HMM PF08007"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06915"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T1"
FT                   /protein_id="ABM06915.1"
FT                   /translation="MKDAGVLETRLIDIGYEKFASDVWGRTALLTRGVGDFSDLFSADA
FT                   VDELISRRGLRTPFLRVAKGGSTLPESSFTSPAGVGATISDQLDDTQLWRKFADGATLV
FT                   LQALHRTWEPVSSFSTQLSTELGHPVQANAYITPPQNRGFDDHYDVHDVFVLQIEGTKR
FT                   WIIHEPVHVDPLRSQPWTDRRSAVAEAAQGKAYIDTVLEPGDVLYLPRGWLHAAEAQGK
FT                   VSIHLTLGVHSWTRHALAEHLAQAALAALCDDPEVRRSLPLGVDGPDEEIAAVRERLAA
FT                   AVLEADTTSLFHRTRRGQGRPAPLGPVAQLAALDGLGPESLVRLREALEARLEGSRLTT
FT                   RVGWLDFPEANLPSVRRLLDGEPHLASDLGVELVERLLRAGVLVTAEL"
FT   gene            386021..386929
FT                   /locus_tag="AAur_0379"
FT   CDS_pept        386021..386929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06999"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06490"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T2"
FT                   /protein_id="ABM06490.1"
FT                   /translation="MTTSSLPTPGFFCADSARIRGDSMAGTASPGLVWVLVEYRGGWPP
FT                   NGFDGLDLEAGTKALVLSAARTAGARVLLVRRPGPRRRHGPNSWAVVRHHSSGAYQQLW
FT                   GTWDRDEDLADIVTALASPGKPGFPPVILICAHGRHDPCCAVRGRPVGRALGERWPELV
FT                   WECSHVGGDRFAANAVVVPDGVYYGGLDAQSSVATIEEHLAGRIHAGYLRGYTDLSPLQ
FT                   QAAVAAVLERFGPAGRHDYLVTETLHEGDHWRIHITGNPPHPAHIDVELQPRRSPQCQL
FT                   TCLAPAEGSVMVYEPTSIRRT"
FT   gene            complement(386962..387117)
FT                   /locus_tag="AAur_0380"
FT   CDS_pept        complement(386962..387117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07976"
FT                   /db_xref="GOA:A1R1T3"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T3"
FT                   /protein_id="ABM07976.1"
FT                   /translation="MELGELVWAEVLTVAVAWLTVVCLLLARVPKPPSLIDSPLDMDQP
FT                   EDSESR"
FT   gene            387292..388155
FT                   /locus_tag="AAur_0382"
FT   CDS_pept        387292..388155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0382"
FT                   /product="putative spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T4"
FT                   /protein_id="ABM07280.1"
FT                   /translation="MPTGTRPDGPVAGVYYIDTGDCELLQDQDNSNGWLLKINGVMSSH
FT                   IDLADPLFLDFEYMRWIAALVESRWPREQKPKLRALHLGGGACSMARYFHAAYPEARQV
FT                   VVELDGKLADYVRGWFDLPKAPLLRIRVGEAREVTESLTPDTRDLIIRDVFAGAFTPRA
FT                   LTTREFTAHADSVLAPDGLYVVNSGDAPDLKNARADAATIAATFEHTMIIADPAMLKGR
FT                   RYGNMIMAGSHAPFGDDPTLARKLLGGGVPAHMWDDAKVRAFAQGIPVRHDPVTVAADE
FT                   PSVAAE"
FT   gene            complement(388138..389892)
FT                   /locus_tag="AAur_0381"
FT   CDS_pept        complement(388138..389892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0381"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09323"
FT                   /db_xref="GOA:A1R1T5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T5"
FT                   /protein_id="ABM09323.1"
FT                   /translation="MSAEILPIATPRETRKAMWRLLAQHPGRLTLTIVVLLAASCCGLA
FT                   APALLGVMVNIAASGGHVLSLLWLAIGLLVAGGLGALLGILGQNLLARICEEALAGLRE
FT                   EVFAAAARKPLAQLEKAGIGDVVARVSGDVEAVSEAISGVLPAFTSAAFTIAVTLLGLG
FT                   VIDWRFAVAVLVAAPLQVFTLRWFLKRTAPIYRTVRITEANRTEQIIETVHGSPSVVAL
FT                   GLGSRHADLVAAASHENIGHSMRGVGYLTRFYNRLNLAELIGLSGVLVVGFWLHAEGAV
FT                   TIGAATAAALYFYRLFDPIGLVLGQFDELQKAAAGLGRMFGLTMSAGRTTARPSPAAAD
FT                   AGIVLDDVTFAYPGQRPALHGVSLTVQPGERVAIVGTSGAGKTTLAKVIMGLEHPHSGA
FT                   AWVGGLDSAAGAPAELHERIAMVSQEVHVFSGTLAEDLRLAKPDASADELAHVLETVGA
FT                   TWVETLDDGLDTSVGAGGHQLTPEQAQQLALARLMLKDPPIAVLDEATAEAGTGSAHML
FT                   DQAAEAALAGRTSVVIAHRLSQAASADTVVVMEQGRIVESGSHQELLAVGGRYAHLWEA
FT                   WNSSLSRN"
FT   gene            complement(389889..391685)
FT                   /locus_tag="AAur_0383"
FT   CDS_pept        complement(389889..391685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0383"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10272"
FT                   /db_xref="GOA:A1R1T6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T6"
FT                   /protein_id="ABM10272.1"
FT                   /translation="MVSMPSGSAIPSCPPGRNKPAPWTVSRLFTFTLFANRRWKLLLVG
FT                   CAGLALHQVSEALVPATIGAAVDNAIQPNDAGALLGWLGALAVVFVVLALSWRLGTLAT
FT                   ERSFNYGSHDLRQLVVERTLHHRGMAARRAPGEIVAIASSDADRVAGLSWLISGGLAAA
FT                   AGVITSAVTLLLISVPLGLAVLLATPVMLLVMHRLTKPLENRSDMEQSTAARAGALATD
FT                   FITGSRPLKGLGAEDAAIERYRAASRESLASALKAIRAKSAYTGASTALSAAFLAGIAF
FT                   FAAWFAVQGTITVGELVAVVGVAQFVQGPMASLGFLSVELARKRASAARIAVLLEEPDA
FT                   VPAPDAEERTTAAAGSVATLTSPAEPAPYGEPAPVLELSDKAGNSVFPPFTASIGEIVG
FT                   VVLPDGDQARKLVDTLGFRTPAPSGLISIDGRDAAHLDPHHVRSRVFADSHDGVLFRGS
FT                   VRENVAVSSTELEERALAAAAVGDFVSQLPEGTETVLTGHGQSLSGGQRQRLVLGRSLH
FT                   QKQPVLVLHDPTTAVDTATEAVIADGLRNFPDKALVLVTTSPTLLGICHRVVMGGADGP
FT                   PATGTHRELLATSASYREVVGS"
FT   gene            391717..392581
FT                   /pseudo
FT                   /locus_tag="AAur_0384"
FT                   /note="transcriptional regulator, AraC family, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:CAD44484.1"
FT   gene            392727..393659
FT                   /pseudo
FT                   /locus_tag="AAur_0385"
FT                   /note="putative iron(III) dicitrate ABC transporter,
FT                   authentic point mutation; this gene contains a premature
FT                   stop which is not the result of sequencing error;
FT                   identified by similarity to GB:BAB80516.1; match to protein
FT                   family HMM PF01497"
FT   gene            393656..394537
FT                   /locus_tag="AAur_0386"
FT   CDS_pept        393656..394537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0386"
FT                   /product="putative iron-chelator utilization protein"
FT                   /note="identified by match to protein family HMM PF04954;
FT                   match to protein family HMM PF08021"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07797"
FT                   /db_xref="GOA:A1R1T7"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T7"
FT                   /protein_id="ABM07797.1"
FT                   /translation="MMRIYRAEVISTLLLTPGMIRITFGGPGLAGFDTTGVGDEYLRVF
FT                   LPDPGCHEARLPISTGDSWDWSPCVEPSAMRTYTVRAVDAGAGTVDIDFVVHDGGLAAS
FT                   WAGRAQAGDVVGLNSPTGLYEPPAGLQWQILLADATGLPAVSRLVEQSPPGVRTRVLIE
FT                   VEDPSHQQELTLGAGTEVAWIYGGNGHSQSRLDEVLRSMELPGGVGYIWVAGETKVLRG
FT                   IRKYLRHDKKLKPESYKLIGYWTDKSEAWEERWENLDAQTRRWFDELWSNEKWDREEIV
FT                   DLQDAKFELLGL"
FT   gene            394538..395650
FT                   /gene="fepD"
FT                   /locus_tag="AAur_0387"
FT   CDS_pept        394538..395650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="AAur_0387"
FT                   /product="ferric enterobactin transport system permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07558"
FT                   /db_xref="GOA:A1R1T8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T8"
FT                   /protein_id="ABM07558.1"
FT                   /translation="MASGTMAPRSATAAAVELPDAVPVAGDSPPPSASAGLVAVNRYRL
FT                   LGLLTALAALALVLWLSLVVGSKDVDLAALWPAITAYDGSPEHVIIHDLRLPRTVTGVV
FT                   VAVALGLSGALIQALTRNPLADPGILGVNAGAGFSVVLGVAIFGVTSIQEYIWFSFAGA
FT                   VVATVAVYFIGSRGRGGATPLRLTLAGVALGAVLGGISSGITLLRPAVFDSMRSWSAGT
FT                   LSNRTWEIFTTVAPFILVGTLIALAMARPLNAVAMGDDTAKSLGANIVSTRVWTIVSVT
FT                   LLCGAATAAAGPIGFVGLMVPHVARWIVGPDQRWILAYTLVLSPVLLLVSDILGRLVLR
FT                   PGEMQVGIITAFVGAPVLIWLIRRRKVSTL"
FT   gene            395647..396735
FT                   /gene="fepG"
FT                   /locus_tag="AAur_0388"
FT   CDS_pept        395647..396735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="AAur_0388"
FT                   /product="ferric enterobactin transport system, permease
FT                   component"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10150"
FT                   /db_xref="GOA:A1R1T9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1T9"
FT                   /protein_id="ABM10150.1"
FT                   /translation="MISVESATPVEQAAPVDFGRRTLSVRRFGGRVSLRIDVRTLIVTA
FT                   VLVAAALALAVVALGLGEFSVAVPDVVSALLGQSGGAVHMVVVEWRLPRVLLALLLGAA
FT                   MGVSGAIFQSLTRNALGSPDVIGFNTGAYTGALVVILLMGGGYYAVSAGALVGGLVTAA
FT                   LVYVFAYKKGIQGFRLIIAGIAMSAMLASVNTFMILKASLEQAMSAAVWGAGSLNKVSW
FT                   DQVLPVVVIFMALLAVLSFYGRRLGLLEMGDDAARALGVRLEGSRLVLAVVGVALTAMV
FT                   TAAAGPIAFVSLAAPQLARRLTRSASVAMVPSAAMGAFLLVASDIVAQNLFAPVQLPVG
FT                   VVTVSIGGCYLVWLLAREVKRQ"
FT   gene            396759..397601
FT                   /gene="fepC"
FT                   /locus_tag="AAur_0389"
FT   CDS_pept        396759..397601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="AAur_0389"
FT                   /product="Ferric enterobactin transport ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06412"
FT                   /db_xref="GOA:A1R1U0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U0"
FT                   /protein_id="ABM06412.1"
FT                   /translation="MTNVLVEPGSAGSRPSRVRSGVGSRLRADNVSLGYAGRTVSSALD
FT                   VRIPDGEFTVIVGPNACGKSTLLRALSRLLEPSSGSVVLDGKNISSYGAKEVARRLGLL
FT                   PQTSIAPDGITVADLVARGRYPHQKLLRQWSESDEAAVVAALEATNVTSLSGRLVDELS
FT                   GRQRQRVWVAMVLAQQTPLLLLDEPTTFLDIAHQIELLELFRRLNGEGNTLVAVLHDLN
FT                   HACRYATHLIAMKDGAVVAEGRPADVVTAELVEHVFGLPCVVIDDPVSHTPLVIPLGS"
FT   gene            complement(397615..398511)
FT                   /locus_tag="AAur_0390"
FT   CDS_pept        complement(397615..398511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0390"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09013"
FT                   /db_xref="GOA:A1R1U1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U1"
FT                   /protein_id="ABM09013.1"
FT                   /translation="MNPNPDDLLILLTVSRSGKFTTAAQALGLNHTTVSRRIAALEKAL
FT                   GGRVLARAAGGWEVTELGAEAVLVAERIEAAVGALGPSDRAPDPITGVVRMTATDGFSA
FT                   YIAAPAVARLRMEHPGLSVEIVTVTRRALQQRSGLDIEVVVGTPQVHRAEAIRLGEYRL
FT                   GMYASRAYLKDNGTPSSIEELTQHQLVYFVDSMLQVDDLDAPRRLVPAMRDGLSSTNVF
FT                   VHVEATRAGAGVGFLPCFMADRHSDLVRLLPADFAELLPYWMVLRPDSMRRPAVAAVVQ
FT                   ALREETEQRREELLGAE"
FT   gene            398649..400037
FT                   /locus_tag="AAur_0391"
FT   CDS_pept        398649..400037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0391"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09345"
FT                   /db_xref="GOA:A1R1U2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U2"
FT                   /protein_id="ABM09345.1"
FT                   /translation="MSVEQRSASRAGKGAGEGSGLKKIVAASMVGTVVEWYEFFLYATA
FT                   ATLVFGKYFFPSTGNELDGIIQAFITYAVGFVARPLGGIVFGQIGDKLGRKPTLQLTIV
FT                   IVGVSTFLMGCLPGFMEIGYWAPAMLVALRFIQGFALGGEWGGAVLLVAEHSPNKSRGF
FT                   WSSWPQAAVPVGNLLATLVLFVMSTTLSSEAFLGWGWRVAFWLSAVIVFVGYYIRTHVT
FT                   EAPIFLEAKAQVEESKAISYGVGEVIRKYPKGILQAMGLRFAENIMYYLVVSFAIVYLK
FT                   SVHKYDTSSLLLALLIAHVIHFLVIPQVGRLVDSWGRKPVYLVGAITGATWPFFAFPMF
FT                   DTKNAVVIVLAVTIGLCLHAFMYAGQPAIMSELFPTRMRYSGVSLGSQVTSIFAGSLAP
FT                   LLATQWLKDTGSWVPTAIYLVVACAITVVAVVSLKETKGIALQEVDEADAIRHGLTTSS
FT                   AAKG"
FT   gene            400042..400791
FT                   /gene="bdh"
FT                   /locus_tag="AAur_0392"
FT   CDS_pept        400042..400791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdh"
FT                   /locus_tag="AAur_0392"
FT                   /product="D-beta-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM TIGR01963"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08807"
FT                   /db_xref="GOA:A1R1U3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U3"
FT                   /protein_id="ABM08807.1"
FT                   /translation="MDNSLNGRKALVTGGASGIGAACARALAARGAKVVVADVDASGAA
FT                   ALADELGGTAWTVDLLDVDALAALSLDCDILVNNAGIQKVAPIEEFEPAEFRRILALML
FT                   EAPFLLIRAALPHMYANGFGRIINISSVHGLRASAYKSAYVSAKHGLEGLSKVTALEGG
FT                   ERGVTSNCINPGYVRTPLVERQIADQARLHGIPEAEVLAKVMLTESAVKRLVEVEEVAS
FT                   LAAWIASDDAGMVTGASYTMDGGWSAR"
FT   gene            400914..402359
FT                   /locus_tag="AAur_0393"
FT   CDS_pept        400914..402359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08960"
FT                   /db_xref="GOA:A1R1U4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U4"
FT                   /protein_id="ABM08960.1"
FT                   /translation="MFGRGPWKSSFMGGIRGSQEAAVASPLALPARVLPSAPPGAVASG
FT                   VAVSGRGIREFILELGSRQITADSSALIDELRDLEDLKSAISARQARVAVAFDLAQRAE
FT                   QAQAGVPAAERGMGVAAQVALARRESPNKGSRLFGFAKALVTEMPRTMAALESGQLNEW
FT                   RATLLVKETACLSVEDRAAVDEELAPDAGTFDGTGDKAIIAAAKAAAYRRDPRSVAQRA
FT                   SRAATERTVSLRPAPDTMTYLTALLPVAQGVAVYAALTRTADSVRSSGDARTRGQVMAD
FT                   TLTERVTGTSSGVAGINLNLVMTDRTLFQGDPEPARLEGYGIVPAEWARALLVEEQSGY
FT                   EDQLHWNLESADRSELRVLLRRLYTAPRSGELLTMDSKARFFPQKLRRFIHIRDNTCRT
FT                   PYCDAPIRHIDHVIPWHSEGSTHLNNGAGLCGACNHTKENPGWTAKSMPGDVHTIRVST
FT                   PTGHSYKSKAPPLPGHKSTRLRN"
FT   gene            complement(402393..403832)
FT                   /gene="proY"
FT                   /locus_tag="AAur_0394"
FT   CDS_pept        complement(402393..403832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="AAur_0394"
FT                   /product="proline-specific permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08518"
FT                   /db_xref="GOA:A1R1U5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U5"
FT                   /protein_id="ABM08518.1"
FT                   /translation="MESSVLQAAGTALSRGLNVRHIRFMALGSAIGTGLFYGSASAIQK
FT                   AGPAVLLAYIIGGAAVFMVMRALGEMAVRHPVSGSFGQYASKYLGPFAGFVTGWTYVFE
FT                   MAIVAIADVTAFSIYMGFWFPQVDRWIWVLAIILFLGAMNLLSVKVFGELEFWFSLIKV
FT                   VAIIAMIVGGAAIVVFGFQTGDGGGVAPGLGNLVNHGGLFPNGFEGLLAAFAVVMFAFG
FT                   GIETIGITAGEATNPKKVIPQAVNTVPVRVLLFYVLTLGVLMSIFPWNEIGSSGSPFVQ
FT                   IFDGLGIPAAPHILNAVVITAALSAINSDIFGAGRILFGLAQQGHAPKSFSKISRHGVP
FT                   WMTVVMMGGILLVGVVLNAVIPEDVFVLIASIATFATVWVWVMILASHVAMKREIKRKG
FT                   LPASEFGSPLWPVASILTMAFMAMVIVILGVFEDTRVALYVGGTWLVLLFVAYKLWVRG
FT                   GGLLRAELVDETAQMPIVKAP"
FT   gene            404110..406203
FT                   /locus_tag="AAur_0395"
FT   CDS_pept        404110..406203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0395"
FT                   /product="putative short repeats of unknown function
FT                   family"
FT                   /note="identified by match to protein family HMM PF03752"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09861"
FT                   /db_xref="GOA:A1R1U6"
FT                   /db_xref="InterPro:IPR005506"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U6"
FT                   /protein_id="ABM09861.1"
FT                   /translation="MNSAFRTARRRVTAALVAVVAGASLLLATPAQAYEIPAFEVPHAA
FT                   QAPVPFVERATDTAGVVELWKTGGPATRAAAAAALVGGPEALQTFLDGGQDVTLAADRK
FT                   QLVTELTTRGSENVRESAVRVLATNDPAVIDSFLSSGWAKSWELDLRIATSWFLNYEGP
FT                   VRMAASKSLDQGAEAIEGFVLEGWRKTAQGQDREAVTHLTNSPIAGVTLGAQAALDTYD
FT                   PEVLATFLRYGQFVAADRDSETATVTGLLQQIKSDIAANPNGTVAVADRAKAAVEKAKN
FT                   TASAAREADTARLMADWKFQTTQAVPRAIIDGASMTAKKPFQEAFGKAAKELPGLLTTL
FT                   TAPGADLDALINDARQATLDLALVGTPEVRKAAEAALLGGDAAIKTFVVNGHDAALLLD
FT                   EAALVADRQRAFQYQATGGKYVQKAATEAVKSASHADVRYFLEYGFAGPQDLDNRILAY
FT                   QKLDAADLELRVAADVALDGSRADAHAFATVGQFAALDRDMATRAHVASIDAMIAELAG
FT                   LADTAAVDAGKASDAAKAAEAARQAEAARQAEAAAEAARQAEAARQTAAANAGVQAGQA
FT                   AAGQVDVSQHSGTGVAPIVVPWPRDYAPAVELAETGTPAEAVETPAATASAAPSISVPP
FT                   AASAAKDGASVDSQSQEAASPLAASSNGMSGWTIGLIVALVLAAAGAITFLLRRKGVAP
FT                   TKG"
FT   gene            406344..407150
FT                   /locus_tag="AAur_0396"
FT   CDS_pept        406344..407150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0396"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01022;
FT                   match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09414"
FT                   /db_xref="GOA:A1R1U7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U7"
FT                   /protein_id="ABM09414.1"
FT                   /translation="MTTTPTAPGKATSKVPAAENTLRILKLLASRRGPMAASNIATALG
FT                   LPRSSVYHLLGVMEANGFVLHLHEEQRYGLGISAFELSSAYSRQEPLSRLGRPMLASLV
FT                   DVIGESAHLAVLHGRDVLYIVEERAKNRPSLVTDVGVRLPSHLTASGRAILAALPKSQV
FT                   RALYPNAAAFTSRHEVEFPIMKYSALSSHLDQVRQRGYATENGEITPGFGSIAAAVTDH
FT                   VGWPTAAVAVTFLEDKVPAEQWPVLAARIRKAADELSVRIHGRPGQ"
FT   gene            complement(407165..407602)
FT                   /locus_tag="AAur_0397"
FT   CDS_pept        complement(407165..407602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0397"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07561"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U8"
FT                   /protein_id="ABM07561.1"
FT                   /translation="MATFRISTLVAASPEHVFATWTDLDRYPEWIGGVTRVSDLVGSID
FT                   VPGSRYTLWFGRMASPTEILEVERPRHIRTRFGNAILKGESDVRFTAEGEGTRIHQEFV
FT                   TRGFIAGIFGRLFALGSYRGSFRGELETFRKLVERDAPRRG"
FT   gene            407765..409492
FT                   /gene="hutU"
FT                   /locus_tag="AAur_0398"
FT   CDS_pept        407765..409492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="AAur_0398"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="identified by match to protein family HMM PF01175;
FT                   match to protein family HMM TIGR01228"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07258"
FT                   /db_xref="GOA:A1R1U9"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1U9"
FT                   /protein_id="ABM07258.1"
FT                   /translation="MAPADFTSGARPVKAARGTELTAKSWQTEAPLRMLMNNLDPEVAE
FT                   RPDDLVVYGGTGRAARSWAAFDAITRTLETMEKDETLLVQSGKPVGVFRTNEWAPRVLL
FT                   ANSNLVGDWATWPEFRRLEAEGLMMYGQMTAGSWIYIGTQGILQGTYETFAAVGNKLAA
FT                   EGRHPAPAPAGSTEGPLAGTLTLTGGCGGMGGAQPLAVTLNDGACLIVDVDESRLRRRV
FT                   GKRYLDEVETDLDAAIAKVQAAKDERRGWSVGYVGNAAEVFPELLARHQAGEVTFDVVT
FT                   DQTSAHDPLSYLPEGITVAEWHSEAEADPEGFTKKAQASMARQVQAMVEFQDAGAEVFD
FT                   YGNSIRDEARKGGYDRAFEFPGFVPAYIRPLFCEGLGPFRWVALSGDPEDIAVTDKAIK
FT                   ELFPENTHLHKWLDAAAERVEFEGLPARICWLGYGERHKAGLLFNQLVAEGKVKAPIVI
FT                   GRDHLDSGSVASPYRETESMKDGSDAVADWPLLNALTAASSGATWVSIHHGGGVGIGRS
FT                   IHTGQVSVADGTELAAQKLERLLTNDPGMGVIRHADAGYDRALEVANERGVRIPMNEK"
FT   gene            409497..411089
FT                   /gene="hutH"
FT                   /locus_tag="AAur_0399"
FT   CDS_pept        409497..411089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="AAur_0399"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="identified by match to protein family HMM PF00221;
FT                   match to protein family HMM TIGR01225"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08515"
FT                   /db_xref="GOA:A1R1V0"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V0"
FT                   /protein_id="ABM08515.1"
FT                   /translation="MTITSNEQLTVTLGSSGVTPEDVVAVARHDARVTISQEALDNVAK
FT                   VRAHIDDLATSDVPAYGISTGFGALANRHIPNDLRTQLQKSLIRSHAAGMGPAVEREVV
FT                   RGIMFLRAKTLASGRTGVRPVVLQTMVDVLNAGITPLVREFGSLGCSGDLAPLSHCALV
FT                   LMGEGEATGPDGELYGTAGKPAVAELLAQHGIEPVTLAEKEGLALVNGTEGMLGMLLMA
FT                   IADIRLLLATADVTAALSVEALLGTDQVFLPELHAALRPHPGQAASADNMLRVLSNSPI
FT                   VASHRINDTKVQDAYSLRCAPQVAGAVRDTVDHAALVASRELAAAIDNPVVLPDGRVTS
FT                   NGNFHGAPVAYVLDFLAIAVADLSSIAERRTDRMLDPARSHGLPAFLAGDPGVDSGLMI
FT                   AQYTQAGLVSDNKRLAVPASVDSIPSSAMQEDHVSMGWHAARKLRKAVENLRRVLAVEL
FT                   VTSARAIDMRTQMSDGELTPGPAGTAVLEVLREVVQGPGADRFLSPELEAADRLVGSGA
FT                   VRAAAESAVGILA"
FT   gene            411109..411537
FT                   /locus_tag="AAur_0400"
FT   CDS_pept        411109..411537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0400"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08120"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V1"
FT                   /protein_id="ABM08120.1"
FT                   /translation="MMGIFVTPRSLFATQAPGRGKCSRTYGVRHVHANDVVGLTVNRSN
FT                   NSIHNREHPQRGRSSMKARGAVLSRRSAHTATVTDWKTLKVGERVEVVKYAHVIAAGRI
FT                   EEISSSGNVVWLEHAGPGVTEEGKELFMKSDGVTLRRA"
FT   gene            complement(411642..411863)
FT                   /locus_tag="AAur_0401"
FT   CDS_pept        complement(411642..411863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08253"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V2"
FT                   /protein_id="ABM08253.1"
FT                   /translation="MTPAMIAEREIRLSFSKADEIHDGLDRAVDALIANAAADTNCGIL
FT                   VTRHEPGTYTVALDESVPFGQTHEVLAA"
FT   gene            complement(411966..416849)
FT                   /pseudo
FT                   /locus_tag="AAur_0402"
FT                   /note="putative NAD-glutamate dehydrogenase; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF05088"
FT   gene            complement(416976..417046)
FT                   /locus_tag="AAur_0403"
FT   tRNA            complement(416976..417046)
FT                   /locus_tag="AAur_0403"
FT                   /product="tRNA-Cys"
FT   gene            complement(417236..417727)
FT                   /locus_tag="AAur_0404"
FT   CDS_pept        complement(417236..417727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08823"
FT                   /db_xref="GOA:A1R1V3"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V3"
FT                   /protein_id="ABM08823.1"
FT                   /translation="MRTPLVQEKLAWVAGLAAVALGLAAHMVAGGSAPAIPVLLCLAAL
FT                   GCLAAQLLARWVHGPLLLLLLSGVAQQLLHLGFDAFGGYFPGSGILDHLHGGQATSPAA
FT                   GAPANGAAPSGGSVHLMLYTHMAAAILTLLVASGVFKVAGLRSRRREGTDPALVRDSRP
FT                   "
FT   gene            complement(417789..418736)
FT                   /gene="hutG"
FT                   /locus_tag="AAur_0405"
FT   CDS_pept        complement(417789..418736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="AAur_0405"
FT                   /product="formimidoylglutamase"
FT                   /EC_number="3.5.3.8"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01227"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08657"
FT                   /db_xref="GOA:A1R1V4"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V4"
FT                   /protein_id="ABM08657.1"
FT                   /translation="METTPLTVDVSPTPWTGRFDGEGNEHRRWWQAVAPHTVCAAAEAS
FT                   RPAVVLGFCSDAGVLRNKGRVGAAAAPAAIRSALGPLAFHLDRDVFDAGDVVVEDDSLE
FT                   AGQERAGLAISGLLDAGNLTVVLGGGHETAFASYLGVAGSEAVRGKRLGVLNLDAHFDL
FT                   RDEPTPSSGTPFLQMAHAEAAAGRELQYAVVGISEPNNTRTLFNTARDLGVKYLLDELC
FT                   TPEAAEVFVADFLAGVDVLYLTIDLDVMPASVAPGVSAPAAYGVPLPVISAICRQVAAS
FT                   GKLLHLDVAELNPEFDIDSRTAKVAARLVNTLLA"
FT   gene            complement(418836..420278)
FT                   /locus_tag="AAur_0406"
FT   CDS_pept        complement(418836..420278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0406"
FT                   /product="putative xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09755"
FT                   /db_xref="GOA:A1R1V5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V5"
FT                   /protein_id="ABM09755.1"
FT                   /translation="MLKQGSAVDRYFKISERGSTYSREIRGGFATFFAMSYIVVLNPLI
FT                   LSGPDSSGASLGFTAVAATTAFVAGILTILMGAWAKHPFAVATGLGVNAFVAVTVASHP
FT                   GLTWPDMMGLVVLSGITMLILVLTGFRTAVFKAVPEALKTAIVVGIGLFIALIGLVNAG
FT                   FVRRIPDAAGTTVPLGLGVDGKLMGWPTLVFAVGLILTIALVVRKVRGAILIGIVVSTA
FT                   LAAILEFTLHIGPSFDGTNVNPRGWSLVAPTLTEWGAPDLSLIGKANPLGAFEHLGFIA
FT                   AALLAFVILLSIFFDAMGTMVGLANEAGTVDEDGNIPNVDRVLQVDALGAIVGGGASVS
FT                   SNQIFVESGAGIGEGARTGLASIVTGALFLVAMFFTPLINLVPFEAVAPALVVVGFMMV
FT                   SQVGKIDWQDWGVGIPAFLTIALMPFTYSIANGLGAGFISYVLIRTFQGRAREVHPLMW
FT                   AVAAAFLLFFGIGTVEELLGVK"
FT   gene            420393..421025
FT                   /locus_tag="AAur_0407"
FT   CDS_pept        420393..421025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0407"
FT                   /product="putative copper resistance protein, CopC family"
FT                   /note="identified by match to protein family HMM PF04234"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06819"
FT                   /db_xref="GOA:A1R1V6"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V6"
FT                   /protein_id="ABM06819.1"
FT                   /translation="MRTIRPLLAAVVAALAFASALLFSAAPASAHDVAESTAPANGASV
FT                   AEVPASVSITFNNRPLAIGSGVTVTAGGENWADGPVEIIDNQAVQKLREGAPAGEYTVV
FT                   WRVVSSDSHPIEGTFTFTAAAGSTTTASGPAGASPSASAPSAAVPTAGTAAPGTGASEP
FT                   AADASQPFPWSIVGLAVVAVGLVIYLAVTARKKLAASNDPEGDTPAE"
FT   gene            421371..422165
FT                   /locus_tag="AAur_0408"
FT   CDS_pept        421371..422165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06374"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V7"
FT                   /protein_id="ABM06374.1"
FT                   /translation="MSSRILRGRRKADSVRPNPFISISKAVASNASGAGRQAAVIAAAS
FT                   GLVLTGSIAAHAAEAPVQRDSSPATVAETVSEAPTKVVTALATATVNFERPAVASVAAP
FT                   VIEKPAPVVEAPVVQKAAVTTAAATAPVAAQAAVAAPVAAAPVAAAPVAAAPAVGGVNA
FT                   AMVASAYAQIGIFQDCTAMVEKALGSAGIPVGDLGPMQFMNYGKVVSDPQPGDMIVQSG
FT                   HVAIYIGNGQAISGGINGNQTGIHPISWLTATGPLTYVRAGA"
FT   gene            complement(422392..423474)
FT                   /locus_tag="AAur_0409"
FT   CDS_pept        complement(422392..423474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0409"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09842"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V8"
FT                   /protein_id="ABM09842.1"
FT                   /translation="MFRLFCQRFSSSDCLTVSLSMAGAGETRKFLLPIPTILGRQWRIK
FT                   ATSGYVHNGPGSVPDPPHCAPDEHTKRGVAEAIHGRKSSVVFESPNGRRTCFTPHTPAI
FT                   YLRPLGELGRDPTRCRKAHTSRRNQAVSLTPDSATERTTTVVIGAGLSGLAVASELSRF
FT                   GVGSIVVDGFGALSTTGPSVHTGMLQRTDAADPAAMQERNEILRHLRNYAANHHLDVRN
FT                   TTRAVRLDFLGADPSRQIGYGLAASMTTAGLRTGLHVSGPLESTPRQWAVHTANGVLLA
FT                   DHVVVTRCAQSQLRRMLAELGIAVGQNFAAAMRAVGMHLVGVGDLITPSPKEVLRQAKA
FT                   VGQAISTKVALPAGPGIAIA"
FT   gene            423503..424540
FT                   /locus_tag="AAur_0410"
FT   CDS_pept        423503..424540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0410"
FT                   /product="putative universal stress family domain protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08912"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1V9"
FT                   /protein_id="ABM08912.1"
FT                   /translation="MDQHGRHSEEPQDGQDQAVEPGGIVVGVDGSEHGQCALVWAAREA
FT                   ERRRLPLHIVTAYSVPIFAASGLDGGYATVDDSVIREGADAIVRQALDKVSGYAIDVDA
FT                   SVENGDAAGVLLDLSSEAALLVFGSRGRGGFVGRLLGSVSSALPAHAKCPTVTVPLYCA
FT                   DRLGESTEDKHIRAEHAKAGPRTVENVVAVGVDGSEQARVAVLEAAEQAQRMGAKLRVI
FT                   CAVPQYSGSLAWVPAPLDRDALFADIKVQLDAGADWLRSHFPSLPMETELRDGSPVDVL
FT                   VETSRSVELVVLGTRGRGGFAGMLLGSTSDGVLHHSKGPVMVVPDRDDPRLADRHKFGP
FT                   MLGAA"
FT   gene            424482..427283
FT                   /locus_tag="AAur_0411"
FT   CDS_pept        424482..427283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0411"
FT                   /product="pyruvate phosphate dikinase, PEP/pyruvate binding
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF01326"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07319"
FT                   /db_xref="GOA:A1R1W0"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W0"
FT                   /protein_id="ABM07319.1"
FT                   /translation="MTIPGSLTATSLGLCSALLKPDPVTSMDKKQPGEPSQDPVLVLDI
FT                   AAIRGPMLPEVGGKAANLGELASVGLPVPRGFCLTTAAYRQALSGVGLEPVFAALEEAS
FT                   ASAMDQLSGLAARARSLVIEAGVPAEIAEAVRSAYQDLGANVPVAVRSSATAEDLPFAS
FT                   FAGQQDTFLNVVGVDAVLDAVSRCWASLWTDRAVAYRTTNVIDHATVALAVVVQEMVNS
FT                   ATAGVMFTANPVTGNRYETVIDASPGLGEAVVSGAVNPDHYVVNARRGAVLTRVLGDRQ
FT                   VEIRAMPGGGTERVERPLPADSAVEPCLSDRQVLELAKLGLAVQEHYRAPQDTEWAIDD
FT                   DGKLWLTQARPITTLYPQTTRTPPAPGEHAFLNFSLAQGLTRPLTPMGLAGIRLIASSV
FT                   AKTAAFDVPDPRSGPPAYYEAGQRIFFDFSAVLRSRVGRTIVPRVFDVMEARSAAIMRG
FT                   LFDDPRFTVTIKTPIKLTRHVAPVAAKYRVPESLFRGLFRPAKAMRRVERLSTELRSTF
FT                   SVPSEATPHQRLGHVQRILGEEVFATVPQVLPLPALGFAMLALVRRILGDQAPYSELQT
FT                   VIRGLPNNVTTEMDLALWQVASEIREDPDAVASMVRHTAAELVEQYRDARLPPVAQAGL
FT                   ERFLRKYGHRAVAEIDLGMPRWSDDPTHILGVIANYLRLSDGAEAPDQQFTQAALDADE
FT                   QVARFVARARAKSPLHAVIVRLALDRTRRFAGLRELPKYNLVLGLSAARKQLLLIGDEL
FT                   VAAQRIERPEDIFFLDLDDVEIALAGDDVHEVVAERRAAYLQELRRKHIPRVLLSDGTE
FT                   PEATPGRNEGKQRPGTLSGSPASAGLVSAPARVIMDPVGAHLEPGEILVAPSTDPGWTP
FT                   LFLTAGGLVMEMGGANSHGAVVAREYGIPAVVGVPDATSRIRTGQRITVDGAAGTVSIE
FT                   NSG"
FT   gene            complement(427294..428214)
FT                   /gene="czc"
FT                   /locus_tag="AAur_0412"
FT   CDS_pept        complement(427294..428214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czc"
FT                   /locus_tag="AAur_0412"
FT                   /product="cobalt-zinc-cadmium efflux permease"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08086"
FT                   /db_xref="GOA:A1R1W1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W1"
FT                   /protein_id="ABM08086.1"
FT                   /translation="MGHDHNHSHGVTATGKHRKRLIAVLAITLGVVGIQVIGAVVSGSL
FT                   ALLADAGHMLSDAAGVFIALMAAWIATRPASDQRTYGYQRAEVLAALANALILIVIAVV
FT                   IMIEAIRRFGEPTEIQTDVMLWAAILGAVANLVSLLILQGAQKESLNVRGAYLEVLGDL
FT                   LGSIAVIVAAVVIMTTGFSAADPLASVLIALMIIPRAWHLLRDVVDVLLEATPKGVDVN
FT                   MIREHIVAVDGVVDAHDIHIWTITSGVPVFSAHVVVEDAVLSASGADNILDQLGSCLGR
FT                   HFDTEHCTFQLEPVSHSEHESHQHA"
FT   gene            complement(428225..428725)
FT                   /locus_tag="AAur_0413"
FT   CDS_pept        complement(428225..428725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0413"
FT                   /product="putative domain of unknown function (DUF1025)"
FT                   /note="identified by match to protein family HMM PF06262"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06410"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W2"
FT                   /protein_id="ABM06410.1"
FT                   /translation="MPANLPPGLPIVPDGERPSSPLRERNAVHSPAEHAPADEAYVSGP
FT                   YEMSPEDFEEAVSDALQLIPPKAASAMDNVAIFIEDDYTPQPGEDPDTVLLGLYEGVPL
FT                   TERDSWWEAGSLPDRITIFRQPILNICSTREEVIDEVAITVVHEIAHHFGIDDDRLHEL
FT                   GWG"
FT   gene            428817..429740
FT                   /locus_tag="AAur_0414"
FT   CDS_pept        428817..429740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0414"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09630"
FT                   /db_xref="GOA:A1R1W3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W3"
FT                   /protein_id="ABM09630.1"
FT                   /translation="MTGTASHAPEPLDVVVVGEALIDIVQSADGQKEFPGGSPANVAYG
FT                   LGLLDVKTGLLTAIGRDERGDAIAAHLQRAGVVLLPGSMSAGKTATATARITADGSADY
FT                   TFDIDWALAPLALPYAPRILHTGSIATFLEPGASVVRSLLEQAQGGCMVTYDPNIRPDL
FT                   LGSHHEALSLFEEMVPLTDVVKMSGSDARWLYPGKSLEETANHLLALGTGLAVVTQGVR
FT                   GALMATRDIHINVPAVPATVADTIGAGDSFTAALIMGLLLRGSDGMAPTVLERIGTIAS
FT                   MAASIAVGRSGANPPTHRELLVGMAR"
FT   gene            complement(429761..430702)
FT                   /locus_tag="AAur_0415"
FT   CDS_pept        complement(429761..430702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0415"
FT                   /product="putative Integral membrane protein DUF6"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10117"
FT                   /db_xref="GOA:A1R1W4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W4"
FT                   /protein_id="ABM10117.1"
FT                   /translation="MTTTTPAEPGQPSPDLPPRTTPAPGATISKLGIAAVIITVVLWAS
FT                   AFVGIRAVGPSFSPGSLTLGRLAVAAVVLGIVVLPTLKVWPSGREWLPIVAYGVMWFGG
FT                   YNVALNAAEHMLDAGTSAMLINVSPILIAILAGVFLKEGFPRWLLIGSGVAFCGVAMIA
FT                   LGSGQRSTADVAGVLLCLLAAVLASVSAILQKPVLRKFTAGQATWFGIMVGAICCLPWT
FT                   GQLISEVQAAPLPATLGLVYLGIFPTAIAFTTWAYALSLISAGKLAATTYLVPGTTILI
FT                   SWAVLQEVPTIWGLIGGVICLVGVGLTRRRTR"
FT   gene            430950..431022
FT                   /locus_tag="AAur_0416"
FT   tRNA            430950..431022
FT                   /locus_tag="AAur_0416"
FT                   /product="tRNA-Glu"
FT   gene            431107..431180
FT                   /locus_tag="AAur_0417"
FT   tRNA            431107..431180
FT                   /locus_tag="AAur_0417"
FT                   /product="tRNA-Asp"
FT   gene            431227..431302
FT                   /locus_tag="AAur_0418"
FT   tRNA            431227..431302
FT                   /locus_tag="AAur_0418"
FT                   /product="tRNA-Phe"
FT   gene            complement(431374..432000)
FT                   /locus_tag="AAur_0419"
FT   CDS_pept        complement(431374..432000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0419"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09650"
FT                   /db_xref="GOA:A1R1W5"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W5"
FT                   /protein_id="ABM09650.1"
FT                   /translation="MELPANASGMVQRDRHNILGGRTISQPPNHVTAPPGWYADPAGTM
FT                   RLQWWDGAAWTGQFADVPAEGSKGRPLLPPRTPTSTPFLWALLGLSALFLILDIVVKSL
FT                   HGYAIGPDGAQLADPDLELSLGDLIVGGVAWPTCAANVVMAYLDWRRLKRLGVVRPFHW
FT                   AWGFLPTIYVIGRTVVVRKEVPGSSIAPIMIAVGLSIVSVATNYS"
FT   gene            432246..432848
FT                   /locus_tag="AAur_0420"
FT   CDS_pept        432246..432848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0420"
FT                   /product="site-specific recombinase, resolvase family"
FT                   /note="identified by match to protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08713"
FT                   /db_xref="GOA:A1R1W6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W6"
FT                   /protein_id="ABM08713.1"
FT                   /translation="MRMLGYTRVSTAAQDARLQLDSLLSAGVQRRDIFSDVTSGSRDAV
FT                   KRPGMKKLLDYAEAGDTLVVWRVDRLGRSLIDVLNTVNLLQGWGVGLRSISDGIDPATS
FT                   TGRLMLNMLATLADYERELITERVNAGIAAAKANGTRFGRPLGDPSVIASKLQIVQQER
FT                   AKGRTAAEAAKLVGWSRATLYRHQQAVQGVATATQDF"
FT   gene            complement(432923..433372)
FT                   /locus_tag="AAur_0421"
FT   CDS_pept        complement(432923..433372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0421"
FT                   /product="putative histidine triad protein (HIT domain)"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09286"
FT                   /db_xref="GOA:A1R1W7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W7"
FT                   /protein_id="ABM09286.1"
FT                   /translation="MTDTHIDLPQDQPCAFCDYLSGRRAFTVLGRNNIIAVLVTREQRG
FT                   MGHVLVVPTRHYPTLLEATTAERHALIDTVSACAEAIDAAYERPGIAVWQNNGTAAHQA
FT                   IGHLHFHVAGTLPGGGTDFGEVTEVPVKQTDAIAQRLQEAGFSLT"
FT   gene            complement(433369..434145)
FT                   /locus_tag="AAur_0422"
FT   CDS_pept        complement(433369..434145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09581"
FT                   /db_xref="GOA:A1R1W8"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W8"
FT                   /protein_id="ABM09581.1"
FT                   /translation="MGFFAVPIGILAPLAPQWWDGKWWLVLGVLAVAVGWTALGLRRKE
FT                   PNQRYRENVTIRLVVGDLFIQDASPVIGMTATFDTRVPEVIAPTSVQGHFLKRIYDGSQ
FT                   ERLDADLDHALANVKPEGMIAKPGKQTVYPLGTVATLSPPGRLRYYCAAYTRMDEKNRA
FT                   SGTIRSVLDSLDNSWEEADVHGNGDPICVPVIGQGQSRIPELTPEISIRLIAFSFLLRS
FT                   KKSRFASELRIVVHPSERDKINFPEFQAFLTSLAAS"
FT   gene            complement(434214..434723)
FT                   /locus_tag="AAur_0423"
FT   CDS_pept        complement(434214..434723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10182"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1W9"
FT                   /protein_id="ABM10182.1"
FT                   /translation="MSYRNKTYVAFASEDIKSYRLMEAWRENKNIAFDFYDAHDLFISR
FT                   DTSRPETIKKNLRERMKNAKQIVLLGSPDAKRKGGDGVSFLAYEIQIALEFNLPVVVAH
FT                   LDGSRGGNSANYPKPLSDANHYTMSVSFQPTIIKHALENYAGSFATSKTTGERIYLASV
FT                   YSGLGL"
FT   gene            complement(435453..435581)
FT                   /locus_tag="AAur_0424"
FT   CDS_pept        complement(435453..435581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0424"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06923"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X0"
FT                   /protein_id="ABM06923.1"
FT                   /translation="MAPPEKALAVGEDSAMAKRIRGPTAAIYKKTGSASVIQSAFS"
FT   gene            complement(435629..436999)
FT                   /locus_tag="AAur_0425"
FT   CDS_pept        complement(435629..436999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07493"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X1"
FT                   /protein_id="ABM07493.1"
FT                   /translation="MPSFGRSVSTFRLCWIYARLACQQTKILVPGMMIPAPEHLKLCAI
FT                   AHRPTGAINLPSTRMSDDEPMGKKSRRPSRQNRNTPGAPRAGLTVTVGASPRMKSSGQP
FT                   SLDNELRLLRSSLLYADHVDLVAPSAAWLGTFSPLLEMNPGDPMSVIADLPSDTLQRLG
FT                   VEDVTLREFRRALRNLAGKPDGDPQRLEGEKLWRPAITKLRQQAEEVFDSAEARELEMA
FT                   LGTGSVTMISDGTRLEDNTEQQVAWFRDRLTLALRDPSSTVLLDQVTTDFLRESEEYVN
FT                   GLPAVADSRFRRAAVGAGLVERLPTFPESPMSDVLEAREELAEGRAKYRTSVKELSGKL
FT                   QSSALDATLPSEIDQMWHDDVRPRLEDLRKTVSKTRMAKDAGKRILTEGYGIPSILVAV
FT                   ASFSDLAAALPTPAAATAAAVRIAAAGAQEAFQARSAVRKHDLVYLLDLDKKLGKTR"
FT   gene            complement(436915..437823)
FT                   /locus_tag="AAur_0426"
FT   CDS_pept        complement(436915..437823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07896"
FT                   /db_xref="GOA:A1R1X2"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X2"
FT                   /protein_id="ABM07896.1"
FT                   /translation="MDVELHFRPSSSLTSFDMFLKGDIGAAVPPEQAGDLMIGFCGAMK
FT                   DVQLRRASDGEELTFDSPIAPSDKDLFVGSVGLDFSLNNDCVMTVVSKRDFKDQTLGEA
FT                   GVGWAVSLEGETTAPTEAVAGAQHRYAFPRIATLTLPVEILNIESVTAESVVSITPNDL
FT                   PADYVPTVSSPEVEDPTAPTWSLPLQSADRAAGFELNGIDKRHEAAVQRDLFLASASAG
FT                   TAGGGLIWFFGAAGPFVDALLRKFRRNEAPFIEEAGELTPPPASGDDVRDSPTCRHLVA
FT                   ASLLSGFVGSTLAWLVSRRKS"
FT   gene            complement(439721..440833)
FT                   /locus_tag="AAur_0427"
FT   CDS_pept        complement(439721..440833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0427"
FT                   /product="putative protein of unknown function (DUF1526)"
FT                   /note="identified by match to protein family HMM PF07512"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08373"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X3"
FT                   /protein_id="ABM08373.1"
FT                   /translation="MSLQSSPEDIHGWFSEARMRPYLLEADGDHKTAINLYKWNAELSA
FT                   ACFEVMSHLEVLIRNALDECLQDYMKEQACGIPWFLMPINSGPTQTSISASIDATRLRL
FT                   RAQKKEIRPQIIANLSFGFWTNLLGTPHEELWRHALHSAFPQSSGKRKDVAAACNNLRL
FT                   FRNRLAHPDSLLAVDVPFQLRKMLLVAGWIDPDARPWLESVERVSSVYSRRPTKKFDTV
FT                   VIPGSQAWDLYQKEHVYVCQAGRSFRQVDRMGFYADKAVKAEVPFITHRVDNVDWSIAE
FT                   QQRLLASAKSDEKRMGKIMKVARDLGWTAGRYQVFLLSRAGDPRHRTLRKELNHQTSGR
FT                   GTAFVQKQRYVSLHDLEIATTTADLPGKKT"
FT   gene            441348..441548
FT                   /locus_tag="AAur_0429"
FT   CDS_pept        441348..441548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09290"
FT                   /db_xref="GOA:A1R1X4"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X4"
FT                   /protein_id="ABM09290.1"
FT                   /translation="MLDRLGPGDETVVWKLDRLGHNTGHLLEFLDHTSPWVRQGLNRSP
FT                   RLITPCGNPQHWVAVSSDFSL"
FT   gene            complement(441538..442263)
FT                   /locus_tag="AAur_0428"
FT   CDS_pept        complement(441538..442263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0428"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07308"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X5"
FT                   /protein_id="ABM07308.1"
FT                   /translation="MNSKVSGRQLVVTAIAVAFACSSCSPAAPSPTASNDFALPAVSSS
FT                   QKPSSKPSPTFTDGPRAGCVLSPEELKAALGEIVGPGAIVINDEYTGQSQHTGTNVCSY
FT                   TLPAGSLTKKGSGGKVISGGDEASFTISRYTYASNYKGSMGVYNVHREYGGSTAEEIID
FT                   SWFIAERDTKEAQRGSKAADLVKKVPDIGSGAVSDGEGEIIVTTAGRYWFDAGISGVVA
FT                   SQAYEAGALAVARLLAAKG"
FT   gene            complement(442486..444885)
FT                   /locus_tag="AAur_0430"
FT   CDS_pept        complement(442486..444885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07962"
FT                   /db_xref="GOA:A1R1X6"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X6"
FT                   /protein_id="ABM07962.1"
FT                   /translation="MNNRLSHLLIKLLAFVSCVLLTVVLAGLGVLSPREAEAAPAPGVT
FT                   CHPLSILAFRGSGEKNIDSSVKDPAGSSHDYGDGVVTNGWEGQTLSRLVVSYIRQLKTM
FT                   AGNGVAPSAVPIYGVGPTNDNELGYSAVNALTEAYLNVMNSALDGTDTALKLADTLRAQ
FT                   AKIDGCPAPKFILIGYSQGAQSARHFAGHSDVVGVLNLGDPEQSPFAVGNQGTGAKGEG
FT                   AMRFKYPGLKSVFDIYDSNTQVDKIALCHKLDPICDFELKHLGNLFTAEQHTNYFLEPA
FT                   ETDEYGRKLAEMVSKHYTAASTAKPEASRVGLDTMIAIDTTSSMTPYLKAAIASADAIA
FT                   QRSLTAAKQARVGLVEYRDHSVDSFGARTVVPLTNDYALFKAALSSLKASGGGDTPEDV
FT                   YSGIVTALGADWNPLAARSIVVIGDAAPHDPESGTCYTAEQVTRLLAGFTLVSSVPAPN
FT                   AGGSKGSSSSSCAKTSTSPSAAPSSKPDHMSLPAEGTAASPSPDSLPSPIASVPMAESP
FT                   DPVLGDPVALYGLSGSDRFASVLKQVAQDTGGQILDTKEAATAGDKILAAMDDAASAPE
FT                   AAVKTDSVSSVGSKAVISAAASRVEKGSLKYEFDVDGDGVFETQTESPTVTGTFEKAGD
FT                   IKVAVRVTGDKDRRSVASQTVRVLPAEAAAPAYSEASTRLANVHVSPLAAGPGTKRMIE
FT                   VPDVQAGEEVSALLVSPQREDAFAQEAPFATASGAGGKFELEVPEALPSGVYKVLILTN
FT                   HGRHATADITVDSPWAVWIFWGPIAVLGLLILGGAVWLRRRRREPK"
FT   gene            complement(444985..445212)
FT                   /locus_tag="AAur_0431"
FT   CDS_pept        complement(444985..445212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0431"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07294"
FT                   /db_xref="GOA:A1R1X7"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X7"
FT                   /protein_id="ABM07294.1"
FT                   /translation="MSDEELTKAINDAVRPQKPRPRYALGTFWLLVGIVVLIAAFVAKT
FT                   PGHQNGFWAGPLLIGYAIYLYRGGRFGFFI"
FT   gene            complement(445253..445579)
FT                   /locus_tag="AAur_0432"
FT   CDS_pept        complement(445253..445579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0432"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07727"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X8"
FT                   /protein_id="ABM07727.1"
FT                   /translation="MNAFCRPEHPVVMVLAAVMAVGIMAGCSNPGTATCDEYASQPYSE
FT                   RKKTVKALLEAHNLETISVSNTLGLQQALSKYCGVYGFNTTDKAGSNGSSPIDKAVNWA
FT                   SEKW"
FT   gene            complement(445612..446358)
FT                   /locus_tag="AAur_0433"
FT   CDS_pept        complement(445612..446358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0433"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07139"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1X9"
FT                   /protein_id="ABM07139.1"
FT                   /translation="MFYNPLSIIEPSEPVSFAYPSITEDLALVWDGLDGHINGPFYATG
FT                   ADVQILDPSRNQFRQLAEIKDVRIECYMTEARLAMVCRKYDKGGGWAGGPSALVLNAGS
FT                   KIMAANRRRGKALAGHLRYPWVSKVLFHNRRGFFDSEILRLIYQSEGATMYLELTLDSS
FT                   FNSGAVAYEIVQRTLYYRQADRAPISDEDSQAMIALASQGPVLPADKESMAKYTIPASS
FT                   PAGSGAQFSPSAPPSAIAKQLKPPTA"
FT   gene            complement(446642..447634)
FT                   /locus_tag="AAur_0434"
FT   CDS_pept        complement(446642..447634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0434"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06520"
FT                   /db_xref="GOA:A1R1Y0"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y0"
FT                   /protein_id="ABM06520.1"
FT                   /translation="MVQAISIRFMIVLCCAFAVLHVVLGIANLDMVASIWPPIIAMLVY
FT                   LGAVVLALWPGPGRLNSPSAFLILLAVVLMTLLVNSVLPLDTWPGYASWHMAATYTLLV
FT                   VMNLRRRVALSWCGAAVSLVLTTWWASETYLGIVGGLMLNVATVGWLTIATLIGRLLGA
FT                   NDRQVAEYSADALAAADWYATERAMNVSRTQWIQHVQEIAGPALARIAERDRQLSANDR
FT                   KEFLLIEAQFRDEIRGRVLATEEVLEAARRARERGVTVRLLDDRRQELAPRLLAAVSER
FT                   VVSILNQAPGGTVTARARPEGGATAVTILSLDNDQAVPTLVEFPDTRAR"
FT   gene            complement(447634..448824)
FT                   /locus_tag="AAur_0435"
FT   CDS_pept        complement(447634..448824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0435"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09997"
FT                   /db_xref="GOA:A1R1Y1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y1"
FT                   /protein_id="ABM09997.1"
FT                   /translation="MVPIPNGVSAKETHKLMGRGIAAFALLLLLQVSGSIVTQSGLAAP
FT                   WWNAMFLWLLLTGIGCFSVASIRGRGLRWTSSILSLLVLAGLLLWPAAVPTTVPVDIGT
FT                   PWLWAMINVGAAWSAFAFGTLPGCVYTVVIGSVFAVVRTLPQSGSASPSTAIQDASFST
FT                   VLGIIICLTIGILRQASERVDTAAENAINRYREAAAETALSNERTRVDGLLHDSVMSAL
FT                   LTASRSGSSLERLSSAELARSALARLGEHEIKQTDATTVSVSELASRIRFTVQDDGDTP
FT                   TVTVTGEGSTSLLLSGQVVRALFEASTEAVANAVRHSNATRCEVRVLGQDPKGIARVVV
FT                   SVKDNGDGFRQELVSDRRLGIKVSIIGRMRTIGGTADISSHPGKGTEVILTWAGEA"
FT   gene            complement(448830..449519)
FT                   /locus_tag="AAur_0436"
FT   CDS_pept        complement(448830..449519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0436"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09482"
FT                   /db_xref="GOA:A1R1Y2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y2"
FT                   /protein_id="ABM09482.1"
FT                   /translation="MSSGAVLAGIIDDHETTMIGLVGAINRYSDLGDPPVKLVRMATTV
FT                   DAFMHADRRVCHVVALDMQLADGSAPAENTAKLVAAGYRVLVFSAGNNVRHLQQALANG
FT                   AKGVSLKVEPVITTVDKLRRVAAGETIPSLDLAAAIEADTCFVEANLSDREAECLALYA
FT                   TGYALTQVATQMNVQESTVKKYVDRIREKYEHLGRPAGTKIDLLKRAVEDGLLPPIMPL
FT                   KKPQNDR"
FT   gene            complement(450956..451522)
FT                   /locus_tag="AAur_0437"
FT   CDS_pept        complement(450956..451522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0437"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08911"
FT                   /db_xref="GOA:A1R1Y3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y3"
FT                   /protein_id="ABM08911.1"
FT                   /translation="MPRTLLERSDAVHALAGVFRRRGFESSSLSVIQQEAGIGRGSLYH
FT                   FFPDGKTDMARAVLDQVSDWFEDEVFAPLRSATDAADAVSAMTKAVSDYFVSRENVCLF
FT                   AAMTLGEEKETFAGEVKTYFADWVDALAALLHRGGLDLEDAHENALDAVAVIQGGLIIT
FT                   RAYADETTFLGVMERVERRLLSQLS"
FT   gene            complement(451522..451989)
FT                   /locus_tag="AAur_0438"
FT   CDS_pept        complement(451522..451989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0438"
FT                   /product="putative protein of unknown function (DUF1348)"
FT                   /note="identified by match to protein family HMM PF07080"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08318"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y4"
FT                   /protein_id="ABM08318.1"
FT                   /translation="MSRPPFPPYTEATAIQKVRAAEDGWNTRDPERISLAYSENSWWRN
FT                   RSTFVQGRAAIVEFLAGKWERELDYRLIKELWAYTDDVIAVRFAYEYHDAAGQWFRAYG
FT                   NENWHFDKEGLMTHRHASINDLAIDEADRKFFWDTSRPRPADHPGLSDLGL"
FT   gene            complement(452555..453196)
FT                   /locus_tag="AAur_0439"
FT   CDS_pept        complement(452555..453196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0439"
FT                   /product="putative Rhs family protein"
FT                   /note="identified by match to protein family HMM PF05593;
FT                   match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06448"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y5"
FT                   /protein_id="ABM06448.1"
FT                   /translation="MGGSWVVFTPSGPGVYTAPSHVLAKLVKNVDGTWTYFRRSKEIFT
FT                   FEVTGKLASIEDLNGDAVALVWDTSGKLATVTDDGGRAITFTYGSNGKVATATDPANRV
FT                   MSYGYDAAGRLETVTLPGNRTTTYIYDASYLITSMTDPRGSVTVNTYDQASRVTKLQAP
FT                   PVTAADVPVVQEASSDPLIPAITTVPASGSRQRFTPGSSGLHRKTAPALS"
FT   gene            453353..454354
FT                   /locus_tag="AAur_0440"
FT   CDS_pept        453353..454354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0440"
FT                   /product="putative SIS domain protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07361"
FT                   /db_xref="GOA:A1R1Y6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="InterPro:IPR035488"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y6"
FT                   /protein_id="ABM07361.1"
FT                   /translation="MLGFKEEEFLTQTRSALALQGQIESVVDSIQQRGLTNLFLIGAGG
FT                   TYAAMLPYEHFIRSRSTLPVRASIGKELMLTDDPTFGPGSVAVFASVSGTTEDVIEAIE
FT                   FAKAKGAYTIGFTGFGDSPFAKALDVAMVTEPKTWPFDIPMILLSTRLLAARGEFEGYE
FT                   ELAAELQTVPENLVGVARQAESVAEAFAEKNKDADYHFLVGTGNLWGLTYLYSMCILEE
FT                   MQWLRTTRVHGAEFFHGSLELIEEDTSLMLLLGEDETRPLMDRVAKFAENYNKNTTLLD
FT                   SKDYDLPGVSPRFRALLAPLILDTVLDRFSKHLERVRNHSLDLRRYYRVVEY"
FT   gene            454440..455324
FT                   /locus_tag="AAur_0441"
FT   CDS_pept        454440..455324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0441"
FT                   /product="putative sugar kinase"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06888"
FT                   /db_xref="GOA:A1R1Y7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y7"
FT                   /protein_id="ABM06888.1"
FT                   /translation="MKVIGFGDNIVDRFLDRKVMYPGGNCVNVAVFARRLGAESAYLGV
FT                   FGSDPLGAFVRDAIDAEGVDTSQCIIRDGLNGVTEIKVVDGDRIFLGWNDGGVTTSDPF
FT                   MLEEEHLTYLASADLVHSSVYSASEDQLPAVRTTKTLVSFDYSSEPERRTDSYLTRTAP
FT                   NVDLALLSCGNMTVAAVENDLKRVHAAGVSLAVGTRGQSGAMMYDGERFLTQAAAPTDP
FT                   LRFADTMGCGDAFLAGLVVSLLGSGWSRAYRPPADALQKALARGAESAAAQCYVEGAFG
FT                   YGRAVEVAAGQSR"
FT   gene            455399..456505
FT                   /locus_tag="AAur_0442"
FT   CDS_pept        455399..456505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0442"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06440"
FT                   /db_xref="GOA:A1R1Y8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y8"
FT                   /protein_id="ABM06440.1"
FT                   /translation="MATDHQNHPAAPTITEVAAAAGVGRATVARTLGNYGSVSEATRAK
FT                   VMRAAEKLGYQPNTLARSMTTGVTKTLGIVLADVANPFFSGVLKGISETAKTAGYDAII
FT                   LSTDEKLELERDAIAVLLAKQVDGLVVASAAGRSDDVSHLSNAIDRGTPVVLIDRLVDK
FT                   LETDSVVIDNREAARSAVASLIHNGHRRIAFAWGPVTLSPATDLKQMHSILDEALWSDG
FT                   ERLRGYLDALEEAGIPFDTALITHVLKNEGQATRAVSGMLALADPPTAIFTTETEATVG
FT                   ALHSLRAKNLRLLKDVSLIGFDDSPWAAVMDPPLTMIQQPMRQMGAVASQQLIARIDGD
FT                   TSAPKKHVLPSQLVARSSDGPVRAARGE"
FT   gene            456722..458044
FT                   /locus_tag="AAur_0443"
FT   CDS_pept        456722..458044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0443"
FT                   /product="putative extracellular sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09603"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Y9"
FT                   /protein_id="ABM09603.1"
FT                   /translation="MRKNTQSLMALLAGAALALTGCADGGSQPAAVLDPNAEPQYAGTL
FT                   SILTKFGGDPLEPYFEDLAAEYKKLHPEVSFDLIQETDQSIKDKTKTLTASQAMPDIYF
FT                   TWAGSWANNFIDGGLAADLTPVIAPGTEWGNNFGEPALKAFAKDGKYFAVPLYNNGKFM
FT                   GYNQRIFKELGLTPPSTFDDLISSCSVLKGAGYEPISFGNKDGWPGLHYLQQLFAYEVP
FT                   ADTLQADFSPATAKLEDKGYLKAMDQFTRLVNECTGSGKDSNGVLYTTAQQALAEGKSG
FT                   MYYQEILEFDSTASADSKLKQDGLGIFKLPAAADAKGDTQAIEGSPEGYIINARSKNAA
FT                   LAADFMKFVTNTQNAAKLSAPPYGQPSAVKGAVSTENSSGPVIEGIKQVNEASAAITWL
FT                   DSVTVPAVADAWLAGGEALVAGTQTPDQVLASVRAASSAAK"
FT   gene            458056..459027
FT                   /locus_tag="AAur_0444"
FT   CDS_pept        458056..459027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0444"
FT                   /product="putative ABC-type sugar transport systems,
FT                   permease components"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09267"
FT                   /db_xref="GOA:A1R1Z0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z0"
FT                   /protein_id="ABM09267.1"
FT                   /translation="MTVSDTAWKPAAPPPAPASTKSPRTSTRKFARTTHWRNVMWVLPA
FT                   VLLLGVFAYLPLVQNLGFSFLKWDIYSGRQTFVGADNYVRMFNDPIFWKSLLNNTLYAI
FT                   ISIAFQVFGALILAAMIEGLRSQRWRGILRAVYFVPSAISLTVAGLLFYFIYEPEMGIL
FT                   NAALDFLGLGNFTQAWLGQENTAIFAIIAMSQWQGFGYCTLLFSVALQRIPSELYEAAS
FT                   IDGVGPFQRFFSISLPLVREMTGLMMIVTVSGAFQVFNEVMVMTSGGPNNSSQVLGTWL
FT                   YRSGFVRNDFGYAAAVATAVFIITLVLAVIQLRISKKRRVQW"
FT   gene            459021..459857
FT                   /locus_tag="AAur_0445"
FT   CDS_pept        459021..459857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0445"
FT                   /product="putative sugar ABC transporter permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08690"
FT                   /db_xref="GOA:A1R1Z1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z1"
FT                   /protein_id="ABM08690.1"
FT                   /translation="MVTRSAVLLVLGRVLVKAFLIALAVVVIYPLVWMLLNGVKSNSEL
FT                   FSNPFALPVAWKWDNYVTAWNRGVGDYLTTSVLVTVASTIATVFISAWAAYGLTRVNIP
FT                   FNRVVLILILGGLMLAPTVALIPLVKMFQSLGLYNNLWALLILYTAFRVPFTTFLIRAY
FT                   MMDLPAEVDEAASVDGASKARAFWQVILPMCKPILVSTVLLNILFTWNEYLFAMVFTSG
FT                   GALQTLPVGLTNLMSKHGTDYPVVFAGMAIAAIPVIVLFFAGQRYFIRGLADGVGK"
FT   gene            complement(459880..460830)
FT                   /locus_tag="AAur_0446"
FT   CDS_pept        complement(459880..460830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0446"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07877"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z2"
FT                   /protein_id="ABM07877.1"
FT                   /translation="MGVIRVALGIAFWLVACCTVELPSASADDAWASNNAGDRGIDIGA
FT                   RFKIDPATGQLAPSLGSTSTSPSSENPNQYMADTHCRADGPDTKDPGCDALDCPATTPA
FT                   GEEGTPVIWKEAPKAITNPGWTDWIPVSGPTCLYDPEPENVLANIAARILTDFRQLPVN
FT                   PGNLEAQPFPHTLKGGPTNFYATAADQTFDLTILGQAVHLTATPTSYTYTYGDGTTLGP
FT                   TPAAGYTIPETEWLNNQTRTSHTYTDTGNYQAALTTSFTGTYSVNNGPPLPINGTLDIT
FT                   TPTKTIHVWKTEKALVADTCQENPNSWGCPDSPEN"
FT   gene            complement(460838..461503)
FT                   /locus_tag="AAur_0447"
FT   CDS_pept        complement(460838..461503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0447"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07273"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z3"
FT                   /protein_id="ABM07273.1"
FT                   /translation="MPRHSFTSSPFVRTLPAVCALAVAMLLSGCASGSTPNSAASQTGP
FT                   TTAAPTPSASVPAASATPSAAPVYKPADATGKAQNVPVPVMPDLAKENSKAGLEAFIGY
FT                   YYAQLSYVGETGDMSSWLPLISQDCQLCLRLQESGEDGYKNGRWLAGGKISVPAIEMQW
FT                   TADTLKTAKVQVIQNQIDYYNADGSIGRPRSEASNDAFALFARFDDGAWTVVDLGVIE"
FT   gene            461761..462207
FT                   /locus_tag="AAur_0448"
FT   CDS_pept        461761..462207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0448"
FT                   /product="putative alkaline shock protein"
FT                   /note="identified by match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09305"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z4"
FT                   /protein_id="ABM09305.1"
FT                   /translation="MEDQNVQLDPVPGGEILGTGRTIISEAAVAKVAGIAARTVPGVYS
FT                   LGSAPSRALGAIRDAVGSSDHAAGVRAEVGETQVAVDITLVALYGHPLHGVANQVRAAV
FT                   YRAVEELVGLQVIEVNIEITDVFIAPPAKPAGAKAVVVERDALQ"
FT   gene            462210..462395
FT                   /locus_tag="AAur_0449"
FT   CDS_pept        462210..462395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08834"
FT                   /db_xref="GOA:A1R1Z5"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z5"
FT                   /protein_id="ABM08834.1"
FT                   /translation="MTVVGIAIGAFVAFMSFSFGLWGFLISLLFMGIGALFGRAAEGKL
FT                   DLRSVLDAITGRRSSS"
FT   gene            462392..462772
FT                   /locus_tag="AAur_0450"
FT   CDS_pept        462392..462772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07341"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z6"
FT                   /protein_id="ABM07341.1"
FT                   /translation="MSVAEAVEFTTSLAGHNRISTQALTSLARAAAAEALGVEASDIRA
FT                   DWADDDGLLALSIVAPISVPALTEVLRDPQRVQGFGGSIWDRAVAAKAFVLETVTRLSG
FT                   SQLSRVDIRISRAHVTEGGRVQ"
FT   gene            462853..463416
FT                   /locus_tag="AAur_0451"
FT   CDS_pept        462853..463416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07690"
FT                   /db_xref="GOA:A1R1Z7"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z7"
FT                   /protein_id="ABM07690.1"
FT                   /translation="MSRILRRETHSSRAGASVIAAVLVIVLCVYALLEAGVRAIGQPPW
FT                   LIDPTTAAERIIALPEGISPLLLGASGAVIAMVGLFFLLHAVLPGRRARHLLRDPRTAV
FT                   VVDDEVLASALARRARTAANVTQEQVMVVVSRQLVVVNVRPTSGSRVSEEAVLTAVQAE
FT                   LEEMSPLPMPAVRVNLASSGVIGA"
FT   gene            463413..464024
FT                   /locus_tag="AAur_0452"
FT   CDS_pept        463413..464024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07090"
FT                   /db_xref="GOA:A1R1Z8"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z8"
FT                   /protein_id="ABM07090.1"
FT                   /translation="MNGTPRALNRVLLFIIGVKLLAIGLLLLLLATVPAVATWWHGWSA
FT                   SVWAGAENAFRQTHLPGREESWLWIVAGLILVAIIIAMIAWLSQQGKGRANLLVASDDD
FT                   SDVDGEVRIGGGVAEQALRAALSERTDLAGASVATLEVKGKPGLRIRIQPRQGVAPHLL
FT                   AAEVSQLVEALDLVIGQKTPVLVHMVSGARSKFTKAERVR"
FT   gene            464147..465001
FT                   /locus_tag="AAur_0453"
FT   CDS_pept        464147..465001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09549"
FT                   /db_xref="GOA:A1R1Z9"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:A1R1Z9"
FT                   /protein_id="ABM09549.1"
FT                   /translation="MRSRILTAGAGASAAALAAAIVLAVPAQAAEGDAHLSVLHGVPGL
FT                   TVDVWVNGARTLDDFAPGTLAGPLALPPGAYDLAITASDAADASAPVIGPVTVTLAANG
FT                   NYTAVANLDAAGKPTANFFTNDVSRIDAGKGKLTVRHTAAAPAVDVLAGGTAVVTNLAN
FT                   PNEQTLTLDPGTISAAVAAAGTTAPVIGPADVTVAEGTHTIVYAWGSLTDKNLQLAVQT
FT                   IDGLHSAPGSVPGALDGSSGSVPTEPMVPTEQMVLGGGLAAATLLLIVVGLGKVRTSAA
FT                   RKS"
FT   gene            465125..465805
FT                   /locus_tag="AAur_0454"
FT   CDS_pept        465125..465805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0454"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10203"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:A1R200"
FT                   /protein_id="ABM10203.1"
FT                   /translation="MTPSKPSRSRRVAALAGMAVLVLTACGTATPLTAGSSSSEASGPD
FT                   PSEQQTQPSLPPAEPSRPPAEVSLKGATPTQPAAVPPPVSLKVAGTSIDMAVIPVGVAP
FT                   GGAMEIPETFYQAGWYRFGSAPGAAEGTAVLAGHIDTTSDQAPFSQLKSLPAGTLITVG
FT                   REGAPALNYRVVSVTLMAKDAFDGDSLFRRTGPHELKVVTCGGRWLDERMDYSDNVIVT
FT                   AVLE"
FT   gene            465858..466436
FT                   /locus_tag="AAur_0455"
FT   CDS_pept        465858..466436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0455"
FT                   /product="putative RNA polymerase ECF-subfamily sigma
FT                   factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08628"
FT                   /db_xref="GOA:A1R201"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1R201"
FT                   /protein_id="ABM08628.1"
FT                   /translation="MVSPNEVSSEWDDTLTASFTAGDESALVAAYRQFAPLVHTLALRS
FT                   LRDRAAADDVTQEVFIRVWRSRDTFNPEVARLPAWIVGIARHVIADAHSASNREVRRVL
FT                   AVAQVQDTGGGGPTEGAVEVLADRLLLDGELDRLGEPQGAIMKLAFYEDLTHEQISRRL
FT                   ELPLGTVKSHIRRSLIHLRSRLEVDHAAH"
FT   gene            466423..467214
FT                   /locus_tag="AAur_0456"
FT   CDS_pept        466423..467214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0456"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07379"
FT                   /db_xref="GOA:A1R202"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:A1R202"
FT                   /protein_id="ABM07379.1"
FT                   /translation="MPHIDPEELSLLALYGDWLDEEGRQHLSGCDACSAEYAALRRAVD
FT                   AMKTTPDSSTLEVPGPSVWSGIHRELGLSDAIREDPLGSAAGSATGTETSKPGINGPTE
FT                   PEQPAAPPADIRSVKKRPQGWQRRGTWLAVAAAGALVIAGATLWNINQAATPLARAELT
FT                   PLAQHTATGSATVLESPDGTRTLEVKLSKEEAQGYQEVWLIGTDLTRLISLGIMKSDSG
FT                   TFPLPADLNLADFPIVDVSDEPLDGNPGHSSVSIVRGSLTS"
FT   gene            467311..468027
FT                   /locus_tag="AAur_0457"
FT   CDS_pept        467311..468027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10116"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A1R203"
FT                   /protein_id="ABM10116.1"
FT                   /translation="MAGTTVASTSAPDKSLLETTVAGLMAELAALEEPRAREVNEKHGD
FT                   DHGVNLSKLRAVAKRLKTQQDLARELWDTGDTAAKLLALLICRPKAFGRAELDSMLREA
FT                   RTPKVQDWLVNYVVKKSPHSEDLRLAWFSDPDPVVASAGWALTSERVVRKPEGLDIVQL
FT                   LDIIEADMKDAPDRLQWAMNHCLAQIGIEFPEHRARALDIGERLEVLKDYPTPPNCTSP
FT                   FAPSWINEMVRRQAIK"
FT   gene            complement(468033..468434)
FT                   /locus_tag="AAur_0458"
FT   CDS_pept        complement(468033..468434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0458"
FT                   /product="putative helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09856"
FT                   /db_xref="GOA:A1R204"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1R204"
FT                   /protein_id="ABM09856.1"
FT                   /translation="MDELEALQTIGRLIKEERLAQGLSQVQLAKQAGTAIKTVRTLESG
FT                   TRRTQEINQRKLEHALGWRAGSVSEVLKGKSTFAPDMITPDDMRSGDESRQGPPRVTVP
FT                   SAPIARASHLSDEELLAELTYRMMHRNRG"
FT   gene            468685..470031
FT                   /locus_tag="AAur_0459"
FT   CDS_pept        468685..470031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0459"
FT                   /product="putative alpha-glucosides-binding ABC transporter
FT                   (aglE)"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09441"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1R205"
FT                   /protein_id="ABM09441.1"
FT                   /translation="MKKTKYLLPVAAAGVLALTLSACSGDGGGGGSTAGSEDCSAYESY
FT                   GKHDGKTVSVYSTIVDIEATNLEESWAQFENCTGITVKYEGSKEFETQIGVRAQSGTAP
FT                   DVAIFPQPGLLATQARAGYLKPAPKTVSDLVDKNWSPDWKKYGTVDGTYYAAPMLANVK
FT                   GFVWYAPKTFKDKGWEVPKTWDEMIELSKKIAADDPNMKPWCAGFESGEATGWPGTDWI
FT                   EDVVLRAHGPEVYDQWVAHQIPFNDPKIVDSFNKAGDILLNQEMVNGGFGDVRSILSTG
FT                   FAQAGQPVLDGTCAMHHQANFQAANWPAGTNVAEDGDVWAFITPPIDESKGKAVTGGGE
FT                   MVGAYKDTAEVQSFLAYLASADFANNRVKLGGVVSANKGLDPNNAQSDLDKLTVQILQD
FT                   PETVFRFDGSDLMPSAVGSNSFWKGIVQWINGTSSQDVANSIESSWPKS"
FT   gene            470128..471093
FT                   /locus_tag="AAur_0460"
FT   CDS_pept        470128..471093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0460"
FT                   /product="putative alpha-glucosides ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08945"
FT                   /db_xref="GOA:A1R206"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R206"
FT                   /protein_id="ABM08945.1"
FT                   /translation="MEFIGEKLLQVVIALAIFAAVIGLIMLLVDRAPKSVKDKVTVAGF
FT                   LAPAAILMLVGLVYPAIRTSMLAFTDASGNGNGFDNFVWMFTQPEALTTLRNTVIWTVL
FT                   VPLLSTSFGLAYAVFIDKARGERVLKSLVFMPMAISFVGAGIIWKLVYDYRGPNIEQTG
FT                   VINFFRDALGMDPKQFLLDAPENTIFLIIVMVWIQTGFAMVILSAAIKGVPVELIEAAR
FT                   LDGANAWQQFRNVTVPGIRGALVVVLTTITIATLKVFDIVRTMTAGNYDTSVVANEMYT
FT                   QAFRAGEPGRGAALALILFLMVLPIVVYNARVLRKQREIH"
FT   gene            471090..472052
FT                   /locus_tag="AAur_0461"
FT   CDS_pept        471090..472052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0461"
FT                   /product="putative ABC-type sugar transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08503"
FT                   /db_xref="GOA:A1R207"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R207"
FT                   /protein_id="ABM08503.1"
FT                   /translation="MTATPAPKEASKATRQRPGSDPTEDAQPIMRRVKTKLTSKWATAA
FT                   AIIIAVVWSVPTFGLFVTSFRPAAKQVGPRSNGWWNAFVDWDFTFKNYADVLTPAGSQS
FT                   ANLSQYFVNSIAIVIPVTIFVLVLASMAAYVFAWGKFKGRDALFIFVFALQIIPLQMAL
FT                   IPLLQFFTQTLQLPAGSYAQLWIAHTMFGLPLGIFLLHNFISEIPGEVIEAARVDGAGH
FT                   STIFWRIILPLSVPALASLAIFQFLWVWNDLLVALVFSGGTADVAPITQRLAEISGTRG
FT                   ARDYLNPAAAFVSIIVPLLVFFGLQRYFVRGLLSGGLKG"
FT   gene            472168..473235
FT                   /gene="ccpA"
FT                   /locus_tag="AAur_0463"
FT   CDS_pept        472168..473235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="AAur_0463"
FT                   /product="transcription regulator for carbon catabolite
FT                   control protein A"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06456"
FT                   /db_xref="GOA:A1R208"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R208"
FT                   /protein_id="ABM06456.1"
FT                   /translation="MSKTTGRSQRGGHTGVSIEDVAAAAGVSTATVSRAVRGLPRVSPA
FT                   TREKILEVASSLGYVASSSASGLATGRTRTIGVLAPFVSRWFFSKAIEGADRELHSRKY
FT                   NLSLFNLGGHGSNRERLFSSTMVYKQIDALLVLCMSLTEEELEHLHKIDIPLVVVGGHV
FT                   EDCAYIGINDYDAASTAVRHLLDLGHKDIALLHGDDETDLNFDVPRVRIRAFQEVMTDA
FT                   GLAVRPEWDQWGDFTVASGQQAFNRLWSQPGRKPTAIFCSSDEMAMGVIFEAGRHGVRV
FT                   PQDLSVIGIDDHDFSSSIGLTTVGQRPDNQAELATKMLLDELDGNPGAVHSEVAPHKLI
FT                   VRETTAPPNFPGQPS"
FT   gene            complement(473232..474131)
FT                   /locus_tag="AAur_0462"
FT   CDS_pept        complement(473232..474131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07555"
FT                   /db_xref="UniProtKB/TrEMBL:A1R209"
FT                   /protein_id="ABM07555.1"
FT                   /translation="MTGNLYRGQAGLPFSSSLRIYEPLEAFPPEQQRQLVAEGSKAGSR
FT                   AAIENAELQASLGRITRSGGDPFPTGRTDLVRMTRVPGGRHAAGSATAANKEDHDAGRL
FT                   LYCPSQLVIRAGLAANALMDGVHSPLADLLIPVSQRDKHQIRIDRINAGEDAKRVHTRA
FT                   STWGIPFSWFSLFTESDRKDVVESEGRILTVRVWTPITEALDRARFAVAHLALAAPDLD
FT                   MLDDLTQLTEWLELFHVQSMVELDYGAVADKVYPDESPMDVRLGIECLAEGDMTGAAAA
FT                   YRRLASRWIPIRQLARAS"
FT   gene            complement(474164..474970)
FT                   /gene="xth"
FT                   /locus_tag="AAur_0464"
FT   CDS_pept        complement(474164..474970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="AAur_0464"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00195; match to protein
FT                   family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07126"
FT                   /db_xref="GOA:A1R210"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A1R210"
FT                   /protein_id="ABM07126.1"
FT                   /translation="MKIATWNVNSLRARADRVEAWLERSDCDVLAIQETKCKDENFPWE
FT                   LFERMGYEVAHFGVNQWNGVAIASRVGLDDVQRTFLDQPAFGKAGKDPAQEARAIAATC
FT                   GGIRIWSLYVPNGRSLDDEHMPYKIKWLDVLQGHAAEWVKSEPTAQIALMGDWNIAPFD
FT                   DDVWDIELFRNNNYTHVSEPERAAFHAFETAGFTDVVRPYTPGPGVYTYWDYTQLRFPK
FT                   KEGMRIDFCLASPALASRVTGASIDREERKGKGASDHAPVIVELAD"
FT   gene            complement(475041..475607)
FT                   /locus_tag="AAur_0465"
FT   CDS_pept        complement(475041..475607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0465"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06619"
FT                   /db_xref="GOA:A1R211"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A1R211"
FT                   /protein_id="ABM06619.1"
FT                   /translation="MSDVADRKMFKNPGTALLVRGVLSIVFGLLIIVLPSATALVVVVM
FT                   FGVFAIIDGITSVAHYFYDPAGRSRWTVVGGFISIAAGIVAIALPGITAAAIGVLIGLW
FT                   ALVLGLSQIILSLAARNFIRSWGIWLLTGLVTTVFGIVVLVNPGLGLLSLVWMLAGFAI
FT                   VTGLLLLASGIGLRKLATSPPLFAR"
FT   gene            complement(475635..476261)
FT                   /locus_tag="AAur_0466"
FT   CDS_pept        complement(475635..476261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0466"
FT                   /product="putative two-component system response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08776"
FT                   /db_xref="GOA:A1R212"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1R212"
FT                   /protein_id="ABM08776.1"
FT                   /translation="MNSISVLLVDDHTVVRSGLKALLGTQADIAVVGEAASGEEALEAA
FT                   QEHMPAVVLMDLAMGAGMDGIEAIKQLRQRNPKQAVIVFTTYDSDADIVRAVDAGAMGY
FT                   LLKDAAPEEIFAAVRGAVQGKSVMSAPVASRLFQQLRNPDEILTPREAELLSLLTEGLS
FT                   NRDLGKRLFISEATVKTHLAHIYAKLGVETRAAAIATAIRREGMR"
FT   gene            complement(476258..477487)
FT                   /locus_tag="AAur_0467"
FT   CDS_pept        complement(476258..477487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0467"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07403"
FT                   /db_xref="GOA:A1R213"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1R213"
FT                   /protein_id="ABM07403.1"
FT                   /translation="MPTTRLRPEPGNQPSNRIDGRLDAVVHSGFAVLMVASAVRYVMRH
FT                   SPADNLWTVALAIAVCALYAVTAVLAHRQPRRGRQQLWIPWMVALVAAWAALVVVAPSF
FT                   AWCSFAIFFLTRTAFRGWSGYVAGGATAAATAVGLFRMSDWTDIAMLLGPLAAGALLTL
FT                   IYDKIERDAALQRRLFDDVTQAQEQLAAKQREAGIATERERVSREIHDTVTQGLASSLL
FT                   LLEAAQRSWPAETAHDDVRKATDLLRRNLADTRSLVHELSAPGLETGPLPEALEHAARQ
FT                   YVDNINVQVTGEPQPLPSEVRHALLRVTQSAAANIKLHAHANHASVTVGYLPDAVTLDV
FT                   FDDGRGFDPAAVPPPSANGGYGLRAMRQRVEQLGGELSVESSPGEGTIIAAQFPLTRPA
FT                   DPENAPKEAR"
FT   gene            477696..478253
FT                   /locus_tag="AAur_0468"
FT   CDS_pept        477696..478253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0468"
FT                   /product="putative domain of unknown function (DUF336)"
FT                   /note="identified by match to protein family HMM PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07601"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A1R214"
FT                   /protein_id="ABM07601.1"
FT                   /translation="MIAAAAAGALLLTGGVTAVANAVAPAGTPVAAPVKVAADVLPAPE
FT                   NVVAQNRISVGASSKAVNAALAKCQADKLPFVTVALVDRFGTVQALLRGDNAAEHTIEA
FT                   AKQKAYTAAAFGAPTSELAKRINGNGPSIADLPGTLFLPGGVPLKVNGVSVAGIGVGGA
FT                   PDGALDEACATAGADALAAAAK"
FT   gene            478256..478966
FT                   /locus_tag="AAur_0469"
FT   CDS_pept        478256..478966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0469"
FT                   /product="putative ankyrin repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10175"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A1R215"
FT                   /protein_id="ABM10175.1"
FT                   /translation="MNALGTKARVVGTGVLVLGLLSGCTTAAPSPSSPTPTQATPTQAA
FT                   SSNAGPGPASSAAVPAQQSAEAKLSPEAQIETDRLLILAAKANDAAKVRELIAAGGNVN
FT                   AKDEIQDSAFLYAGAEGFNEVLQLTLAAGADVRSTNRYGGTALIPASEHGHTETVRILI
FT                   AAGVPVDHVNNLGWTAMQEAILPNNGGPNQQDVVRQLLAAGATPDIRDPQGRTALQNAE
FT                   RLGFTEIAALIRNR"
FT   gene            complement(478967..480181)
FT                   /locus_tag="AAur_0470"
FT   CDS_pept        complement(478967..480181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0470"
FT                   /product="putative 3-ketoacyl-CoA thiolase"
FT                   /note="identified by match to protein family HMM PF02803"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08719"
FT                   /db_xref="GOA:A1R216"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1R216"
FT                   /protein_id="ABM08719.1"
FT                   /translation="MSLKDQFGKDILLTGWGHSKFGKLGDETLESLIVQVAGEAISNSG
FT                   LAPKDIDEIYLGQFNSGMQPLGFTSSLALQLSADLANVPATRTENACASGSAAFQQGVK
FT                   AVLSGTARNVLVIGAEKMTDAGADVVGAALLGASYEMAGKASSTGFTGLFAEVAKHYDK
FT                   RYGAGINGPGFENGLGDVLGSIAAKNHRNGMDNPYAQMHRDFGVEFCRTISEKNPMVAE
FT                   PLRRTDCSPVSDGAAAVVLSTSATGGATAPVRLAGFGHANDFFPAEKRDPTEFAATRAS
FT                   WERALGMAGVGIEDLDFAEVHDCFTIAELIMYEAMGLTPRGEGARAIKEGWVYKDGKLP
FT                   INVSGGLKAKGHPVGATGVSQHVIAAMQLSGTAGDMQLPNARRGAVQNMGGVGIANYVS
FT                   VLEAL"
FT   gene            complement(480178..480873)
FT                   /locus_tag="AAur_0471"
FT   CDS_pept        complement(480178..480873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0471"
FT                   /product="3-oxoadipate CoA-transferase subunit B"
FT                   /EC_number="2.8.3.6"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02428"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10280"
FT                   /db_xref="GOA:A1R217"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1R217"
FT                   /protein_id="ABM10280.1"
FT                   /translation="MAWTRDQMAAIAAEELNDGDYVNLGIGIPTLVANNLPDGVRVVLQ
FT                   SENGLLGMGPFPFEGEEDADLINAGKQTVTITPGGSIFDSATSFGMIRGGHVKVAILGA
FT                   MQVSGSGDLANWTIPGKMVKGMGGAMDLVAGTPRVVVLTEHNAKDGSAKIVTDCTLPLT
FT                   GLKCVDRIITDLAVFDIVPDAEIHDRGTRLLLTRLAPGLTVEEIRIKTDAAFTVALTAE
FT                   EPTLEGAHA"
FT   gene            complement(480893..481624)
FT                   /locus_tag="AAur_0472"
FT   CDS_pept        complement(480893..481624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0472"
FT                   /product="3-oxoadipate CoA-transferase subunit A"
FT                   /EC_number="2.8.3.6"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02429"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08947"
FT                   /db_xref="GOA:A1R218"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1R218"
FT                   /protein_id="ABM08947.1"
FT                   /translation="MAKIHTSAAQALHDLMADGLTIAVGGFGLSGIPADLIDAVRESGA
FT                   KDLTIVSNNMGVDGKGLGVLIEAGQVRKVIASYVGENKLFAEQYLAGQLEVEFTPQGTL
FT                   AERLRAGGAGIPAFYTRTGVGTLVAEGKPLEEFDGVTYVRERAITADVALVHAHTADTD
FT                   GNLVYRYTARNFNPVVATAGKVTIAEAEVIVQPGELDPNHIDTPGVYVQRLVQAINRVK
FT                   DIEQRTVRPRPEARRAEALTA"
FT   gene            481803..482567
FT                   /locus_tag="AAur_0474"
FT   CDS_pept        481803..482567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0474"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08569"
FT                   /db_xref="GOA:A1R219"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R219"
FT                   /protein_id="ABM08569.1"
FT                   /translation="MVQGAQVVGRVALLLRLVGRKPEGTSLAGLVRESGLTRPTVHRLL
FT                   TSLAAEGLLEHDSDSGKWVLGPEIFLLGSVAAARFPMEDIARPSLRRLAAETGESAFFS
FT                   IRRGNETVCVLREEGSFPVRSFVLHEGVRFPLGVASAGTAIMAFLPPEEQESLLNDWPG
FT                   HAGDFAAGHPAGVVRDNLEQTRLAGYSVNPGLILEGSWGMGAAVFDQQGRPAWALSLTG
FT                   IEPRFRPDRQEFLGKLLLEEAHRMTARLQGAS"
FT   gene            complement(482560..483132)
FT                   /locus_tag="AAur_0473"
FT   CDS_pept        complement(482560..483132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0473"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06768"
FT                   /db_xref="GOA:A1R220"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1R220"
FT                   /protein_id="ABM06768.1"
FT                   /translation="MAIDVRPATVFDDVKTMVGPKSPDANVCWCLSYRIPSKLNQELQR
FT                   QERGKFVKQLVAKDPPPGVLAYDGDEVVGWAAVHPRADTTFAKNRKIPQVDESNVWSVW
FT                   CIRVRPGHRGKGISHELLRGAIDFAKSQGAPAIEGYPVDNKGGKVDLTMAYVGTRRLFE
FT                   KAGFTKVAETTSVLNGFPRVLMRLDLS"
FT   gene            483333..484013
FT                   /locus_tag="AAur_0475"
FT   CDS_pept        483333..484013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0475"
FT                   /product="putative fasciclin domain protein"
FT                   /note="identified by match to protein family HMM PF02469"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10217"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A1R221"
FT                   /protein_id="ABM10217.1"
FT                   /translation="MLSTKRPALAFVGLTAAALLGLTACGGSSTTSTPAASSAAPETSM
FT                   AAPSPSASAMSSAAMDPAANLVGPGCAGYAAQVPDGAGSVMGMAQDPVAVAASNNPLLK
FT                   TLTAAVSGQLNPKVDLVSTLNGSEFTVFAPVDDAFAKIDPATIETLKTDDALLSKILTY
FT                   HVVPGQLTPDQVVGTHKTVQGGEVTVAGTKDALTVDGASNVICGGVQTANATVYLIDSV
FT                   LMPK"
FT   gene            complement(484113..484301)
FT                   /locus_tag="AAur_0476"
FT   CDS_pept        complement(484113..484301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09778"
FT                   /db_xref="UniProtKB/TrEMBL:A1R222"
FT                   /protein_id="ABM09778.1"
FT                   /translation="MSKIATQGTLRLNTQSSAQAGKDVTLTLDSSKPMTVRIEVDHCPC
FT                   GSEHNRAGSYVDTDFSR"
FT   gene            complement(484347..486374)
FT                   /locus_tag="AAur_0477"
FT   CDS_pept        complement(484347..486374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0477"
FT                   /product="putative choline/carnitine/betaine transporter"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08782"
FT                   /db_xref="GOA:A1R223"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A1R223"
FT                   /protein_id="ABM08782.1"
FT                   /translation="MAINSDTKPLTPEEIPANGHVAGTPAAASPTNPARAENPEEVISV
FT                   SPDTTLAALDAEDGGAEILPDSEEYEQIMEELRHAKTEQAVSARRNRKLTLDKVTFGIT
FT                   GAIAVAFVVWGFVGRDSLSATSKGALNWVMEYTGWLFMVLASLFVVFVLWLALGKFGNI
FT                   PLGKDGEKPEFRTISWVAMMFAAGMGIGLMFYGVAEPLYHYISPPPGTVDGRTPAAIQT
FT                   AMATSIFHWTLHPWAMYAVVGIAMAYGTYRLGRKQLVSAAFTSLFGIRMVEGPLGKFIN
FT                   ILAIFATLFGTAASLGLGALQIGSGMTSNGWLGEVGTPVLVVIVAILTFCFVASAVSGI
FT                   SRGIQWLSNINMVLAVVLALIVFVAGPTLFILNLIPSAVGDYARDLAEMSSRTEAVGDD
FT                   SLRSWMTSWTIFYWAWWISWTPFVGMFIARISRGRTIRQFVTGVLLVPSVVSVIWFGIF
FT                   GGAAFHVQQEADKAGTPGLVTMVDGAPSINFDGALFDLVKNLGMPGWLTAAVIVLAMVL
FT                   VAIFFVTGADAASIVMGSLSSNGAEHPRRGVVIFWGSLTGAVAAVMLLAGGDKPSEALS
FT                   GLQRVTIVAALPFVIVMLLLCFALVKDLRRDPLQLHKRLATSVVERAIRTGVEQHGGVQ
FT                   FDLVTKHDCAEKCTESDCVGGTPTGTIPLVGKPQLESDDK"
FT   gene            complement(486834..487640)
FT                   /locus_tag="AAur_0478"
FT   CDS_pept        complement(486834..487640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0478"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10101"
FT                   /db_xref="GOA:A1R224"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R224"
FT                   /protein_id="ABM10101.1"
FT                   /translation="MAERNHADTDKGADAQGGGVQSVDRALQILEILAREGDAGVSEIA
FT                   EEMGIHKSTVSRLVGSLVNRDIVRQNSERGKYQLGFGILRLASSIPGRLSVVHEAREVL
FT                   EALAAEYKETVNLAVLRSNYAVNVDQAMGPSTLATYDWVGSLTPLHATSSGKVLLAALT
FT                   ADERTQVFKAVGLPARTPRTVTNRGELEKQLLDVARNGYATVHEEFEIGLTAVAVPIFN
FT                   HAGSVIAAVSISGPAFRFSPEEQPGLIKSLREAGLTISARMGYRPR"
FT   gene            complement(487745..489025)
FT                   /locus_tag="AAur_0479"
FT   CDS_pept        complement(487745..489025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0479"
FT                   /product="putative molybdopterin biosynthesis protein MoeA"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF03453; match to protein
FT                   family HMM PF03454"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07948"
FT                   /db_xref="GOA:A1R225"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A1R225"
FT                   /protein_id="ABM07948.1"
FT                   /translation="MLAQATFIDVPGPTVSAERRHAPSWAEARQLAYHCAGPLPPLNLR
FT                   PADAIGRTLTANITASQDLPHYASSAMDGWAINGNGPWVMTTAGLPLSPGEASVIATGG
FT                   LIPAGAAAVLRKESGVVVDGAGGARQLTLKPDAKLGETLPGRHIRPAGEEASAGEVLIP
FT                   AGTLLNPAHIALAAVAGSDELQVQRKPSVAVVLTGSEVVTSGEPAPGQVRDAFGPQLDT
FT                   VISQLGGEPRGQIRIGDSYDEWLAALAGGQAGSLPDVTITTGGTGKSGTDHFRDAIAAL
FT                   GGRLLLDGIAMRPGHPAVMAELPDGRFVIGLPGNPLAAMMALMTLGEPLLAALGNRPLQ
FT                   SAILMTSGADIDPDPGRTRLMPCTLVHDLVFPASHTGPGMMRGLAWADGYMAVPPAGAA
FT                   AGTPVQVLPLPWTTSFSSEVRTRVPMV"
FT   gene            complement(489150..490367)
FT                   /gene="fdhA"
FT                   /locus_tag="AAur_0480"
FT   CDS_pept        complement(489150..490367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhA"
FT                   /locus_tag="AAur_0480"
FT                   /product="glutathione-independent formaldehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.46"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR02819"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07477"
FT                   /db_xref="GOA:A1R226"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R226"
FT                   /protein_id="ABM07477.1"
FT                   /translation="MSGNRAVAYKEPGVVEIIDTDYPTFELKDGPGVNPANVGRKVPHG
FT                   AILRTVTTNICGSDQHMVRGRTTAPQDLVLGHEITGEVVEVGPDVEFIKVGDIVSVPFN
FT                   ISCGRCRNCKEQKTGICLNVNPDRPGSAYGYVDMGGWVGGQAEFVLVPYADWNLLRFPD
FT                   RDQALEKIMDLTMLSDIFPTGFHGAVTAGVGVGSTVYVAGAGPVGLAAAVGAQLLGAAV
FT                   VIVGDMNEDRLAQARSFGCETVNVSNGDPKEQIAQILGVPEVDCGVDAVGFEARGHGKD
FT                   ASHEAPATVLNSLMDITAAGGSLGIPGLYVTGDPGGIDDAAKHGSLSLSLGTGWAKSLS
FT                   FTTGQCPVMKYNRQLMMAILHDKVQIAKAVNAKAIPLEDAPRGYAEFDAGAATKFVLNP
FT                   NGYVKA"
FT   gene            complement(490515..492833)
FT                   /locus_tag="AAur_0481"
FT   CDS_pept        complement(490515..492833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0481"
FT                   /product="putative formate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM TIGR01701"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08445"
FT                   /db_xref="GOA:A1R227"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:A1R227"
FT                   /protein_id="ABM08445.1"
FT                   /translation="MASKAPRENIDESKLTVTKPKTKAVGIPAVANALKISLEQMGPLR
FT                   SVQTLLAVNQLDGFDCMGCAWPEHEKRNAAEFCENGAKAVAEEATRRRVTPEFFAQHSV
FT                   ADLKTRDDFWLGQQGRLTHPMFLDEGATHYKPIDWDDAYDLMAEELRGMEHPDEAVFYT
FT                   SGRTSNEAAFVYQLLVRGLGTNNLPDCSNMCHESSGSALVETIGIGKGSVSLTDLETAS
FT                   LIFVAGQNPGTNHPRMLSALEKAKKNGAVIVSVNPLPEAGLLHFENPQHVAGMIQGTQL
FT                   TDDFLQIRAGGDQALFQGLGKYLLEAEADGRKTPGLETVLDHQFINNHTVGIDDYLRYL
FT                   EKVEWDDIVEATGLTLEQIRSTGERLLASSATIVCWAMGLTQHKHSVPTLRDVVNVLLL
FT                   QGNIGKPGAGVCPVRGHSNVQGDRTMGIFEKMPETFHDRLDQEFEFRSPREHGYDTVAA
FT                   IRAMRDGRVRFFMGMGGNFVRAAPDSEVTEQALAKTRLSVQISTKLNHSHLSTGRRALI
FT                   LPTLGRTEKDTQRTGDQRVTVEDSMSAVHASRGRLKPASDHLHSEVAIVCNLAHRLFTD
FT                   GHHRLPNTPQAAWLSLRDDYSLIRKHIEAVFDGFEDFEARIQHPGGFVLPHPPRDARKF
FT                   DTTSGKAHFTGNELEFIKIPPGRLVLQTLRSHDQYNTTIYGKDDRYRGIHGGRRVVLVN
FT                   AQDISDLGFADGDMVHLISEFQGTDRRAENFRIVSYSTPKGCAAAYYPETNVLVPLDSV
FT                   ADTSGTPTSKSVIIRMEKA"
FT   gene            complement(492844..493728)
FT                   /gene="folD"
FT                   /locus_tag="AAur_0482"
FT   CDS_pept        complement(492844..493728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="AAur_0482"
FT                   /product="Methylenetetrahydrofolatedehydrogenase /
FT                   Methenyltetrahydrofolate cyclohydrolase, bifunctional
FT                   protein"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by match to protein family HMM PF00763;
FT                   match to protein family HMM PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06814"
FT                   /db_xref="GOA:A1R228"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R228"
FT                   /protein_id="ABM06814.1"
FT                   /translation="MTTEVLSGKPLAAIIQQRAHEETALLDDEGVRPVLAVVVATDDES
FT                   THWYVRSIERAAGRAGIGCRIIDLGHDATEQVLASVLADLSAEPTVHGIILQTPLPAAV
FT                   RADRLVGLIAPEKDIDGANPLSLGRLAVGQPAFAPATAQAVVELLDHFQIPVAGRNVAV
FT                   VGRSAVVGKPLSLLLLERDATVTICHSKSGPLERYTQPADVVVVAAGRTGLLKGSHLSP
FT                   ETVVIDVGTNVLPDGSLVGDVDEASVTGVAAGLSPVPGGVGSVTTALLLLHTVEAARQQ
FT                   SRSGLLTASTSRI"
FT   gene            complement(493725..494351)
FT                   /locus_tag="AAur_0483"
FT   CDS_pept        complement(493725..494351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0483"
FT                   /product="putative formiminotetrahydrofolate
FT                   cyclodeaminase"
FT                   /note="identified by match to protein family HMM PF04961"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07987"
FT                   /db_xref="GOA:A1R229"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:A1R229"
FT                   /protein_id="ABM07987.1"
FT                   /translation="MISSETISDYLSRLASRQPTPGGGAAAALHAAQGAALVAMVARYT
FT                   TGAKYEEHAALVTRITSAADHLVVEALRLADADEHAFQSVIDSYKLPSGTEELKAARTA
FT                   AIQEALVQAAHTPAQLINVAGEVVDLATELFDVANPNVISDIAAAADAARAAATTARVN
FT                   IDINVVAIKPGEARSRLAEQTDGIEDKVVLAVDALVKRVRERILS"
FT   gene            complement(494487..496979)
FT                   /locus_tag="AAur_0484"
FT   CDS_pept        complement(494487..496979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0484"
FT                   /product="putative N,N-dimethylglycine oxidase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09079"
FT                   /db_xref="GOA:A1R230"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R230"
FT                   /protein_id="ABM09079.1"
FT                   /translation="MTSTPRIVIIGAGIVGTNLADELVTRGWNNITVLDQGPLNMPGGS
FT                   TSHAPGLVFQTNPSKSMALFAKYTVEKLLSLTEDGQSCFNQVGGLEVATTETRLADLKR
FT                   KLGYAQAWGIDGKILSREECKELYPLINEEDILGGLHVPTDGLALAARAVQLLIKRTEA
FT                   AGVKYIGNTEVTGIEQSNRRVTGVETADGVIPADIVVSCAGFWGAKVGELIGMSVPLLP
FT                   LAHQYVKTTPVPAQKGKNELPNGAQLPILRHQDQDLYYREHGDRYGIGSYAHRPMPVDL
FT                   DELGSYEPSSISEHNMPSRLDFTLEDFLPAWEATKQILPALRESEIEDGFNGIFSFTPD
FT                   GGSLVGESKEVDGFFVAEAVWVTHSAGIARAVAELLTTGKSQIDLGDCDIHRFEEVQLT
FT                   PEYVSETSQQNFVEIYDVMHPLQPKLSPRNLRVSPFHARHKQLGGYFLEGAGWERPYWF
FT                   EANAELLKEMPDDWQPPARDAWSGMFSSPIAAAEAWKTRTAVAMYDMTPLKRLEVSGPG
FT                   ALKLLQELTTGDLAKKPGAVTYTLLLDEAGGVRSDITVARLSEDTFQLGANGNMDTAYF
FT                   ERAARHQTENGGAGDWVQVRDTTGGTCCIGLWGPLARDLISTVSSDDFSNDGLKYFRAK
FT                   KVTIGGVTVTAMRLSYVGELGWELYTSADNGQRLWDALWKAGQPFGVIAAGRAAFSSLR
FT                   LEKGYRSWGSDMTTEHDPYEAGLGFAVKMTKENFVGKAALEGRSEESSARRLRCLTVDD
FT                   GRSLVLGKEPVFYKDQAVGYVTSAAYGYSVRKPIAYAYLPAAVSLGDSVEIEYFGRRIQ
FT                   ATVTEDPLYDPTMSRLRG"
FT   gene            complement(497038..497952)
FT                   /gene="purU"
FT                   /locus_tag="AAur_0485"
FT   CDS_pept        complement(497038..497952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="AAur_0485"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00655"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07986"
FT                   /db_xref="GOA:A1R231"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A1R231"
FT                   /protein_id="ABM07986.1"
FT                   /translation="MTLMATDSPVSTLPKPETLKDEQAQKFVLTLSCVERAGIVQAVTT
FT                   FLFERGFNIEEHQQFDDGLRQTLHLRTAFSGPLSYSPERLEEEFSAIADRFEMKFSFHD
FT                   QTKKRVLVMVSKFGHCLNDLIFRWRGGSLGGDLVVVASNHETHRAMAEAAGLPFVYIPV
FT                   TPDTKAEAEQRLLDLVEEYNVDLVVLARYMQVLSDDLCRALEGRAINIHHSFLPGFKGA
FT                   RPYHQAYDRGVKLVGATAHYVTADLDEGPIIEQEVIRVDHSYGPTTLSTVGQDAEALAL
FT                   SRAVRWHCEHRVLLDQTSTVVFR"
FT   gene            498072..498752
FT                   /locus_tag="AAur_0486"
FT   CDS_pept        498072..498752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0486"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10207"
FT                   /db_xref="GOA:A1R232"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R232"
FT                   /protein_id="ABM10207.1"
FT                   /translation="MAFGTLAITGDATKKSLADVAYERLRDRLLMLEIKPGDLLNDDQL
FT                   AKELEIGRTPVREALKRLELDRLVITYPRRGTFATRVEVTDLAFISEIRAQLEPLAAAR
FT                   AARVASAATKEHLREVMRNVEDFDVSAASVVETLRLDASVHQGIYAAAANPHLEDVLIR
FT                   YDNLATRIWCMVLDRLPDLEHHVREHLDLLRAVIDGDEEKAAELARVHVSGFEHAVRQA
FT                   LFAA"
FT   gene            498914..499828
FT                   /locus_tag="AAur_0487"
FT   CDS_pept        498914..499828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0487"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01680;
FT                   match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09749"
FT                   /db_xref="GOA:A1R233"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A1R233"
FT                   /protein_id="ABM09749.1"
FT                   /translation="MTTRPLLFEHIPLTGSSRVKRGMAEMLKGGVIMDVVNVEQARIAE
FT                   DAGAVAVMALERVPADIRAQGGVSRMSDPDMIDAIIAAVSIPVMAKARIGHFVEAQVLQ
FT                   SLGVDYIDESEVLTPADYINHIDKWNFTVPFVCGATNLGEALRRINEGAAMIRSKGEAG
FT                   TGDVSNATGHMRKIRSEIAKLAALPEDELYVAAKELQAPYELVKEVAATGKLPVVLFTA
FT                   GGIATPADAAMMMQLGADGVFVGSGIFKSGNPAERAAAVVNATAYYDDPDVIAKVSRGL
FT                   GEAMVGINVDDIPQPHRLAERGW"
FT   gene            499833..500057
FT                   /locus_tag="AAur_0488"
FT   CDS_pept        499833..500057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07295"
FT                   /db_xref="UniProtKB/TrEMBL:A1R234"
FT                   /protein_id="ABM07295.1"
FT                   /translation="MTDLSLVKTIHGRGLRKDWAQLTGRTVEVWLLDHHVLTGVVEQAA
FT                   DDDSVLWIAAEGLSTRKLFDKSTGYQIWA"
FT   gene            complement(500078..501010)
FT                   /locus_tag="AAur_0489"
FT   CDS_pept        complement(500078..501010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0489"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09231"
FT                   /db_xref="GOA:A1R235"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R235"
FT                   /protein_id="ABM09231.1"
FT                   /translation="MIDARLNTLRVFARCGTVGATAELTGYSPSAVSAQLRELQRLLGM
FT                   QLLTKDGRGVRLTATGRFLVAGSDALVAEWESLRAAAMEAGDQVQSRFGLGGFSTAAAQ
FT                   LLAPLAATLRSTRPLLEVQVLEANPARCFDLLVAERIDLAVIVAMQSDTYVEDDPRFEQ
FT                   RVLLDDPLDVIIPGDHPLASREMVTLEELASEPWITEAAGSTYHSLFTAAFTAVGVTPR
FT                   IAHEAVEWETQIAFVGAGLGVGLLPRLAPLHGAENVVRLRITGKGKPSRRIVAAVRRGS
FT                   IASPLIQESLGILQDRANRILTARPEDDL"
FT   gene            501180..502484
FT                   /locus_tag="AAur_0490"
FT   CDS_pept        501180..502484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0490"
FT                   /product="putative iron-sulfur cluster-binding protein,
FT                   rieske family"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07044"
FT                   /db_xref="GOA:A1R236"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1R236"
FT                   /protein_id="ABM07044.1"
FT                   /translation="MTAPVNLPLKSRGKLASSLPAEQLAEIAGLFEFRRTGYSLDAPFY
FT                   TDPTIFKIDMEAIFGEHWIFAGSVAELPEPGDYITVDYGPYSLIVLRNDDGGVNVLHNV
FT                   CRHRGARVLTEAAGSTGNLVCGYHSWTYSPEGNLIHASAPGETKFDKGCFGLKRAHSRV
FT                   VAGLIFVCVADEPPTDFDETSKIFEPYLAPHDLSKTKVAYQQNIIEEGNWKLVMENNRE
FT                   CYHCDGHPELACSLFPTWGLTEGLIPAHLEEVWDRNKEAQSSLEERCRRYGLPYEVVEE
FT                   LDTRIAGIRISRESLDGEGESFSADGRRLSKKLLGDLPDFRLGRCSMHLQPNSWFHFQS
FT                   DHVITFGVFPVNEHQTLVRTTWLVADDAVEGVDYDLDKLTYTWKQTNLQDKAFVELCQT
FT                   GAGSPAYEPGPYMKSEYQVEAFINWYVQRVQEHLA"
FT   gene            502559..503890
FT                   /locus_tag="AAur_0491"
FT   CDS_pept        502559..503890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0491"
FT                   /product="putative flavodoxin reductase"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06970"
FT                   /db_xref="GOA:A1R237"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1R237"
FT                   /protein_id="ABM06970.1"
FT                   /translation="MGSTEAPARAARALGPWHPQEFMAECVETVPEAGGLMTFVFRRCD
FT                   GAPLAFRAGQYVNIAFPVNGEDQDPVDRSYSLSSSPTEPWTFNISVKRDATGLVSPWVH
FT                   QNVKPGTVLEMLGPVGAFHLPDADRRARYLLLAAGAGITPIMSMVRTIHSLPGHADVVV
FT                   LYHGAEAGGFAFHQELAYIASVDSRIKVFYSLGDRNKPEGWEGLSGRLTAAMLDEVAPD
FT                   ANGRQVYACGPEGYLNTATELLGKVGVDDTSIYMEFFSGDRQTLLEYQAELALAVDIAE
FT                   EIAEEIADSAEDYYESQPTAFGLYEPGYDAEGPLQATGLPLETVDPEAPETSDGGSAAE
FT                   AEAEAPDASSFETVGTGSLTLSFMRTGINVRIDPTEHILGPAQRAGVRIGANCKEGMCG
FT                   SCKVVKLSGEVDMNHQGGIRAREIDAGKFLPCCSTARTDMVIDA"
FT   gene            complement(503925..505199)
FT                   /locus_tag="AAur_0492"
FT   CDS_pept        complement(503925..505199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0492"
FT                   /product="putative Transcriptional regulator, LuxR-family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10243"
FT                   /db_xref="GOA:A1R238"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1R238"
FT                   /protein_id="ABM10243.1"
FT                   /translation="MPQPTDFSWSLLDAIASIAKAPLNRIAEELRAATLPFLASSALVI
FT                   FTEDCTGRPQKKAGAEDIVSRVSIPELDRLRAAMEGEGPWRGPAVIGGQQREVLAFRYT
FT                   PSNALLVLSDPAPTPTDEDSAAVRMVTYLWQLAAARIQEKVSDAPPSYLLESRAASAER
FT                   VRVTGELVDQHSTTLETVLAALRSNSLDDHAARTFVTDVTVKALVGLRTLNDRTSNLVE
FT                   EPVATAFERLREDLRPLMHFSKIDIQFIEPPANGRALPGEVAHAARAVVRGLVLAIAEQ
FT                   SDVHRVRTQWDCDGENLLINVRDDGGGELSPEGPTLERLLQRVQAVDGTMTVDIMQGWG
FT                   ADISVVLPLDPPSTPAGDVAEWGLAARELEVLQLLAAGQRNRTIATDLGISENTVKFHL
FT                   RNLFRKLDVRSRTEAIALAHSAGLR"
FT   gene            505353..505943
FT                   /locus_tag="AAur_0493"
FT   CDS_pept        505353..505943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0493"
FT                   /product="putative 6-phospho-3-hexuloisomerase"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08860"
FT                   /db_xref="GOA:A1R239"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:A1R239"
FT                   /protein_id="ABM08860.1"
FT                   /translation="MNVTAESITFTSDDVASNVSLILGEVADTASGIDYSQVSRLADKI
FT                   NGAERVFLTGAGRSGLALRMAAMRLMHLGKTVHVAGDTTTPAISAGDLLVVASGSGTTS
FT                   GVVKAAQTALAAGAQLAAITTNSTSPLAGLADAVVVITAAQKTDHVSNISRQYSGSLFE
FT                   QSLFLVTEAVFHTLWGATDEPAEQLWLRHANLE"
FT   gene            505996..506619
FT                   /gene="hps"
FT                   /locus_tag="AAur_0494"
FT   CDS_pept        505996..506619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hps"
FT                   /locus_tag="AAur_0494"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="identified by match to protein family HMM PF00215"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08403"
FT                   /db_xref="GOA:A1R240"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A1R240"
FT                   /protein_id="ABM08403.1"
FT                   /translation="MKLQVALDLLTIEDALELAGKVAEHVDIIELGTPLIKAEGLAAVT
FT                   AIKKAHPTKIVFADMKTMDAGELEADIAFKAGADLVSVLGTADDSTIAGAVKAAQSHNK
FT                   GIVVDLIGVADKVTRAKESRALGAKFIEFHAGLDEQAQPGFDLRGLLNAGEEARVPFSV
FT                   AGGVNASTIAAVQLAGADVAVAGSAIYSAADPELAAKELKAAIQ"
FT   gene            complement(506627..508780)
FT                   /locus_tag="AAur_0495"
FT   CDS_pept        complement(506627..508780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07754"
FT                   /db_xref="GOA:A1R241"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:A1R241"
FT                   /protein_id="ABM07754.1"
FT                   /translation="MAGWNSDTAAGPLGSGTVTLVEGSSFCISSANGDIHPELPHGVFH
FT                   LDTRILSRWELTINGQMIEPLAAETREPYRALFVGRVPHSDGYADSPLLVERLREVGTG
FT                   ILEEITVRNYSRQPAECRILLTAETDFADLFEVKEARITREWTETRIPDGNSLEIRGKW
FT                   EGIRKSVVIRAEGAGAGARALGFTAKIPASGSWSTRVTVVPTVDGAGTPFAHPSRGELS
FT                   PSDRRRQEWVAKIPRLQVGNRSIERTLRRSYEDLGALRIQDPDHPDRVVVAAGAPWFMT
FT                   LFGRDSLWASEMALAVDPSLALGTLRTLADRQGTVVDTTSEEEPGKILHEVRLDVSSGL
FT                   ALGGKSAYYGSVDATPLFVIVLGSVSRWGFAKDVISELLPNADRALEWIRDYGDRDGDG
FT                   FVEYGRPNQHGLINQGWKDSWDGINFADGTIAEPPLALCEVQAYVHGAYMARAWMAYDD
FT                   GDLTLAAELRERADRLKRKFNEDFWLPDKGYYAVALDKDKRPVDACASNMGHCLWFGLV
FT                   DEDKAPLVVERLMSPEMFSGWGVRTLASDMGAYNPASYHNGSVWPHDNALIAAGLLRYG
FT                   FVEEAQRIATALLEAAEFSGGRLPELFCGFDREQFREPVPYPTACSPQAWAATTPIQLI
FT                   TGLMRYDAHISLGGVWLDPVLPESYGDLHISNAPMGSGRITIDVVGSSSRVQGLPEGLE
FT                   LHRAQRPWITELVERAELRRSEQ"
FT   gene            509059..509397
FT                   /locus_tag="AAur_0496"
FT   CDS_pept        509059..509397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06911"
FT                   /db_xref="UniProtKB/TrEMBL:A1R242"
FT                   /protein_id="ABM06911.1"
FT                   /translation="MTDTQIGSFIRDCVVFEDDTENGLDFDTFYGLYISWCVLGRKIPI
FT                   PDSAFKTALELEGVKPIKENGRRIYPGMSMVGPAARDYVVNSVPVWSETATDIPVSEIR
FT                   QQAVASIA"
FT   gene            509488..510885
FT                   /locus_tag="AAur_0497"
FT   CDS_pept        509488..510885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0497"
FT                   /product="putative deoxyribodipyrimidine photolyase"
FT                   /note="identified by match to protein family HMM PF00875;
FT                   match to protein family HMM PF03441"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06343"
FT                   /db_xref="GOA:A1R243"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A1R243"
FT                   /protein_id="ABM06343.1"
FT                   /translation="MKPSIVWFRDDLRVADNPALRAAVDDGAAVALYVLDEESPGIRPH
FT                   GGAARWWLHHSLTALRGDLDKLGVPLLLRRGPATDVLRETTTAIGAGGLYWNRRYGSAE
FT                   RTVDADIKAWAGEAGLHVSSFQASLLHEPWEVTTKTGGQYKVFTPFWRTVSAQDFREPL
FT                   AVPEAGHGFTGKLPVYDQLESWQLLPTKPDWSGGLAEMWTPGAAAGHKRLARFVADGLS
FT                   NYSEGRNRPDTDGSSCLSPYLRWGELSPFEVWHALGSKRSESASIYASELGWREFCWHQ
FT                   YFHNPQLATANLRPEFDRFPWAWPGKNGNGNGGRHPGHESAPEEFRAWQQGRTGFPMVD
FT                   AGQRQLWHTGWMHNRVRMVAASFLVKNLGIHWQLGEQWFWDTLVDADPASNPANWQWVA
FT                   GSGADASPFFRIFNPEAQRVKFDPQGRYIAHWLPDFGTPEYPEEIVDLKTTRAEALEAY
FT                   KEMREVH"
FT   gene            511051..511500
FT                   /locus_tag="AAur_0498"
FT   CDS_pept        511051..511500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0498"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09382"
FT                   /db_xref="GOA:A1R244"
FT                   /db_xref="UniProtKB/TrEMBL:A1R244"
FT                   /protein_id="ABM09382.1"
FT                   /translation="MPKVVPIVGWLFLSVGLLMSLVSFTYDRSPLGARITAVAIFLGGL
FT                   AFVLMYRNWYVAPRAHEVAFRTVLGKEHVVPYSDIANYRVQVMKGQPILTVKSIHGVKL
FT                   SLNIRTYDVTPLMTAIDFHKVTGHWPARADVVGEGAGAEKHPSGN"
FT   gene            511622..513121
FT                   /gene="mmsA"
FT                   /locus_tag="AAur_0499"
FT   CDS_pept        511622..513121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="AAur_0499"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08928"
FT                   /db_xref="GOA:A1R245"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1R245"
FT                   /protein_id="ABM08928.1"
FT                   /translation="MVRELSHYVDGQRIDGTSGRFSDVYDPCTGEVQARLPLASADEVR
FT                   DAVANAEKGQLEWAAMNPQRRGRILLKFVDLVNQNMDELAKLLSSEHGKTFADAKGDIQ
FT                   RGIEVVEFSAGAPHLLKGEFSDNAGQGIDVHSLRQPLGVVAGITPFNFPAMIPLWKSGP
FT                   ALAAGNAFILKPSERDPSVPLRLAELYSEAGVPNGVFNVINGDKEAVDALLEDPRVKAI
FT                   GFVGSTPIAQYIYATAAAHGKRAQCFGGAKNHMVIMPDADLDMAADALIGAGYGSAGER
FT                   CMAISVAVPVGQETADALVDKLTERVKHLKVGHSLDKDSDFGPVVAASAKERIEGYIQS
FT                   GVDEGATLVTDGRGLTVDGYDGGFWVGPTLFDNVTKDMKIYKEEIFGPVLSVLRAADYD
FT                   EALRLCSEHEFGNGVAIFTRDGDSARDFASRVEVGMVGINVPIPVPIAYYTFGGWKASG
FT                   FGDLNQHGADAFRFYTKTKTVTSRWPSGIRQGASFIMPAGS"
FT   gene            513121..514185
FT                   /locus_tag="AAur_0500"
FT   CDS_pept        513121..514185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0500"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08526"
FT                   /db_xref="GOA:A1R246"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R246"
FT                   /protein_id="ABM08526.1"
FT                   /translation="MESVGSDEEVLFERRGNLGIVTLNRPKAVNALNAGMVKTMLSQLT
FT                   DWAADDAVATVLVRGAGDRGLCAGGDIVAIYKDMLHGGTETAEFWADEYRLNALISHYP
FT                   KPYVAFMDGLVLGGGVGISAHGSVRVVTERTRTGMPETTIGFVPDVGGTLLLSRSPGET
FT                   GTHAGLTGAHLSGADALFLGLADHFVPSQSLPALAEALESSTATAAVERFAQAAPDSAL
FT                   AAQREWIDAAYAHDDAEEIVRSLRTLGDEAAAAADTIEAKSPTSVKVALESLRRVHGMS
FT                   LEEALDQEYRVGLRCLAGPDFREGIRAQVVDKDRNPQWKPATLAEVQASDVEGYFAPLG
FT                   ERELGLSVSPVQAN"
FT   gene            514197..515138
FT                   /gene="mmsB"
FT                   /locus_tag="AAur_0501"
FT   CDS_pept        514197..515138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="AAur_0501"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM TIGR01692"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06586"
FT                   /db_xref="GOA:A1R247"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R247"
FT                   /protein_id="ABM06586.1"
FT                   /translation="MTENAAMSDIQVPATGLIAFLGLGHMGGPMAANLIKAGHDVVGYD
FT                   PVPAAVEAALAHGIPMASTAHEAAAEAAVVLTMLPSGKHVLDAYRGVDGPGLLSVAKPN
FT                   TLFLDCSTINVDEAREAAVIALEAGHRSVDAPVSGGVVGAEAGTLTFMVGALPEDFETV
FT                   KPILELMGKRIVHCGDHGAGQAAKVCNNMILGVSMIAVAEAFVLGEKLGLTHQALFDVA
FT                   SNASGQCWALTTNCPVPGPVPTSPANRDYQPGFAGALMAKDLRLAVNALESTGVAAEMG
FT                   PLASRIYDAFAAGEGAGRDFSGIITEIRDKSV"
FT   gene            515184..515963
FT                   /locus_tag="AAur_0502"
FT   CDS_pept        515184..515963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0502"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09826"
FT                   /db_xref="GOA:A1R248"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1R248"
FT                   /protein_id="ABM09826.1"
FT                   /translation="MTEQYQNIVVEHRGRVGLVTLNRPEALNALNTALMNELVDAVTAM
FT                   DTDPDVGAVVITGSAKAFAAGADIKEMSSNSYMEMYAADWFRRWEDLTRLRIPVVAAVS
FT                   GFALGGGCELAMMADFIIAGDNAKFGQPEINLGVIPGMGGSQRLTRAVGKAKAMDMVLT
FT                   GRFMDAEEAERSGLVSRVVPAAEVIDEALKAAEVIASKSKPAAMVAKEVVNAAFEMGLA
FT                   QGVVFERRVFHSLFATEDQKEGMAAFSEKRQPEFKHR"
FT   gene            516132..516920
FT                   /locus_tag="AAur_0503"
FT   CDS_pept        516132..516920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07203"
FT                   /db_xref="UniProtKB/TrEMBL:A1R249"
FT                   /protein_id="ABM07203.1"
FT                   /translation="MSSVTPLEKAAQRSRHLLPLVTIALIGCLGGCEYEPDSIAFPSVS
FT                   SPITEARTVPPLPESRDTRTVPSLPESGDIDAGTYLVPVAGYKEPFEITVPAGWFALDG
FT                   HSLGKDDPNHPAEWAVYLTLSRAYYVAKDACIWRGALADSGPSAEAFVDAMAAQSSTAS
FT                   TPPAKVMVGNYSGFEFHHSVEGNVDITACNGGQLCIHSEDTQRCSRWYLTQNEHETYRV
FT                   VDLNGQRAVAAVGHIDESIDPELMREARALFDSIVFRSAK"
FT   gene            517618..517926
FT                   /locus_tag="AAur_0505"
FT   CDS_pept        517618..517926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09677"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A1R250"
FT                   /protein_id="ABM09677.1"
FT                   /translation="MNCWKVERLSLTEIIAPALNGLRRHVFSRQLKAAPWGSLSLGETF
FT                   FAAGEVDAVRLVVMPVGQGSGRGVFPAGHHPALLKLEDVNSYDQGLVELSYTVRKRP"
FT   gene            complement(517923..518588)
FT                   /locus_tag="AAur_0504"
FT   CDS_pept        complement(517923..518588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0504"
FT                   /product="tenA protein"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07067"
FT                   /db_xref="GOA:A1R251"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="UniProtKB/TrEMBL:A1R251"
FT                   /protein_id="ABM07067.1"
FT                   /translation="MGFAEELKNQYAEDWDAAVNHPFVDQLLDGSLSDDHLRGYLVQDY
FT                   QFCDAFTALLGQAVASAPSLPSRLVFAAVLGAFASDENTYFQDCFNELDVPEADRAAPA
FT                   LGPATRNFDHLMRSTLATRSYPKVLAVLLVAEWLYGDWAARAGEPARWPAHAKHAEWIR
FT                   LHNNPEYNAWVTWLRDEFDAVEPVDVAERQGVAATFAEAVRLERAFFDAALVPADASV"
FT   gene            518696..519562
FT                   /locus_tag="AAur_0506"
FT   CDS_pept        518696..519562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0506"
FT                   /product="putative universal stress family domain protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07559"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1R252"
FT                   /protein_id="ABM07559.1"
FT                   /translation="MTNQRTMVVGYDGSEESNLAVQWAAKHAILRDCSLHVVHCSLWVL
FT                   LSHNRGPVPGVADSGLERAAQKVLEEGMALAKETVPDLEVRTTLLHGMPRDHLAHVSVG
FT                   AEMLVLGSRGLGGFMGLLVGSVSLEMAATAECPVVVIRADDHPEGPVLLAVDDAGSPAA
FT                   LEDACDFAAATGADLMIVHVLHEPVGYRRLREPVEAYPEAEALLDSVLSQARHKAPGIA
FT                   VTGELLVDASFSKAIVKASQGARITVLGTKGHGLIKGTIGSTAHAVLHHAHSPVLVSRR
FT                   RATSEVA"
FT   gene            519780..520976
FT                   /locus_tag="AAur_0507"
FT   CDS_pept        519780..520976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0507"
FT                   /product="putative HNH endonuclease domain protein"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07998"
FT                   /db_xref="GOA:A1R253"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1R253"
FT                   /protein_id="ABM07998.1"
FT                   /translation="MKSAITALQARVAVAFDLAQRAEQAEAGVPASERGRGVGAQVALA
FT                   RRESPNRGGRLLGLAKALVTEMPRTLAALQSGYLNEWRATLLVKETACLSAEDRCAVDE
FT                   ELAPDAGTFDGKGDKAIIAAAKAAAYRRDPRSVVGRASRAAAERTVSLRPAPDTMSYLT
FT                   ALLPVAQGVAVYKALTQAADSARSSGKAKSFEDVGSGRVVRPRGQIMADTLVERITGTP
FT                   GGISGITIDLVMTDRTLFQGDSEPARLQGYGVVPAEWARTVVGEEQSARDREFSVWLRR
FT                   LYTAPATGDLLATDSKARLFSGRLRRFIETRDDSCRTPYCDAPIRHIDHVIPWHSGGQT
FT                   NLGNGAGLCEACNHTKENPGWSTRAVDADVHTLEISTPTGHTYQSKAPPLPGHRPSRT"
FT   gene            complement(520999..521508)
FT                   /locus_tag="AAur_0508"
FT   CDS_pept        complement(520999..521508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0508"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09827"
FT                   /db_xref="GOA:A1R254"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R254"
FT                   /protein_id="ABM09827.1"
FT                   /translation="MGTPLPRDPIADAQRNWERHGWGDVAAPMAAITAIMRTQQILLAR
FT                   IETVLKPFGLTFARYELLALLSFARSGALPMNKASALLQVHPTSVTNAVDRLEKAALVA
FT                   RSPHPTDGRTTLIELTAEGRTLAKKATTALNAEVFGKSGFGADDVDHLIRVLGTFRRDA
FT                   GDFTEE"
FT   gene            complement(521551..523269)
FT                   /locus_tag="AAur_0509"
FT   CDS_pept        complement(521551..523269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0509"
FT                   /product="putative acetyl-CoA synthetase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08411"
FT                   /db_xref="GOA:A1R255"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1R255"
FT                   /protein_id="ABM08411.1"
FT                   /translation="MTVTEDFRAARDRLLELREDYKQAHSEFQWPRFEEFNFALDWFDQ
FT                   IAADETRGSKPALVIVEQDGSSTRRTFKDLSQRSSQLANWLRDQGVKRGDHMIIMLGNQ
FT                   VELWELMLAGIKLGIVMIPTTTLMGARDLQDRVERGGATWVAVGSANIGKFADVEGDYT
FT                   LVEIGAQRTNADAKQYADSYDAGTDFTPDAPTRADETLLLYFTSGTTSRAKLVEHTHTS
FT                   YPVGHLSTMYWIGLEPGDVHLNVASPGWAKHAWSNVFTPWIAEATVFIYNYQRFDAAAL
FT                   MDQMGREGVTSFCAPPTVWRMLIQADLTQLTSPPRKVVSAGEPLNAEVIGQVEEAWGVT
FT                   IRDGFGQTESTVQIANTPAQSVKIGSMGRPLPGYDVVLVDPLTGQESDDGELCLRLDPR
FT                   PVGLMKSYFGDEAKTAEAFRDGYYHTGDMASRDSDGVITYVGRDDDVFKSSDYRLSPFE
FT                   LESVLIEHPAVAEAAVVPSPDAVKLSVPKAFVVLAAGYEPGPAVAEDILKYCREHLAPF
FT                   KRIRRLEFGELPKTISGKIRRVELRGSEVARHGDGPLPAGLGVEYTEEEFPNLKD"
FT   gene            523403..524620
FT                   /locus_tag="AAur_0510"
FT   CDS_pept        523403..524620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0510"
FT                   /product="putative glutaryl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07267"
FT                   /db_xref="GOA:A1R256"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1R256"
FT                   /protein_id="ABM07267.1"
FT                   /translation="MLDEKAAGTVTSGAVSERVLPPYPEADLMHVIDLLPTEERARYLE
FT                   IREFLQTRIRAASIDYWNREEFPFGLLADMAKFGLGGLQTDGSSKLFKGLMYTEIARAD
FT                   VSLSALVGIHNELIVGMIHELGSDEQKRKWLPGLEAFTQLGAFALTEPDHGSDIAGGLS
FT                   TTARRDGGEWVINGAKRWIGAGTIADFALVWARDLADGHIKGFIVETDRPGYSATKISN
FT                   KIGLRIMQNAAIVLDEVRVPLENLLPGATEFSRANDLLRDSRAWVGWQAAGIQLAAFDI
FT                   ARSYALERKQFGKELARFQLVQQQLADILGNANASLSMMVELARIQQAGKLEMVQAAMC
FT                   KATTTRLARSSVSMGRSLLGGNGITTDYEMAKLFGDAEILYTYEGSYEINSMIVARAVT
FT                   GKSAFV"
FT   gene            complement(524681..526261)
FT                   /locus_tag="AAur_0511"
FT   CDS_pept        complement(524681..526261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0511"
FT                   /product="putative amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10202"
FT                   /db_xref="GOA:A1R257"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1R257"
FT                   /protein_id="ABM10202.1"
FT                   /translation="MSEPSKIGPCKSDASGMDEFGYAQTLDRSIGKFASFAAGVSYISI
FT                   LTGVFQLFYFGFSTAGPAYAWSWPIVFVGQLMVALCFAELAGRYPVAGSVYNWAKRLST
FT                   GTWAWLAGWLLLLSSIMALGSVALALQITLPQIWSGFQLVGDGTGPYDFAVNGVILATI
FT                   MIGISTLINAFGVKLMTMINSVGVFVELVAAVLLIAALIWHSVRGPEVLLDTAGFGEEH
FT                   PLGFFGVFLIAAMASGYVMYGFDTASSLGEETKDPKRTAPRAILRAVTASFLLGGLLLL
FT                   GGILAAPDLSDPKLGAADGGLQYIVLSVLGGPFGKAFLACIVVAVVVCTLAVHAAAIRM
FT                   MFAMARDNNLPFSRQLGKVHPTRKTPTVAAIVIGVVAVIPLIVNISQPAIFTILSSISI
FT                   VLIYLSYLLVTVPMLRRRFLKKWPLKDDGSEPGFSLGKWGLPVNILAVLWGGAMTLNLV
FT                   WPRPEIYSSVPPFEWYLQWGGVMFVAAVIIGGTLLYRLRIRHRTGVLAEHAAAVTTPPD
FT                   PALVAAPNS"
FT   gene            complement(526407..528059)
FT                   /locus_tag="AAur_0512"
FT   CDS_pept        complement(526407..528059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0512"
FT                   /product="choline oxidase"
FT                   /EC_number="1.1.3.17"
FT                   /note="identified by similarity to GB:AAS99880.1; match to
FT                   protein family HMM PF00732; match to protein family HMM
FT                   PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06581"
FT                   /db_xref="GOA:A1R258"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R258"
FT                   /protein_id="ABM06581.1"
FT                   /translation="MHTDNIEDLSERGFDYVIIGGGSAGAAVAARLSEDPAVTVALVEA
FT                   GPDDRNLPEILQLDRWMELLESGYDWDYPVEPQENGNSFMRHARAKVMGGCSSHNSCIA
FT                   FWAPREDLDEWESKYGATGWNADAAWPLYQRLESNEDAGPDAPHHGDSGPVHLMNVPPN
FT                   DPAGVALLDACEQVGIPRTKFNDGTTVINGANFFQINRRSDGTRSSSSVSYIHPIVDRE
FT                   NFTLLTGLRARQLVFDAEKRCTGVDVVDSAFGRTHRLSAHREVILSTGAIDSPTLLMLS
FT                   GIGPAAHLEQHGIEVLVDSPGVGEHLQDHPEGVVQFEAMQPMVQASTQWWEIGIFTPTE
FT                   EGLDRPDLMMHYGSVPFDMNTLRYGYPTTENGFSLTPNVTHARSRGTVRLRSRDFRDKP
FT                   MVDPRYFTDPDGHDMRVMVAGIRKAREIAGQPAMAEWTGRELSPGIEAQTDEELQDYIR
FT                   KTHNTVYHPVGTVRMGPVDDDMSPLDPELRVKGVTGLRVADASVMPEHVTVNPNITVMM
FT                   IGERCADLIKADLSASRTEETTTAEADFSLSLA"
FT   gene            complement(528060..529607)
FT                   /gene="betB"
FT                   /locus_tag="AAur_0513"
FT   CDS_pept        complement(528060..529607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="AAur_0513"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06484"
FT                   /db_xref="GOA:A1R259"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1R259"
FT                   /protein_id="ABM06484.1"
FT                   /translation="MNRCSRCTNLHRMTQATFSDSPSTLFINGRWEPAASGAVSRIHNP
FT                   ADGELVATVSEAGREDTERAIAAARAAFDSGVWSSVPAPERGAFLLKVAAELRERREKF
FT                   ARAESLDTGKRIIESRIDIDDIAACFEYFGRLAGQSAGRVVDAGDPTVVSKIVYEPVGV
FT                   CGLITPWNYPLLQAAWKIAPALAAGCTFVLKPSELTPSTAILTMQLLQDLGLPDGVANL
FT                   VTGPGAQAGAPLSEHPDVDLVSFTGGLETGKRIAAAASGTVKKVALELGGKNPNVVFAD
FT                   ADFDAAVDNALNGAFVHSGQVCSAGARLVVEESIAERFVDELVRRAQDIRLGGPFDESA
FT                   ESGPLISAAHREKVDAYVQRGVAEGARLRCGGAAPEGEKFDAGFYYQPTVLDRVQRGMS
FT                   VVVDEAFGPVVTVETFRTEDEAVATANDTIYGLAGAVWTQDAGKAQRVAGRLRHGTVWI
FT                   NDYHPYLPQAEWGGFGQSGVGRELGPTGLGEYQEAKHIYQNTSPQVTGWFADHGKEK"
FT   gene            complement(529653..530423)
FT                   /locus_tag="AAur_0514"
FT   CDS_pept        complement(529653..530423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0514"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09010"
FT                   /db_xref="UniProtKB/TrEMBL:A1R260"
FT                   /protein_id="ABM09010.1"
FT                   /translation="MTPSPYRTPFFALLSSAFVLAALGGCSIGAPATTEASSTAPTSST
FT                   TSQSAAQGAASPKEAASPKEAASSKEAVGAGGDSPGGRLDAATEDLTWANGNRILGDEN
FT                   GGHTPDIASSLTDPTAGWVGDYSRMAADGMMTFSSENTRCKIRTVQVRNQPSELVPGDD
FT                   RASTLKVLTILFPNKTELIASAKDATLGFSAAGNRDVDMLAVSYTSGDAFGYTVVRTFN
FT                   KPAVTLKVEALCPTLETLKATLPEMRKNITINAL"
FT   gene            530516..532198
FT                   /locus_tag="AAur_0515"
FT   CDS_pept        530516..532198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0515"
FT                   /product="putative molybdopterin oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00174;
FT                   match to protein family HMM PF03404"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09339"
FT                   /db_xref="GOA:A1R261"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1R261"
FT                   /protein_id="ABM09339.1"
FT                   /translation="MTSQKRGPSGSSTLISENACTHPCPRLLRTTLMKKLGLRTKGTET
FT                   MAALAGVVSAAVVLAIAELIGAFFTARATPVFALGSTFIDFTPSWLKDFAIATFGTNDK
FT                   AALFVGMGLTIAVLACVLGIVAYRKWALGVLGVLFMGAVIVACVLTRAGVGPADAIPSV
FT                   VGTVSGLFVLRRLMVPLWGAKAWPEAPADIAADADNQAGGAGTSRRRFFATAGITAVAA
FT                   GIAATGGRLLGAARNNIAQARDALRLPTPVRAAPPVPAGVQSPVPGVLPWLTPNSEFYR
FT                   IDTALSVPEININDWELRVHGMVEEEVTLTFQDLLDADLIESHVTLTCVSNPVGGKLAG
FT                   NAKWLGLPIREVLARAKPKEGADMVLSTSIDGFSASTPLEVLQDDRDAMLAIGMNGEPL
FT                   PVEHGYPVRMVVPGLYGFVSATKWVVDLEVTRFADSKAYWTQRGWSERGPIKTMARVDV
FT                   PKSFAKFPPGKVAVGGTAWAQTRGITKVEVQIDDGEWVEATLSTEASTITWRQWSYEWD
FT                   ATPGIHYVKARATDGTGEVQTDKRADPVPDGASGWPSVMVTVE"
FT   gene            complement(532478..533062)
FT                   /gene="betI"
FT                   /locus_tag="AAur_0516"
FT   CDS_pept        complement(532478..533062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="AAur_0516"
FT                   /product="HTH-type transcriptional regulator betI"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08659"
FT                   /db_xref="GOA:A1R262"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A1R262"
FT                   /protein_id="ABM08659.1"
FT                   /translation="MGTSTVKSGEQADRQTRILEAALELLSRHGISGINMRAVAREAGV
FT                   ALGLVNYYYEDKSSLIRAVLRQIEEHDLLLVEPVSTSTPDEQLRESLRRVADPGLLTTP
FT                   YLSLRLHLWALAQADEDFARINAAAFDRYLQGLAALIGNAVPGLSPDECSDRAADIVVV
FT                   QNGMWLTTLLGIDKAAIERGIARTEQIAFAS"
FT   gene            complement(533107..533865)
FT                   /locus_tag="AAur_0517"
FT   CDS_pept        complement(533107..533865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0517"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF07739"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08977"
FT                   /db_xref="GOA:A1R263"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A1R263"
FT                   /protein_id="ABM08977.1"
FT                   /translation="MDWSIQEIAKIAGTTSRTLRHYDDIGLLKPSRTGHNGYRYYDGPA
FT                   LVQLQRILLLRELGLGLPAIAEVLDRDTDTVKALSSHMEWLAREQDRLTRQITSVRQTI
FT                   DTMKGDGKYMAQDMFDGFDHTQYKDEVEERWGKDAYAASDSWWRGMSADEKQQWKERAQ
FT                   KLGADWISAAESGVSAESTEAQDLARRHVEWLRGIPGTPTAAPGGDVKGYVTGLGEMYV
FT                   ADPRFAANYGGESGATFVRDALRAYAETNL"
FT   gene            complement(533943..534593)
FT                   /locus_tag="AAur_0518"
FT   CDS_pept        complement(533943..534593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0518"
FT                   /product="putative transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08232"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R264"
FT                   /protein_id="ABM08232.1"
FT                   /translation="MKGINEHDNTFPEHGHGHPEHGHGRGRFNRGKGRRGPGGHGGGGF
FT                   GPGFGPGGFGPGFGPGFGPRGFGPGGSRRANRGDVRAAILSLLAEAPSNGYGLIKTIAE
FT                   KTSGAWRPSPGSVYPTLQQLVDEELIVAVGEGRRTEFTLTDDGKAYVAEHEEELANAWN
FT                   TEADGTGAAFHQSVGKLMGVIHQFRAAATDEQRQAAIEKLDETRRALYLILAD"
FT   gene            complement(534762..535583)
FT                   /gene="nadE"
FT                   /locus_tag="AAur_0519"
FT   CDS_pept        complement(534762..535583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="AAur_0519"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by match to protein family HMM PF02540;
FT                   match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07216"
FT                   /db_xref="GOA:A1R265"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:A1R265"
FT                   /protein_id="ABM07216.1"
FT                   /translation="MRELQAKIIEEMGVQPRINPAEEVRKRVGFLKDYLKATHTKGFVL
FT                   GISGGIDSSLAGRLAQLAVEELEAEGMDANFVAVRLPYGIQHDEDDAQAALDFIKAKTE
FT                   WTYNISQAVDGFEEEFEKTTGAPISDFHKGNTKARARMIAQYALAGEHNYLVIGTDHGA
FT                   ESVTGFFTKFGDGGADILPLFGLNKRQNRALLAELGAPSRVWEKVPTADLLDNKPGRTD
FT                   EDELGITYDTIDDYLEGRDVPEDAAELLEQKYLRTRHKRTVPVTIFDTWWK"
FT   gene            complement(535651..536667)
FT                   /locus_tag="AAur_0520"
FT   CDS_pept        complement(535651..536667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0520"
FT                   /product="putative transcription regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07799"
FT                   /db_xref="GOA:A1R266"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R266"
FT                   /protein_id="ABM07799.1"
FT                   /translation="MGETSARATAPTIRDVAERAGVATSTVSRALSNPDRVNRVTRERI
FT                   EKVAAELNYVPSSQARGLSSGRTNAIALLVPDVTNPFYFDIIRGTQNQLKAAGYTQLLV
FT                   DTEESAEMEADTLRKMQRTADGFILAASRLTDAQILEAASSQAIVTINRSSSNAPAVVI
FT                   DTPAAVVQALEHLTSLGHGKICYVGGPASSWSNAKRWKTFEDESRERGITTSRVGPFTP
FT                   KTTSGAAAADAAVRTGATACIVFNDLLAIGMLQRLRERGIRVPEDMSIVGCDDIFGADF
FT                   CNPPLTTMASPIEQAGRVAVSMLLAQLDPLNSGSSRRLAVMPTHLTVRGSTGPAPSH"
FT   gene            536802..538160
FT                   /locus_tag="AAur_0521"
FT   CDS_pept        536802..538160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0521"
FT                   /product="putative extracellular sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07938"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1R267"
FT                   /protein_id="ABM07938.1"
FT                   /translation="MKFAPSAKLAAVLATAALALTACGGSGSSSDSTGGAVDGAGKKLS
FT                   VLTGVNNQYPEQQKEWFKDIAAKFKAKTGADVEFETFASANDELTRIQTSVVSGQGPDV
FT                   YSLGTTFTPTAYATKAFVTLSEDDWKKVGGKDRFNQAALGISGPDADHMAGIPFVSRPF
FT                   VMAYNKDLLAAAGIEKPATTWDELAEQAKKMTNAGAGTYGLATGYKDNFDPWKFIWAMS
FT                   VQAGNPLVDGDKLKMDDPTVKKAYETYFGWLTKDKVVDPAAIGWSNSNAVAAFASGKAG
FT                   YLMMTTSSSVPTLDKSAIAGKYAYSVMPTTAPGETAPKGDGDKAASILSGDNVVVADYS
FT                   QQKDLAFAYIELITSKDEQLNYQKIFGELPANAEALAALTDPKLQPIADAAGKSKATPF
FT                   TGAWGDIQLGLLNVTVQSIPDLANGSVDNSALESRLKDAQSKGQASLDRAAKS"
FT   gene            538251..539225
FT                   /locus_tag="AAur_0522"
FT   CDS_pept        538251..539225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0522"
FT                   /product="putative ABC transporter, sugar permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09691"
FT                   /db_xref="GOA:A1R268"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R268"
FT                   /protein_id="ABM09691.1"
FT                   /translation="MSDAGTSPVAGAGTSQPAGRGKKPVRRKGLSERNRPLWMLIPGGL
FT                   LMFVIIVIPLFLGIYMSALNLDQYTLRKWVSAPFIGIDNFVEALTDSPLLHSVWLSVSY
FT                   SLIAMVITLPLGIAAAVATQNAFKGRALVRSIFLIPYVLPSFVVATVWRTMFQPDGVVD
FT                   SALGLFGMDGGLWLNGPQTYWTLILVQIWASWPFIYLLALSGLQSVDHEVHEASALDGA
FT                   LWWNKLRYVIFPYLKGPLALAFLIGMLHHINNFTLPFVLFGVPAPADVEVLPILTYVTS
FT                   FQSFRFGLSAAMAFVSLVLIAIPLFIYLRAVKLDDAETPGGKK"
FT   gene            539312..540157
FT                   /locus_tag="AAur_0523"
FT   CDS_pept        539312..540157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0523"
FT                   /product="putative ABC-type sugar transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09819"
FT                   /db_xref="GOA:A1R269"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R269"
FT                   /protein_id="ABM09819.1"
FT                   /translation="MTRLLPGPMLAIILTVLSAIVLIPVAYIFLASVNSDIGVANGEFW
FT                   PSTFSLENYTKIWSSVGLAKGLANSVLVAGATAVVSAAMSVSIAYVLVRYQFGGRLTIL
FT                   RSLLALQSVPGTLMVLPVFVLFSSAASYLGVQVIGTQWGLFITYLTFAMPFSTWVMVTY
FT                   LRGLPRELEEAARIDGASNLGVLVRIILPLSWPGIVVSGIFAFLLGWNDVLFASVMTRP
FT                   DSQTAAVALQIFGASQEGGAIPLYGQMMAASLVCAAPVVILYLIFQRYLVGGLTAGGVK
FT                   "
FT   gene            540160..541008
FT                   /locus_tag="AAur_0524"
FT   CDS_pept        540160..541008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0524"
FT                   /product="putative sugar phosphate isomerase/epimerase"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10252"
FT                   /db_xref="GOA:A1R270"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1R270"
FT                   /protein_id="ABM10252.1"
FT                   /translation="MTGSATIEWTLSGFGDEIDDDPVLQIAVLQALGANHIEVRSAWGT
FT                   NIVDLAPEQLAELKNLLDKAGMGVSAIASPIGKVDVTLPVEHEVERLRRAANAAQVLGA
FT                   RYIRIFSFYYGEGVAVDSIRDDVIERMRALAGVAEETGVVLLHENEKDIFGDTPDRVLD
FT                   IIESVASPALKVAWDPANFVQVGVKPFDEGYAKLRPHLEYLQVKDARFADGVVVPAGEG
FT                   DGDLLRTVEALKADGFVGFASLEPHLAGAHGLGGFSGPTAFGMAARAFAKVVTEAGVET
FT                   K"
FT   gene            541005..542201
FT                   /locus_tag="AAur_0525"
FT   CDS_pept        541005..542201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0525"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894; match to protein
FT                   family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09028"
FT                   /db_xref="GOA:A1R271"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R271"
FT                   /protein_id="ABM09028.1"
FT                   /translation="MSKQTPTAVLNVAITGCGTIGRTHAASVGEIADLRVTALVDEIAE
FT                   AAEGLAQHIEDNGAARPATFRSLAEAFAGADVDLVIIATPSGLHIQQALEVLDAGKHVV
FT                   IEKPLDVNLDRAAEILAAAKTAEAKGLVASVISQHRFDPASIVVDEARRAGRFGRLTSA
FT                   IASVSWYRSQGYYDSGAWRGTWAMDGGGAVMNQGVHTVDLLLWFLGRPLEISAKTALLA
FT                   HTDVEVEDTAVATVTFESGALAVLHATTAAYPGLTVRLQVMGSKGSAVIDNDHLEYFHA
FT                   AASDEETQSGPMGLPGASNQAESELARFAEPATRTNLDPTLYPAGHIRQYRDVVEAIRT
FT                   GRPAGVTIKDAVTALATVRALYVSATLGHPVLIADVTAGKYNDVQVRTGNGRLEEVTA"
FT   gene            542198..543118
FT                   /locus_tag="AAur_0526"
FT   CDS_pept        542198..543118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07440"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1R272"
FT                   /protein_id="ABM07440.1"
FT                   /translation="MKFSVFTASTPEWTPQEAVTELSAQGWHGIEWRVTDQADAPEPGF
FT                   WAGNKATWPLTGLEESLPDIARITADAGLEYSGLGGYARCDNHDDVDRVLAATAELGAR
FT                   QVCVNVLPLGNSTMGGQEPTGLSYPELFAATREHYEWVSSRAAHHGVKALVELHHGTVT
FT                   ASASSARRLLDGLDPQHVGVIHDLGNLLIEGWESPLPALQLLGPYLAHVHVKNARWVLT
FT                   DQRDPAGGAVWASEWAPLEAGIGNVVTYFKALADAGYDDWVTVEDFSTEVPLAERTAGN
FT                   LDFLRRAASLAGLAVAGNADSVSKG"
FT   gene            543122..544513
FT                   /gene="uxaC"
FT                   /locus_tag="AAur_0527"
FT   CDS_pept        543122..544513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="AAur_0527"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="identified by match to protein family HMM PF02614"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08385"
FT                   /db_xref="GOA:A1R273"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1R273"
FT                   /protein_id="ABM08385.1"
FT                   /translation="MSLATHPDRLLPADPGTRGIARELLQRVQDLPIISPHGHVDAAVI
FT                   EQNTPFPDPAALLVTPDHYVTRLIHASGISMDKLQPGNATPREIWRHFCAAWPLFDGTA
FT                   SGYWLRTQFESVFGWRGELSAEKADASFDSISAKLAEPGFRPRELFKDFNIEVLATTDD
FT                   PLDNLESHRALAEDPSFHSRVLPTFRPDAYINIAHPQWAANVERIISEASDGGSGYRGY
FT                   LTALENRRRYFVDHGAVSADHGVRTPATLKLEEADAEALFEKARSGQATAHDRDVFEAH
FT                   MMYQMARMSVEDGLVMTIHPGSYRNHHQPTFEEFGADTGHDIPVATNYTESIRPLLQDF
FT                   GTAKDFHLVLFTLDETVFSRELAPLAGFYPSVYIGAPWWFLDAPDAMLRFRSAVTETAG
FT                   FSRSSGFIDDTRAFCSIPARHDASRRIEASFLARLVAEHRISEDRAHELIVDVVDSSPR
FT                   RVFKL"
FT   gene            544510..545841
FT                   /locus_tag="AAur_0528"
FT   CDS_pept        544510..545841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0528"
FT                   /product="putative D-mannonate oxidoreductase (fructuronate
FT                   reductase)"
FT                   /note="identified by match to protein family HMM PF01232;
FT                   match to protein family HMM PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07809"
FT                   /db_xref="GOA:A1R274"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R274"
FT                   /protein_id="ABM07809.1"
FT                   /translation="MTGDQGLPRLNRGTRPKPPIRIVHLGLGAFHRSHQAWYTQHAGDA
FT                   AEWGIAAFTGRRPDAADVLAEQDGVFTVVERSGRGDSFEVVGSIVEAVDGSDVGRLTEL
FT                   VAAPTTAVITLTITESAYAADIAGSAEGSTPLARLVTALAARRDAESGPIAVVSCDNLA
FT                   ENGDVARQAVGALARARDGGLAAWIDANVSFVSTSVDRITPRTTQADLDVVAASCGYRD
FT                   LAAVVTEPFHNWILSGDFPAGRPHWEDAGAVFVDHIEPFENRKLWLLNGSHSILAYAGL
FT                   LRGHATVAEALSDDVCRGAVEAFWDEASRHLSGDELQIPKYRKALLERFGNSRIAHHLI
FT                   QIAMDGTTKLRMRAVPVLAAERSAGRSGDGAARMIAAWLAYVSSTTELQDPLAADIQDA
FT                   KTLDGEHRTAALVALISTELANDAATVSQIHGQLDSFAATTSHA"
FT   gene            545866..547095
FT                   /gene="rspA"
FT                   /locus_tag="AAur_0529"
FT   CDS_pept        545866..547095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspA"
FT                   /locus_tag="AAur_0529"
FT                   /product="starvation sensing protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07182"
FT                   /db_xref="GOA:A1R275"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A1R275"
FT                   /protein_id="ABM07182.1"
FT                   /translation="MKIIAAEVFVTSPSRNFVTLRITTEDGVTGIGDATLNGRELAVAA
FT                   YLKEHVAQLLIGKDPHRIEDTWQFLYRSSYWRRGPVTMAAIAAVDMALWDIKGKVAGMP
FT                   VYQLLGGASRNGLRAYGHASGADIPSLFDSVREHLELGYKSIRIQTAVPGIKAVYGVAA
FT                   QAQASGERYDYEPAGRGNFPLEEDWDTRAYLRHLPTVFEAVRNEFGPEIPLLHDGHHRM
FT                   TPIQAAKLGKALEPYDLFWLEDCTPAENQEGLRLVRQHTTTPLAIGEIFNTVWDYQTLI
FT                   KEQLIDYVRAASTHFGGISPLKKVMDFAAQYQIKSGFHGPTDISPVGFAAQLHVGLAIH
FT                   NYGIQEYMQHSDKTNEVFQQSMTFKDGYLHPGDNPGIGVEFNEEAAAAFPYQQAYLPYN
FT                   RLVDGTVHDW"
FT   gene            547124..547603
FT                   /gene="aroK"
FT                   /locus_tag="AAur_0530"
FT   CDS_pept        547124..547603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="AAur_0530"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202;
FT                   match to protein family HMM TIGR01313"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08070"
FT                   /db_xref="GOA:A1R276"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A1R276"
FT                   /protein_id="ABM08070.1"
FT                   /translation="MGVAGCGKSTVGAALAERLGAEFLDGDSLHPQANIDKMASGTPLN
FT                   DDDRAPWLAEIGRRFPASSTALVIACSALKRSYRDIIRSADPSVVFVHLHGTRELLNAR
FT                   MTARPGHFMPASLLDSQLATLEPLQSDEVGIVVDISKPVEDMVNQIAVALTGALL"
FT   gene            547921..549045
FT                   /locus_tag="AAur_0531"
FT   CDS_pept        547921..549045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0531"
FT                   /product="putative sugar ABC transporter"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07642"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R277"
FT                   /protein_id="ABM07642.1"
FT                   /translation="MRLKKLLGAVAVVLTLTVGATGCGSRGGTAESTSSANPSDSLVGI
FT                   SMPTQTSERWIADGANVEKSLKDLGYKTDLQFANDDIPTQVSQIENMLTKGAKALIIAA
FT                   IDGTTLTDVLAKAKEQNVKVIAYDRLINGTPNVDYYTTFDNYTVGVQQATSLLTGLGLV
FT                   DASGKKVEGKGPFNVELFAGSPDDNNANFFWTGAMDTLKPYLDAGTLKVPSGQTKFEQA
FT                   AILRWQAPVAQKRMEDILTSAYSSGTKLDGVLSPYDGLSIGIISALTSTGGYSTGKLPV
FT                   VTGQDAEKGSVKSIIAGEQYSTIFKDTRQLGAQAVKMVDAVLKGSEPETNDTKTYNNKV
FT                   KVVPAYLLKSVIITKDNYKKELIDSGYYTEADVK"
FT   gene            549172..550701
FT                   /locus_tag="AAur_0532"
FT   CDS_pept        549172..550701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0532"
FT                   /product="putative sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06321"
FT                   /db_xref="GOA:A1R278"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R278"
FT                   /protein_id="ABM06321.1"
FT                   /translation="MNVPILQMRGITKTFPGVKALQDVTLDVNRGEVHAICGENGAGKS
FT                   TLMKVLSGVYAHNTFDGDILFENEPCEFSSITDSEKRGIVIIHQELALSPYLSIAENIY
FT                   LGNELARNGWVDWRKTNLEAAKLLARVGLSENPVTPIQHISVGKQQLVEIAKALSKEVK
FT                   LLILDEPTAALNDEDSDHLLDLILHLKGQGVTSIIISHKLNEIRKVADAVTIIRDGKSI
FT                   ETLRLDQGQITQERIIRGMVGRDLESLYPDRTPNIGEEVLRIEDWTVQHPQDHSRTVVN
FT                   NASLNVRKGEVVGLAGLMGAGRTELAMSVFGRTYGRAVSGKVYKYGQEINTSTVSDAID
FT                   HGIAYATEDRKHYGLNLIEDIKRNVSMAALTKLAKRGWVDGNKETTVANHYRKSMNIKA
FT                   PSVAAITGKLSGGNQQKVVLSKWMFSDPDVLILDEPTRGIDVGAKYEIYTIIAELAAAG
FT                   KAVIVISSELPELLGICDRIYTLSAGHITGEVPIAEATQETLMHFMTQEKE"
FT   gene            550593..551990
FT                   /locus_tag="AAur_0533"
FT   CDS_pept        550593..551990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0533"
FT                   /product="putative sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06916"
FT                   /db_xref="GOA:A1R279"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1R279"
FT                   /protein_id="ABM06916.1"
FT                   /translation="MRQDLHAVRGPHHRRSPHRRSHPGNPHALHDSREGIANMSALRES
FT                   LGFLTSRLRQVGIFVALILIVILFQVLTDGILLQPQNVTNLVVQNSYILILAIGMVMVI
FT                   IAGHIDLSVGSIAGFIGAVAGVMIVHWGWAWWLAIPACLLVGALVGAWQGYWIAYVGIP
FT                   AFIVTLAGMLIFRGLTLITLKNQQITPFPNELRALGGGFLPDISGGTSVLEWLTVILGV
FT                   GGTAAILFQAIKERRVRRKFNLENEPMAWFAVKNGFIAVLMLIITFLLASYRGTPIVLI
FT                   VLAVLVIVYSALMNNSIFGRHTYAIGGNLHAAELSGIKTKKVTFRLFVNMGVLAALAGL
FT                   VFTARLNSAQPAGGTGFELDSIAAAFIGGAAVQGGIGTVAGAMIGGLIMGVLNNGMSIL
FT                   GLGTDYQQLIKGLVLLLAVGFDIFNKNRTGSGGGSSVGRRFKWKTTPPATETSTPAKPE
FT                   PVVVDAK"
FT   gene            552072..553055
FT                   /locus_tag="AAur_0534"
FT   CDS_pept        552072..553055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0534"
FT                   /product="putative transcriptional regulator, lacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10125"
FT                   /db_xref="GOA:A1R280"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R280"
FT                   /protein_id="ABM10125.1"
FT                   /translation="MGDVAKMAGVSHQTVSRVLNNHPNVSHQTKQRVESAIEVLGYRRN
FT                   TAARSLVTRRSRTIGVLACETGQFGPANTLLGVEQAGREAGYFVSIANLREVTDHSVND
FT                   AMAHFRNQSVDGIVILVPHPDVLAVLRDVSFPVPIVAVGAGAGNQLTGASLNQRMGARL
FT                   AVDHLIGLGHRRIAHISGPPHWIDAAERIKGWQESLETTGLSADVLLRGGWDAASGYRA
FT                   GLELIQRHTVTAVFVANDQMAVGVLRAVQEAGLHVPDDISVVGYDDQPEAEFFMPPLTT
FT                   IKQDFEELGRRCMEAVLQQLGGDGGTGDQIVNPRLVIRATTAAPLN"
FT   gene            553061..553633
FT                   /gene="pyrE"
FT                   /locus_tag="AAur_0535"
FT   CDS_pept        553061..553633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="AAur_0535"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09121"
FT                   /db_xref="GOA:A1R281"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1R281"
FT                   /protein_id="ABM09121.1"
FT                   /translation="MTSTLDTAAARARLLELIKELAVVRGKVILSSGKEADYYIDLRRI
FT                   TLHHEASKLVGQVMLAMIDDAGVSVECAGGLTMGADPVGTAVMHAAADAGRAVDAFVVR
FT                   KAQKSYGMGRQVEGPSVEGRNVVVLEDTSTTGGSALTAVEGVRKAGGNVVAVAVIVDRN
FT                   TGAKEKIEAETGVPYLFAFGKDELGLD"
FT   gene            553681..554805
FT                   /locus_tag="AAur_0536"
FT   CDS_pept        553681..554805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0536"
FT                   /product="putative Tat pathway signal sequence domain
FT                   protein"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09209"
FT                   /db_xref="GOA:A1R282"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R282"
FT                   /protein_id="ABM09209.1"
FT                   /translation="MDVQVGKLTAPPEVTENLPAPVSQEPEKAADPGSWARILPYAARL
FT                   KKTSRRNFLITAGASGALAADMLFTRRVQAERRATKILRVPDPYSDVYFPKASWILFPG
FT                   YKTSWEEAQWILNSLRPALHQRGRLAAVGYSNLGLDVDEIVREIILHVRELELEKLYFY
FT                   GHSFGGMLATQVAARLLELHGVETQLIVLDSSPFSRADVLDQSWFDGVVFLYENGFRIP
FT                   SVLRGGYELGERVAHKDERTWRQILDQSLEQLSPIAPSSVLIQTESAYIYHFDGLRLAG
FT                   KIGGAKMAFIGNAKDATVDYESARAGWSKVFGSNMVMPTLSTEGARPAHASPQWNGGIY
FT                   RPLLERVQDELQPLPPQPEEPSYREPNGRIIRPA"
FT   gene            554952..555926
FT                   /locus_tag="AAur_0537"
FT   CDS_pept        554952..555926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0537"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07300"
FT                   /db_xref="GOA:A1R283"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R283"
FT                   /protein_id="ABM07300.1"
FT                   /translation="MNGLQLTGISRSFGDRRVLHDVDLTVHRGEIVGFIGGNGAGKTTT
FT                   MRVILGLLTPDHGEVTWEALPITAKDRRRIGYMPEERGLYPQMPVRDQIIHFALLEGHQ
FT                   PDAAREVADELIASLGLQGREQALVQDLSLGNQQRVQLAVALVGDPALLVLDEPFSGLD
FT                   PLAVETMSRLIREQADRGVGVLFSSHQLELVERLCDKVCILDRGRVTASGSVVELQDDG
FT                   KSRWRLGFSRTADSFAAEVSMARGVNVEFSADDRTTVLVSVDGSGRDVPGEILAAAQRH
FT                   GGLKSIVSAQRSLADLLAGTFISSHPGTTPGAERSLDKVGVSQ"
FT   gene            555923..556837
FT                   /locus_tag="AAur_0538"
FT   CDS_pept        555923..556837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0538"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06715"
FT                   /db_xref="GOA:A1R284"
FT                   /db_xref="UniProtKB/TrEMBL:A1R284"
FT                   /protein_id="ABM06715.1"
FT                   /translation="MSTTTFDRTTRSAAPSSGSGLRETRLIIRREVLTRLGNRTILTAT
FT                   GLLALFAGAAAGIGGWFLVDSLGGAGAMSFDPRAIFATAMISALLASLVYSASSLTSGV
FT                   VEEKSSRIVEILLTKIGIVPLLAGKMIGIGLVTLVQLLAIGGTAVVGFSVVGGWSLINV
FT                   AVGPSLLWFLLWFLLGYVIFAALNTTLASTVSRQEDLGTAVMPLSVLQMVLLVVSLYVL
FT                   PMNLGNPWLEGLSFVPLFSSYLMPMRFALEDVSTWEMVLAAGISVAAIPALFWLATVIY
FT                   RNNALRTGSRVTLQQSLTSDETA"
FT   gene            556898..557011
FT                   /locus_tag="AAur_0539"
FT   CDS_pept        556898..557011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08991"
FT                   /db_xref="GOA:A1R285"
FT                   /db_xref="UniProtKB/TrEMBL:A1R285"
FT                   /protein_id="ABM08991.1"
FT                   /translation="MPDNKRNQSLATKKLVRNIALLLIGILAAYAVTTLLL"
FT   gene            557023..558132
FT                   /locus_tag="AAur_0540"
FT   CDS_pept        557023..558132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0540"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07509"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1R286"
FT                   /protein_id="ABM07509.1"
FT                   /translation="MMTASAPHPQSTTPAARRAAGLATTVLASHNREAVEEIAPAAFAG
FT                   RNGTWNMRLRSGEKVFVKQISPQASGPMAFDRSVTFAAFAEQSPDFAPATPQLIGSDTA
FT                   NGLLVFEHCPGTSLAHLMVEETMPDSFPEEAGALLARLHAGPAIGLERSAPPSPPVEML
FT                   AVGVPHARYLEFTMAEMALWSELQNDQELVAAAGRLRASERMHQERPIHGDLRLDQFHL
FT                   HNGKLCVLDWEEFGLGDPARDLGMLAGEWIYRAVLDTVTTRGGASAPPARFDDESASAR
FT                   IAERMAAIVPSIRRMWTSYADHANYHDPDLPVRATAHVGWHLVDRTITRAPMVSRLPGI
FT                   ERAAAGVGREALLSPGHYVKALGFERTPR"
FT   gene            558172..559104
FT                   /locus_tag="AAur_0541"
FT   CDS_pept        558172..559104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06268"
FT                   /db_xref="InterPro:IPR040871"
FT                   /db_xref="UniProtKB/TrEMBL:A1R287"
FT                   /protein_id="ABM06268.1"
FT                   /translation="MEHRVSVDARRLTARIDATTLSATSHSELRSQLAGAIYTHLHVGH
FT                   PGIETVPGTGHQDLAAALIDAIPHRTVVQAATVQAATVQAASKRTQLGTSVQGVPHQVV
FT                   ELSGVKVLFPAEALVRDPLDEIVGVRVPSWRSRTTPGFLLALGAHGSVNPAAASRLYLS
FT                   CFTASEALEMWPKILGALAASGLGHQVKTLSSSLAFPRSDAMVIYVSANDSDAAVSLVG
FT                   PALRSLSARDTPVSVFTHSVGDRLALAMEPKDSRPGYRGLSFGQHRSRVLADALLRASV
FT                   EKTDLEPAWAVEAQTACINPHQPGYNAGQ"
FT   gene            559216..559389
FT                   /locus_tag="AAur_0542"
FT   CDS_pept        559216..559389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0542"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06939"
FT                   /db_xref="UniProtKB/TrEMBL:A1R288"
FT                   /protein_id="ABM06939.1"
FT                   /translation="MSNAVGNFRQADLTDLARAHSTFAAADELGGDAATDAPATSPLCI
FT                   GIIVGATLGAGC"
FT   gene            559506..559679
FT                   /locus_tag="AAur_0543"
FT   CDS_pept        559506..559679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09769"
FT                   /db_xref="UniProtKB/TrEMBL:A1R289"
FT                   /protein_id="ABM09769.1"
FT                   /translation="MTHAITNIPQADLADLARAHSTFTAADELGGDAATDAPATTPFCA
FT                   GVIIGATLTMGC"
FT   gene            559774..560427
FT                   /locus_tag="AAur_0544"
FT   CDS_pept        559774..560427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0544"
FT                   /product="Flavoprotein domain protein"
FT                   /note="identified by match to protein family HMM PF02441"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09874"
FT                   /db_xref="GOA:A1R290"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A1R290"
FT                   /protein_id="ABM09874.1"
FT                   /translation="MLRPAMTTTDSSPRPIWADLTLEAFGYSKVALILTGSAVTQVMPF
FT                   WIEWAVSAAPETEFKVVMRDSAQRFITRHSIESRLKSRVQADTWGEELVAAHIDLAEWA
FT                   DLILVYPATLDYSSRLAHGIADSPSLLAAMTTEAQVCIAPALPPRALANPIVAETLRKL
FT                   RTPENFLVIDPVPGPSESSDVALAWVPPSFPSVLRRLEEERLLRAGMTAEAATV"
FT   gene            560424..561287
FT                   /locus_tag="AAur_0545"
FT   CDS_pept        560424..561287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09109"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1R291"
FT                   /protein_id="ABM09109.1"
FT                   /translation="MSAAMDSRQKSVIRSTRTDLLSTGVYQVGGAYEWVHSLGVGAPIP
FT                   FSSLPISIAPAPGADLLVVGVGGDRHRSYSTPAGSTVFDLITAGVPANLRAAGRIWGTA
FT                   LSVLHDNASLIDFPGSTPRTVQRSEAWLGGAWEPACDVLGDSGLREIRRWIERVLSDPH
FT                   QVVVHGYPGMAHWVVTPDGAAGSLLTGEDLGLAHPAYDIAWVLGEMAELHAFHPVLRPA
FT                   IEELRNGFHETCGEGPAQSEIGPALAFRIAQHAYDWHHYAGAGEAQSKALLRLASSYLN
FT                   TTPETR"
FT   gene            561452..562537
FT                   /locus_tag="AAur_0546"
FT   CDS_pept        561452..562537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0546"
FT                   /product="putative peptidase M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07777"
FT                   /db_xref="GOA:A1R292"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A1R292"
FT                   /protein_id="ABM07777.1"
FT                   /translation="MLHLLEHMVYQDSENITALERQVSVHKAGGILGGNTHMDYSEFYE
FT                   SGPTGHLERISSRLVEQVFQPALTQGQIAEQIDAVATERAQRLAPAPGGILPWPHLTTR
FT                   YWADHSNGHDGSGDSDLATRVTREKLQALHGRLYRPSAAVLTAVASEDPHYTLRLLAAP
FT                   FSGISDQAPVVPVLQDSVRRGGSTSTIYSGGATSTRLLSATAAAFGHSAGPDLLGDLVA
FT                   AELLSQQDGLDASAGLFGPGDLTRDDLFVLVDDTGQAIDPSERFRALAIADDAAIVLAA
FT                   RRALLRMETFTHDDQRLARTVTRDVLLRGTPTFAVELADALAEISDDDTRLRPLVTAAA
FT                   RRLAEQDSVSLTVQPSEEILR"
FT   gene            complement(562551..562928)
FT                   /locus_tag="AAur_0547"
FT   CDS_pept        complement(562551..562928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07507"
FT                   /db_xref="UniProtKB/TrEMBL:A1R293"
FT                   /protein_id="ABM07507.1"
FT                   /translation="MVLRNADRGAGGPSPPPSDRLPSRSSRTPAEPTTASTGSPNSAIP
FT                   GCSVLVTSSVQPRTATSGRVAVITTAPSPGVHVTATGCLAGPHRFTARETALRRRGTPS
FT                   EVVLQPIDTVVKRERRSTWAR"
FT   gene            complement(563465..564148)
FT                   /locus_tag="AAur_0548"
FT   CDS_pept        complement(563465..564148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0548"
FT                   /product="two-component system response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10128"
FT                   /db_xref="GOA:A1R294"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1R294"
FT                   /protein_id="ABM10128.1"
FT                   /translation="MTRVLLVDDELLAREILRDYLSSDSSIEVVGEASDGRVAVVQAAS
FT                   LRPDVILMDMQMPVMDGVAATAQIHAEFPDIAILGLSTFSTDRYVVDLLRAGASGYLVK
FT                   DTLPKEITAAIHTVMAGESVLSSKVTRHVVTGLAESVPAEVVPDPKLVDALTKKELEVI
FT                   QLLGRGMSNREMAAELFVTESTIKARFVNVMEKLGVRDRVQILVAAVEGGLVDLGPGSR
FT                   TGLDS"
FT   gene            complement(564197..565435)
FT                   /locus_tag="AAur_0549"
FT   CDS_pept        complement(564197..565435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0549"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="identified by match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09020"
FT                   /db_xref="GOA:A1R295"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1R295"
FT                   /protein_id="ABM09020.1"
FT                   /translation="MSRTNWLADVKPLPGGWILRSAIVLATLLFLALGIRWQQHDLSSF
FT                   QGWLELVVPYLPLLALLIGAMQSAVAWCLSLVLIMVLGGDASLVVAMIFPTMVVVAFCS
FT                   FLLPWKLAINFSLFVPSVLLGLYISTPEMADQPAVLLALVVFLAAAAWRSVNVYRHRYE
FT                   QSTHHIRDLQEQQAQVRSEERTRLAHELHDIVAHDVTIIAMQARRAEFVNDQAKTSQIL
FT                   EGIGNAAQQTLQDLRSLVTLLKEEEREEPGGGSQLLDREGQAAGFLDAPAMSGETTTAV
FT                   GLVHDLDGVVEALDRAGFQVSLVVEGEVARIPASLRQALRRTVREMGTNVLKHADPSGV
FT                   VDLRLTVGADRVQLASENTVSTAEPIMSSKTGLEAMSARCEVFGGFMDVGLSEGRWTTA
FT                   VSIPLEGLASADA"
FT   gene            complement(565447..566151)
FT                   /locus_tag="AAur_0550"
FT   CDS_pept        complement(565447..566151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07398"
FT                   /db_xref="GOA:A1R296"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A1R296"
FT                   /protein_id="ABM07398.1"
FT                   /translation="MAVLNLRPLAGGRILRGSQPFGLDAAATHGFLAEHGIQAIVDLRS
FT                   ELERSLVPWLVHDDGGEPAAVVQPAVELIHNPLDPNAIAGSLQAVETAEDLGDLYLGWI
FT                   RLRPEWVGDALRPAARGKRTLVHCSLGKDRTGVVSAIGLLAAGGTEDDVVADYAATTAN
FT                   LPDVLEVMAETWRLSVPSTPAEYFSPDLMILQSPEAAMRHFLAGFAREFGDVRSFLREA
FT                   GLTAVEVESLAL"
FT   gene            complement(566163..567032)
FT                   /locus_tag="AAur_0551"
FT   CDS_pept        complement(566163..567032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0551"
FT                   /product="putative sugar phosphatase/hydrolase of the HAD
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01460"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07771"
FT                   /db_xref="GOA:A1R297"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1R297"
FT                   /protein_id="ABM07771.1"
FT                   /translation="MKDWVAVHEQSQPEANMAEETTSTSVYRNGHEIECWLTDMDGVLV
FT                   HENQAIPGAAELIQRWVDTSKRFLVLTNNSIFTPRDLAARLRASGLEVPEENIWTSALA
FT                   TAQFLKDQVQSSDSGNRAYTIGEAGLTTALHEAGFILTDTDPDFVVLGETRTYSFEAIT
FT                   MAVRHILAGARFIATNPDATGPSKDGPMPATGAIAAMITKATGREPYIVGKPNPMMFRS
FT                   AMNQIDAHSETTAMIGDRMDTDIVAGMEAGLHTVLVLSGITQREEIVSFPFRPNQILNS
FT                   VADLKSQI"
FT   gene            567246..568469
FT                   /locus_tag="AAur_0552"
FT   CDS_pept        567246..568469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0552"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07047"
FT                   /db_xref="GOA:A1R298"
FT                   /db_xref="UniProtKB/TrEMBL:A1R298"
FT                   /protein_id="ABM07047.1"
FT                   /translation="MSNNNGVPQPPSNPEGVPQPPYNPDGVPQPRYDTGKDQYSQYQPG
FT                   QTQPLYQPEAQTEAFPAQHAPTQAFAAQQPQQHPDGEHAETVHRYPQAQQGQPGFPPPG
FT                   SGYPGQPGYPGQPGGPGQNPGDHNKKSLFLILGGVAVVVIIALVVTFTWLIPSMTKPVA
FT                   VDTPLPSVTSSDEASEAAAEPSAEPSGEASASSEIPADAIPLPAGWDELAGPSNVPADG
FT                   DPLFSKWVTGESSFQYLAEWTHDESFGITKDPTTGEEIQKKAQGTVEADGDGIALAYAF
FT                   FAESEEGKFGKDPAEIKKAIQDIEARFKAMTASELPQNLVGHKCTADFKTTMPEIREFR
FT                   RGEAVVIGFTCTNARGEQIQAVNLFSVTPWGTPQMLGVSGHKEYWDAHPGLFEQLGNSY
FT                   RINKWKMV"
FT   gene            568522..569208
FT                   /locus_tag="AAur_0553"
FT   CDS_pept        568522..569208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0553"
FT                   /product="putative RNA methyltransferase, TrmH family"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06593"
FT                   /db_xref="GOA:A1R299"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1R299"
FT                   /protein_id="ABM06593.1"
FT                   /translation="MTDLPPNTALPTPAETTAEGEAEAKPEVGVGPWEGEWPVGEHWDP
FT                   DLLRDGDRRNVVDQYRYWKHDAIVADLDSKRHDFHIAIENWQHDLNIGTVVRTANAFLA
FT                   KEVHIIGRRRWNRRGAMVTDRYQHVRHHPTVEDFVQWAEGEGLAVIGIDIFPDSVPLET
FT                   YDLPKNCVLVFGQEGPGLTPEVHDAAVATLSIEQFGSTRSMNAASAAAIAMHAWVRRHV
FT                   FQQPVS"
FT   gene            complement(569244..570383)
FT                   /locus_tag="AAur_0554"
FT   CDS_pept        complement(569244..570383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08716"
FT                   /db_xref="GOA:A1R2A0"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A0"
FT                   /protein_id="ABM08716.1"
FT                   /translation="MENPSSANNHPRPTSAPSDPPAPPSPPAYGAYQQPNVPYQQPGII
FT                   PPQPKRTLNRKVIIAIAAGAAVVLAAATVGLVLLFSPAADGGQAATTFYQALKDGDAKK
FT                   ALSVSDPGVPENEAVLLQDNIYKAAGQHIDGFRILESKGEYVRAEVTQNGRKQEDILMM
FT                   TKSPDGEWKVGPKNFQKIRLSSNRPVKSFTVNGVDVAAPDSGSASPDSQLLLPAFPGEY
FT                   KLGISGDKYATVEEKKALVSIDRRISDTFETLKVLPSQLLLDETKALLQKKRDTCIASA
FT                   SATARQSFSSGCSGFNLYESRPTQNVKWTIDEEPTFTLSLSRDIWYIQPEGKGKATVSY
FT                   EVNRGTEAAPKWEPHSEVMEPRISGEIHIVDGKATLKDY"
FT   gene            570572..571591
FT                   /gene="fbaA"
FT                   /locus_tag="AAur_0555"
FT   CDS_pept        570572..571591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="AAur_0555"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01520"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10185"
FT                   /db_xref="GOA:A1R2A1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A1"
FT                   /protein_id="ABM10185.1"
FT                   /translation="MPIATPEIYSEMIDRAKAGGFAFPAVNVTSSQTLNAAICGFAEAE
FT                   SDGIIQVSTGGAAYWSGASIKDMVAGSLGFAAFAREVAKNYNVNIALHTDHCPQDKLAD
FT                   FVLPLLAASEEAVKAGKDPIFNSHMWDGSHEALPENLRIGRELLERAAAAKIILEVEIG
FT                   TVGGEEDGVENEINEKLYTTTEDALATIEALGAGENGRYLTALTFGNVHGVYKPGNVKL
FT                   RPELLKQIQSEVGAKIGKENPFDLVFHGGSGSTEQEIADAVSYGVIKMNIDTDTQYAFT
FT                   RPVAGHMFSNYDGVLKVDGEMGNKKTYDPRVWGASAEAGMAARIVEAAQQLGSVGKTF"
FT   gene            571591..572013
FT                   /locus_tag="AAur_0556"
FT   CDS_pept        571591..572013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10123"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A2"
FT                   /protein_id="ABM10123.1"
FT                   /translation="MSDEFRKNLMGPEPTLLPAETEIYQHLALGNEALDLVAKNPTSSL
FT                   LWAILAEEAWAEGRTIESYAYARVGYHRGLDSLRRNGWRGVGPIPWEHEPNQGFLRALY
FT                   ALGRAASAIGEAEEPERIEKFLNDSDPKAKAALEAR"
FT   gene            complement(572084..572905)
FT                   /gene="fepC"
FT                   /locus_tag="AAur_0557"
FT   CDS_pept        complement(572084..572905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="AAur_0557"
FT                   /product="ferric enterobactin transport ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08019"
FT                   /db_xref="GOA:A1R2A3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A3"
FT                   /protein_id="ABM08019.1"
FT                   /translation="MSLTTAAPQLHADALTIGYEQRIISENLNVRIPEGQFTVIVGPNA
FT                   CGKSTLLRALARLIKPKSGQVLLDGKSVTSLPAKELARRLGLLPQSSIAPDGITVADLV
FT                   ARGRYPHQKLLRQWSESDEIAVVEAMEATGVSSLSGRLVDELSGGQRQRVWVAMVLAQQ
FT                   TPLMLLDEPTTFLDIAHQIELLELFRELNLDKGHTLVAVLHDLNHASRYADHIIAMKDG
FT                   AVAAEGAPADVITESLVEEVFGMACRIIDDPVTHTPLVVPLGRPRHSAVTD"
FT   gene            complement(572902..573981)
FT                   /gene="fepG"
FT                   /locus_tag="AAur_0558"
FT   CDS_pept        complement(572902..573981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="AAur_0558"
FT                   /product="ferric enterobactin transport system, permease
FT                   component"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08835"
FT                   /db_xref="GOA:A1R2A4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A4"
FT                   /protein_id="ABM08835.1"
FT                   /translation="MSRLEPGRLEAGARVDFGRPTALVRNRTLSVRFDVRSILVCIPLV
FT                   LAALTVAVVSLATGDYDVSVPQVLQAFTGDAPGLAQTIIMEWRLPRVLSALVFGAALGM
FT                   SGGIFQSMTRNPLGSPDIIGFNTGAYTGALIVMLTVGGGYLGVAVGALVGGILTALAVY
FT                   LLAYRRGSQGFRLIIVGIGISAMLAALNHWLILQAELEAALAAAVWGAGTLNGITWEQA
FT                   APAAVVVVVVGLSTLAVARRMQLLEMGDDAARALGVRAEPTRLLLLILGVALTAAVTAV
FT                   AGPIAFVALAAPQLARRLTRSAGITLVPSAVMGAFLLVASDLAAQRLFAPIQLPVGVVT
FT                   VCIGGIYLVWLLAKEARKS"
FT   gene            complement(573978..575105)
FT                   /gene="fepD"
FT                   /locus_tag="AAur_0559"
FT   CDS_pept        complement(573978..575105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="AAur_0559"
FT                   /product="ferric enterobactin transport protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08768"
FT                   /db_xref="GOA:A1R2A5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A5"
FT                   /protein_id="ABM08768.1"
FT                   /translation="MVPCCVPTDGVMSQLTAPAPKPRHGGPATVALPANSAAPRSGVVN
FT                   KSRWRILFLVLAAAVLLGAAILSLGVGAKFIPASTVLEAFTNPQDTADHAIILQNRLPR
FT                   TLMGIAVGVALGVAGALIQAITRNPLADPGILGVNAGASFAIVIAIGVFGIGSLSGYMW
FT                   FAFIGAILTTAAVYVIGTSGRNVVNPIRLTLAGVALGAVLTGIGSGLTLLNPKAFDHLR
FT                   SWSIGSLDTRSMESVVTVAPFMGVGLLVALFCVRGLNAVALGDDLATSLGANVNRTRIL
FT                   GVVAITLLSGAATAGAGAIGFVGLMIPHVARWIVGPDQRWIMATTVILSPILLLVSDVV
FT                   GRVAAPGELQVGVVTAFIGAPVLITLARRRKVSGL"
FT   gene            575196..576263
FT                   /locus_tag="AAur_0560"
FT   CDS_pept        575196..576263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0560"
FT                   /product="putative ABC-type Fe3+ transport system"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09554"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A6"
FT                   /protein_id="ABM09554.1"
FT                   /translation="MKNDDFEVQPRKASPRRKSAVRKLAMKVAGAAVAVGLLAGCGTSG
FT                   GSGSTAGNADVATGGSKFTTADQETAKLGTDAAPGVFPRTLKHANGETTLEKKPTRVVV
FT                   LDTGELDDVVTLGITPVGMATTEGANPVPTYLADKVKDVESVGTIQDLNLEAIAALKPD
FT                   LILGSQLRADKLYKQLSAIAPTVFSIRPGFPWKENFLLVGKSLGEEDKAVKALNDYQTA
FT                   ADALKADVKGDPKISLVRFLPGKIRLYANKSLIGVILKDAGLARPENQDIDELAAEISA
FT                   ENIEQGDADWIFYSSYGDPAATGETSVVEGAVWPKLGAVKAGQAKSVSDDVWFLGLGPT
FT                   GAQLILKDLRSMLVS"
FT   gene            complement(576363..576995)
FT                   /locus_tag="AAur_0561"
FT   CDS_pept        complement(576363..576995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0561"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08094"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A7"
FT                   /protein_id="ABM08094.1"
FT                   /translation="MQELATESPEEILWNRRYEPHIAEVNELCDSIKVQKPGSEVLYID
FT                   PAHSMDDCRIVSLFSNQRTNTGEGFITPGDEEATTRMLGMQWQLGLRPELMMPWNAYPW
FT                   IEPTEEPGKLTPANITEGLKPLLRLLQLLPRTSALVAHGNEAHRLADQLMKAAPASIAR
FT                   RGFKTFKVRSLGGRSFAGTPARQQEYLDAIHGAYAEAMARTGIPRKA"
FT   gene            577441..578730
FT                   /gene="purA"
FT                   /locus_tag="AAur_0563"
FT   CDS_pept        577441..578730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="AAur_0563"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06751"
FT                   /db_xref="GOA:A1R2A8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R2A8"
FT                   /protein_id="ABM06751.1"
FT                   /translation="MPAIVIVGAQWGDEGKGKATDLLGGRVDYVVKPNGGNNAGHTVVV
FT                   GGEKYELKLLPAGILSPNAIPIIGNGCVVNLEALFQEIDGLEARGADTSRLRVSANAHL
FT                   VAPYHQVLDKVTERFLGSRAIGTTGRGIGPAYMDKVARLGIRVQDVFDESILRQKVEGS
FT                   LRQKNELLVKVYNRRDIIADEIVEYFLSFAERLRPLVIDSTLELNNALDEGKVVLMEGG
FT                   QATFLDVDHGTYPFVTSSNPTAGGASVGSGIGPTRISRSIGIIKAYTTRVGAGPFPTEL
FT                   FDEMGVYLQKTGGEFGVNTGRPRRCGWYDAVLARHASRVNGFTDYFVTKLDVLTGIEQI
FT                   PVCVAYDVDGVRHDEMPMTQTEFHHAVPIFEYFDGWTEDITGARTLEDLPENARNYVLA
FT                   LEKLSGTRFSAIGVGPDRDQTIVVHDLIND"
FT   gene            complement(578727..579470)
FT                   /locus_tag="AAur_0562"
FT   CDS_pept        complement(578727..579470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0562"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09212"
FT                   /db_xref="GOA:A1R2A9"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2A9"
FT                   /protein_id="ABM09212.1"
FT                   /translation="MTSTTTPSARSRGINWGVPAALIILSLIPVIAGAARLTQLTGGAT
FT                   VTPENARFFASPIPMVTHIVTVTVYSLLGAIQFVPALRRVNPRQRGSQPQRRTRSWHQA
FT                   AGRVLVPAGLLAALSGLWMSVFYTLPETDGQSLLVLRLIFGFGMLGSIMLGLLAIRRRD
FT                   FAAHGAWMTRAYAIAVGAGTQALVLLSWMLIVGPTDQTVRAVLMGAAWVINLVVAEYFI
FT                   QRRRAARKFREEPRATRRRRELKSA"
FT   gene            579562..580335
FT                   /pseudo
FT                   /locus_tag="AAur_0564"
FT                   /note="putative transcriptional regulator, TetR family;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00440; match to protein family HMM PF02909"
FT   gene            580332..581789
FT                   /locus_tag="AAur_0565"
FT   CDS_pept        580332..581789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0565"
FT                   /product="putative transmembrane efflux protein (MFS)"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10031"
FT                   /db_xref="GOA:A1R2B0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B0"
FT                   /protein_id="ABM10031.1"
FT                   /translation="MSTAIDDGVGFRSRRGPILIALMLATGLVAIDATIVATAVPSIVE
FT                   DIGGFASFPWLFSAYLLAQAVSVPVYAKLSDVVGRKPMILGGIGLFLLGSILCGLAWSM
FT                   PALIAFRVLQGLGAGAVQPVAITIAGDIYTLAERAKVQGYLASVWAVSSVVGPTLGGVF
FT                   ASLGIWRWIFLINIPLCLLAGWMLLRTFHENVERTKHRIDYLGAGLLTISLSLLILGAL
FT                   QGGQAWAWDSTISICVFAGGAVLFVAFLLVERKVAEPILPPWVVSRRLLATTAMISFGV
FT                   GAVMLGLTTYVPTFLEGSLKTSPLLAGLALAALTIGWPISASQAGRLYLRIGFRNTASI
FT                   GIAITVIGAAVLALTASTPSILLVAMACFIVGLGLGLVATPSLIAAQTSVEWNERGVVT
FT                   GTNLFARSIGSSIGVAVFGAIANAIYASSPSGGPDPETTTHASSAVFLAVLVSAVLTVV
FT                   AVLVMPADRKRSSDAPAREPSSEPAND"
FT   gene            581800..582696
FT                   /gene="gnl"
FT                   /locus_tag="AAur_0566"
FT   CDS_pept        581800..582696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnl"
FT                   /locus_tag="AAur_0566"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="identified by match to protein family HMM PF03758"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08499"
FT                   /db_xref="GOA:A1R2B1"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B1"
FT                   /protein_id="ABM08499.1"
FT                   /translation="MEELITGPLEKLFEGTVWAEGPVWVPQSQTVRWSDIPNNRILEFT
FT                   PATGATSEYATGVEYTNGRTLDRDGSVVQCSHGRRRVERDHDGVVTPIVEAFGEHRLNS
FT                   PNDVVVAGDGTVWFTDPPYGILPGTVEGHEGEQEYGGCYVFRFDPETQELTPVVTDLVH
FT                   PNGLAFSPDESLLYVADTAGRGHGVPFRIAAYPVEAGGCGQGWTFVELEDDAASDGFRV
FT                   DVEGRVWTSAGSSVRVYAPDGSLLTAVEIPERVSNLCFGGADGRDLYITATTSLYRLRT
FT                   STRDAAQRDLGPGTPAL"
FT   gene            582737..582970
FT                   /locus_tag="AAur_0567"
FT   CDS_pept        582737..582970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0567"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06592"
FT                   /db_xref="GOA:A1R2B2"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B2"
FT                   /protein_id="ABM06592.1"
FT                   /translation="MSGSNPDPYEDKITGLEPGGGVPPGETPPGEASTAGPQGHDEGGP
FT                   RKGTQVFWLAAIGAGVLLTLLFFIGYIVGFFD"
FT   gene            complement(582980..584728)
FT                   /locus_tag="AAur_0568"
FT   CDS_pept        complement(582980..584728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0568"
FT                   /product="putative succinate dehydrogenase, flavoprotein
FT                   subunit (sdhA)"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF01494; match to protein family HMM PF02910;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10126"
FT                   /db_xref="GOA:A1R2B3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B3"
FT                   /protein_id="ABM10126.1"
FT                   /translation="MNLNTIPERLMSTSVLVIGTGGAGLRASIELAQQGVQVLAVGKRR
FT                   KHDAHTSLAAGGINAALGTMDPEDSWQQHAADTLRESYFLADPSIVETVARNAARGIED
FT                   LEQWGMPFAREEDGRISQRFFGAHKYRRTAYAGDYTGLEIQRTLMRRAAELNVPIIDTV
FT                   YITRLLVADGTVFGAYGFDIVDGTPVQIHADAVILAAGGHTRIWRHTSSRRDENTGDSF
FT                   RLAALAGARIRDAELVQFHPSGLLEPDDAAGTLVSEAARGEGGILTNGLGERFMERYDP
FT                   ERMELSTRDRVALAAFTEVAEGRGTEKGGVYLDVSHLPRETIMEKLPRVYRTMIDLQML
FT                   DITTTKIEIAPTAHYSMGGVWVAPEDHGTGVNGLYAIGEASSGLHGANRLGGNSLIELL
FT                   VYGRITGEHVADYVHSRTHIVRDPAAVGIARGEMQSLLSDRGTESARRLQRELRNLMTE
FT                   HAGVVRTEQGLEQGLAKLTALEERAQLVTAHPDIAGFDDLAHAYDLLGSLLAARATLEC
FT                   ALERRETRGAHNRADFPTADPSLQGNFVWSTDEGVSFESLPPAPDSFRALAQANADDSV
FT                   AGKLVE"
FT   gene            584806..585741
FT                   /locus_tag="AAur_0569"
FT   CDS_pept        584806..585741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0569"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07755"
FT                   /db_xref="GOA:A1R2B4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B4"
FT                   /protein_id="ABM07755.1"
FT                   /translation="MKLEQLRSFEAIARVGHFTRAAEQLFLAQPSLSRQIAALEADLGM
FT                   ALFHRGPSGATLTNAGELLLPIARRMLGDAQTAREQMNELAGLRRGRIRLGAPPTLCVS
FT                   LVADVLASFRSAHPGVELHITEGGSRFLVEALNESALDLALVVTRGTDPAVQGTELIPL
FT                   LTEELVVVSAAGSASPEELTLEELARIPQVAFNRSYDLRMATEAAFSASGLEPVIAVEG
FT                   AEMDAVLRFVERGLGVAVVPAMVVIGRPGLRSARLVNPSLSRTVNLARRNDIGPSAAAA
FT                   AMQEFIFSTVDRLAAPGTDLARLVTPTARH"
FT   gene            complement(585748..586734)
FT                   /gene="mdh"
FT                   /locus_tag="AAur_0570"
FT   CDS_pept        complement(585748..586734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="AAur_0570"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866; match to protein
FT                   family HMM TIGR01759"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08217"
FT                   /db_xref="GOA:A1R2B5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R2B5"
FT                   /protein_id="ABM08217.1"
FT                   /translation="MSSPIKIAVTGAAGQIGYSLLFRIASGALFGGDTPVQLRLLEITP
FT                   ALKALEGVVMELDDCAFPALDSVEIGDDADHIFDGVTLALLVGARPRSKGMERGDLLSA
FT                   NGAIFTAQGKALNRVAADDVRIGVTGNPANTNALIAMSNAPDIPASRFSALTRLDHNRA
FT                   IGQLAAKTHARVGDIRKMTVWGNHSATQYPDIFHAEVAGRNAAEVVNDQDWIENEFIPT
FT                   VAGRGAAIIEARGASSAASAASATIDAARDWLLGTPEGDWVSMAVASDGSYGVPEGLMY
FT                   SYPVTTSGGNWEIVEGLEVNDFSRRKMDATAAELFDERAAVANLGLI"
FT   gene            587009..588286
FT                   /locus_tag="AAur_0571"
FT   CDS_pept        587009..588286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0571"
FT                   /product="putative flavin-binding monooxygenase-like"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09370"
FT                   /db_xref="GOA:A1R2B6"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B6"
FT                   /protein_id="ABM09370.1"
FT                   /translation="MSIQEVEVLVVGAGQAGVAMSEHLSERGIPHIVLERHRIAERWRS
FT                   MRWDSLVANGPAWHDRFPGLEFTDTEPGSFPSKEQVADYFVAYAQKIGAPIRCGVEVTS
FT                   VRRNVGAPGFHVQTSDGEFNARYVVAATGPFQRPVIPAVVPETAGLMQMHSSSYRNPDQ
FT                   LPEGAVLVVGAGSSGVQIAAEIQRSGRQVFLSVGPHDRPPRNYRGRDFCWWLGVLGKWD
FT                   ASTPAAGAEHVTIAVSGADGGHTVDFRALAENGIKLVGRTTAFDNGTMRFADDLRTNIA
FT                   NGDAHYLELLDEADAYVERNGLDLPEEPEARFLRPDPESLTNPIRELDLASAGITSIVW
FT                   ATGFAVDYSWLQVDAFDDKGKPLQQRGVSTEPGVYFLGLPWQSRRGSSFIWGVWHDAKY
FT                   VADQITIQRSYLVHNEQDALVASGAV"
FT   gene            complement(588456..589874)
FT                   /gene="aspA"
FT                   /locus_tag="AAur_0572"
FT   CDS_pept        complement(588456..589874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="AAur_0572"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="identified by match to protein family HMM PF00206"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08861"
FT                   /db_xref="GOA:A1R2B7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B7"
FT                   /protein_id="ABM08861.1"
FT                   /translation="MTQQSSSPLPGTRREHDSLGDADVPEASYWGISTLRAVDNFPVSG
FT                   RTIGTLRSLIWSLGAVKYSAARANESLGLLDPEKSSAIQKASLEVMDGLLDNQFVVDTI
FT                   QGGAGTSTNMNANEVIANRALELMGQRKGDYSALHPIDDVNRSQSTNDVYPTAIKIALQ
FT                   REISAFCAEHAQLIQAFDAKATEFAGIIKVGRTQLQDAVPMSMGQEFGAFADTLREDGH
FT                   RLLELLPHLRESNLGATAIGTGITASPGYREAVISELSSITGMQLTSATNLVEATSDTG
FT                   VFMLVSGVLKRAAVKLSKICNDLRLLSSGPQTGFGEISLPAVQAGSSIMPGKVNPVIPE
FT                   MVNQVAFRVIGADATVTMAVEAGQLQLNAFEPVIADALLESIAWLTVACRQLRTHCVDG
FT                   ITANTQLLQQRMVESISVVTGLAPLIGYAAAAELAKEALASHRGIAELVIERGLLDSQK
FT                   MEAALSATSLAGLG"
FT   gene            complement(589912..591069)
FT                   /locus_tag="AAur_0573"
FT   CDS_pept        complement(589912..591069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0573"
FT                   /product="putative amidohydrolase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07003"
FT                   /db_xref="GOA:A1R2B8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B8"
FT                   /protein_id="ABM07003.1"
FT                   /translation="MSAEPATTSAPAVQRDRVLGSVTAQQPSLVRLSEALHANPELGWQ
FT                   EHRAAAWTADYLAAHGFEVEREYLDFPTAIRAVFGTGSRRVGLMAEYDALPGLGHACGH
FT                   NIITAISCGAAVALAQFAAERDLTVELYGTPAEEGGGGKIELLKRGAFQGLDLAMMAHP
FT                   SPVDSAEARPYAVAHNHVEYRGKSAHAAAYPDQGVNANDAFIVAQVALGLLRQQLPAGT
FT                   RVHGIQTRGGEAPNAIPEKTEGRWYVRAESLALLGELEERVHRCFEAGALASGCELSVT
FT                   AESEPYSEFRTDLRALELYVRHAETLGRDFNAPPEQATMNRASTDMGNVSQVVPAIHPY
FT                   IGLGCFPAANHQPEFAAHCVGDAANLAIHDGAAALALTALDYLAT"
FT   gene            complement(591059..591730)
FT                   /locus_tag="AAur_0574"
FT   CDS_pept        complement(591059..591730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0574"
FT                   /product="putative Family of unknown function (DUF1028)"
FT                   /note="identified by match to protein family HMM PF06267"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06563"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2B9"
FT                   /protein_id="ABM06563.1"
FT                   /translation="MTFSIAATDSHGRLGIAVSSSSPAVAARCAHLRDGIGAVSSQNIT
FT                   DPRLGTALLDRMQAGYSAQEAMDAVVQESPAVDYRQLVVLDAKGGSAVFSGAHTLGLFG
FT                   EGRGANSVAAGNMLAHPGVAQALCDAFEGAKGELEVRLMAALRAAEAAGGEAGPVRSAG
FT                   ISVVSGHGWRDTDLRVDWHEDPIAELGELLEVWLPQRQDYVVRGLDPAASVSYGVAGDE
FT                   R"
FT   gene            complement(591727..592149)
FT                   /locus_tag="AAur_0575"
FT   CDS_pept        complement(591727..592149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0575"
FT                   /product="putative endoribonuclease L-PSP family"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09991"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C0"
FT                   /protein_id="ABM09991.1"
FT                   /translation="MKHQRIRTFNTKETYPEQNLDNDLCQAVVANGVVYLRGQIGQDLE
FT                   TRESVGIGDVEAQTEKAMANIDMLLKEAGSSLEDIVKVTVYLIDPRYRETVYRTMGRWL
FT                   KGVFPVSTGIVVQALARPEWLVEIDATAVLSTEAQQ"
FT   gene            592283..593197
FT                   /locus_tag="AAur_0576"
FT   CDS_pept        592283..593197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0576"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06337"
FT                   /db_xref="GOA:A1R2C1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C1"
FT                   /protein_id="ABM06337.1"
FT                   /translation="MDVTLTQLRYFVEAAAQLSMTGAAVRLNVAQSAVSAAIAQLERHV
FT                   GTQFFIRQRSKGLVLTPAGELFVRDAQAILAQVEESVDHARGEHQSVSGRIRIACFSTL
FT                   APFLLPGVLTKLREDHPALEAEVIETDTAGCIAALLSGQADLALCYDLDLPEAIARSVV
FT                   DTVRPYVALPPNHKLAGSKTVQLSALSGEPFVLLDLPHTRDLMMSIARLGGQEPDIRFR
FT                   SASYETVRTFVARGLGYSILHQRPQHQLTYDGGQLAAVEIRDDVPELKTVLAHLKSHRP
FT                   TARVRAVAQAVRHQIVAARSARS"
FT   gene            593410..594768
FT                   /locus_tag="AAur_0577"
FT   CDS_pept        593410..594768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0577"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06962"
FT                   /db_xref="GOA:A1R2C2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C2"
FT                   /protein_id="ABM06962.1"
FT                   /translation="MNTNNIEGQISRKGLRTSVAAGSIGVFVHWFEWAIYAYLASTIAV
FT                   VFFPQQDSTAALLSVFAVFAISFGVRPLGALIFGTLGDRIGRKKTLSIVILSMSGATLV
FT                   VGLLPTYDAIGLWAPILLVAARVVQGLAAGGEFGSAAAFLAEYSPRKHRGFGVSWLEFG
FT                   SLLGFLAASLVVFVLSSAMDAQAIAGGGWRIPFLIAVPLGVIGFYIRSKIEDTPEFRSL
FT                   EELGNVPQSPVKEVFTKHRKQLLQMSGLEIMMHVTFYVVLVYLLTYQEKVLGFDAGTAA
FT                   LLSTAASVAGLILVPLVGALSDRIGRKPLLITAAVSLVVLAYPLFLIMQTGTAWAGIVS
FT                   TIGLGVILALILGVHAAAAAELFPTRTRQTGLSIAYSVTAAIFAGTVPYVLTWLIAQTG
FT                   NDMMPAFYLILVGLVGLAAVLSMKESKGKNLMDEEELHSPGTPSRATQGVAHT"
FT   gene            complement(594832..595485)
FT                   /pseudo
FT                   /locus_tag="AAur_0578"
FT                   /note="putative transcriptional regulator, TetR family;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00440"
FT   gene            complement(595547..597517)
FT                   /locus_tag="AAur_0579"
FT   CDS_pept        complement(595547..597517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0579"
FT                   /product="amine oxidase (copper-containing)"
FT                   /note="identified by match to protein family HMM PF01179;
FT                   match to protein family HMM PF02727; match to protein
FT                   family HMM PF02728"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10002"
FT                   /db_xref="GOA:A1R2C3"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C3"
FT                   /protein_id="ABM10002.1"
FT                   /translation="MTLQTTPLAATTQAPLGQHPLEQLSAHEIHQARRILADAGLVAET
FT                   TRFAYLGLIEPPKAVFQADAADAPRLVRAMLWDAAQSRSLDVRLSLATGLVLDQRELNP
FT                   EIDGQLPVLLEEFGIIEDILAVDPQWNAALASRGLTPAQVRVAPLSAGVFEYGNEEGKR
FT                   LLRGLGFRQDHPADHPWAHPIDGLVAFVDIENRRVNHLIDDGPVPVPEVNGNYTDPTIH
FT                   GELRTDLKPIEITQPEGPSFTLEGNHLSWAGWDLRVGFDAREGLVLHQLHHSHQGRRRP
FT                   VVHRASISEMVVPYGDPSPYRSWQNYFDSGEYLVGRDANSLKLGCDCLGDITYMSPVVA
FT                   DDFGNPRVIENGICIHEEDAGILWKHTDEWAGSNEVRRNRRLVVSFFTTVGNYDYGFYW
FT                   YLYLDGTIEFEAKATGIVFTAALPDKDYAYASEIAPGLGAPYHQHLFSARLDMMVDGGT
FT                   NRVEELDLVRLPKGPGNPHGNAFTQKRTVLTRESEAVRDADGTKGRVWHISNPDSLNHL
FT                   GHPVGYTLYPEGNPTLAMADDSSIASRAAFAKHHLWVTQHAEDELYAAGDFVNQHPGGA
FT                   GLPSYVAQDRDIDGQDLVVWHSFGLTHFPRPEDWPIMPVDTTGFTLKPHGFFDQNPTLN
FT                   VPSSSTGHCAPAEQNTGTCGH"
FT   gene            597636..598091
FT                   /locus_tag="AAur_0580"
FT   CDS_pept        597636..598091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0580"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09447"
FT                   /db_xref="GOA:A1R2C4"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C4"
FT                   /protein_id="ABM09447.1"
FT                   /translation="MNQQSRLPRRRGTTTPVSAGLVGVAAAGSAVAHVVAAASGPAGVM
FT                   AWWMAAMGAACLSCAAPMAGFPARTFCAGQAATRAAGHLLAMSAAMILIHLVLLLGPGS
FT                   GHHGHVQGASTPDHQPAMLILIGVELLCLMAASAALRMTRTATPHPN"
FT   gene            598113..599609
FT                   /locus_tag="AAur_0581"
FT   CDS_pept        598113..599609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0581"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06541"
FT                   /db_xref="GOA:A1R2C5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C5"
FT                   /protein_id="ABM06541.1"
FT                   /translation="MNTTSTTLSFDWHGRADALAIDGRAFIDGGRAAASTGLVRPTSSP
FT                   IDGRVLAELAACGLADVDRAVAAARRAFPSWSRSGAEKRKGLLLALANLMELNADELAL
FT                   LETLDSGKPILQTTTVDVPGAISTLRWYAEAIDKQSGEMPAVPPGATALVTREPLGVVA
FT                   AIVPWNFPLEIAVWKLAPALASGNTVVLKPAEQTSLSVLRLAELATEAGLPDGVLNIIT
FT                   GTGREVGAALAHHMDVDALAFTGSTAVSRTLLEASGRSNLKRLSLEAGGKSSNIVFSDT
FT                   ADLPKAAAKAAFGAFYNQGQVCSANSRILVQRDIHDEFATLLADAAVGYRAADPLAGLA
FT                   GNGALISSAHANDVEGWIRRGRTEGEVLFGGERLEIQGSDAYLEPTLLGGLPADHDVHR
FT                   DEIFGPVAVLHAFDSEEEAVRLANATDYGLAASVWTSNLSRGHRVAGELLAGTVSVNTV
FT                   DALGNTTPFGGFKQSGFGRDLSLHAFDNYTAPKTTWVQFD"
FT   gene            599827..601335
FT                   /locus_tag="AAur_0582"
FT   CDS_pept        599827..601335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0582"
FT                   /product="putative amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06688"
FT                   /db_xref="GOA:A1R2C6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C6"
FT                   /protein_id="ABM06688.1"
FT                   /translation="MDQPVASTRLAQEQSKHLQKSLGRFDILLLVVAAVISVEVLGQVS
FT                   GFGGETFTWTLILAITFMVPYGLIFAETGGAFTEEGGVYVWTKMAFGRVVAAITSLFTW
FT                   VTQPVWVGGAMAFVAVETWSEYVGHMDAGSPADYIFKLLFIWITVTSAIISLKHGKWLP
FT                   SLGAILKVAFLTFFIIVTMIYGLRHGFNGLDLGFFSPTLAGFLGVTPLLLFSFLGFESG
FT                   NSAAGEMKNPAKDVPISVARSSMIAAASYLLPILAILLVVPLDQITGIGGLFGAIATVY
FT                   TVFGPAAEVMLSVSAVVFCFILVSQGAAWMIISDRMQAMAAADGSFFGGFFGRFHPKLG
FT                   TPIRVNTLSGVVATLFMLAAMQLSGTSSALFGVVLSIAISTFLLSYLLAIPAAVKLRSK
FT                   YPHADRPFKVPVSDTGFRILGYICFAWILIGSWVAIFPGTLDVLFGLPYDFEATWGVSQ
FT                   FTFEAFALGTLGCILALGLVGYARGKKVRDAVAPVSETAELVND"
FT   gene            complement(601343..602692)
FT                   /locus_tag="AAur_0583"
FT   CDS_pept        complement(601343..602692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0583"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08129"
FT                   /db_xref="GOA:A1R2C7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C7"
FT                   /protein_id="ABM08129.1"
FT                   /translation="MTVMHGRDVPSTQGEATGQKDPKKAAMSGWIGSALEYYDFALYSL
FT                   AATLLFPTIFFPTENPTVGIIASLATYAVGYVSRPLGAVILGAYGDRHGRKKVLVFAML
FT                   LMGFATFAVGLLPTYGQVGLLAPVLLVILRLVQGFAVAGELGGASAMIVEHSPDAKRGF
FT                   FASFSLQGTQVGSILATAVLIPLAAFLPDEQFHSWGWRLPFLLSAVVIVAGYVIRRRVE
FT                   EPPAYLAQSEDAGAKRRFPLVDLLRTHPWVLLRCIIMTFTNVIGMATLIFGVSFATQKG
FT                   YGIGFSSSEFLWVTMAANVAAVLTIPLFGALSDKIGRRALMVAGGITGGLLTVGYLWAI
FT                   EQRSLPLVFVCVVIVQGILFQMWNATFATFFQEQFPMRMRVTGFAVSQNIGLMIASFFP
FT                   SLFTAIAPPGSANIPMVIGLTTLGICVVSAVATLLSSDTKGKTLEDLEAR"
FT   gene            complement(602903..603736)
FT                   /locus_tag="AAur_0584"
FT   CDS_pept        complement(602903..603736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0584"
FT                   /product="haloperoxidase"
FT                   /EC_number="1.11.1.-"
FT                   /note="identified by similarity to GB:AAB84315.1; match to
FT                   protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08449"
FT                   /db_xref="GOA:A1R2C8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C8"
FT                   /protein_id="ABM08449.1"
FT                   /translation="MGFIKVGTENTTDIELYYEDHGTGQPVVLIHGYPLDGGSWEKQTA
FT                   ALLNAGYRVITYDRRGFGKSSKPTTGYDYDTFAADLNTVLETLDLENAVLVGFSMGTGE
FT                   VGRYIGTYGEARVAKAAFLASLEPFLLQTDDNPTGVPSSVFDGIRNAAIEDRYAWFTNF
FT                   YNDFFNTDNFLGNRLSEEALRNSWNVAAGSSWYASFAVVDSWLTDFRSDIEKVTVPSLI
FT                   VHGTDDRILPIDSTGREFTKRLPSAEYVEIEDAPHGMLWTHGTEVNEILLRFLAK"
FT   gene            603833..604396
FT                   /locus_tag="AAur_0585"
FT   CDS_pept        603833..604396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0585"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09865"
FT                   /db_xref="GOA:A1R2C9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2C9"
FT                   /protein_id="ABM09865.1"
FT                   /translation="MDISEVRNRIVATADELYNAKGIQAVGMDELRSAAGVSLKKLYGE
FT                   FPSKSSIVMAVLEHRHQSWTQGLDATVQQAGTPRERLLAIFDYLAGWFCQDSFRGCGFI
FT                   NSFAELGAISPDVAEYARKHKESFQEYVARLAGEAGAPKYLAPQLAILAEGAQTTAAIA
FT                   GTSDAAGQARQAAEVLIDAALTSN"
FT   gene            604486..605742
FT                   /locus_tag="AAur_0586"
FT   CDS_pept        604486..605742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0586"
FT                   /product="putative Sodium/hydrogen exchanger family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10144"
FT                   /db_xref="GOA:A1R2D0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D0"
FT                   /protein_id="ABM10144.1"
FT                   /translation="MLAAAVLPKLLRHMPLSMPMVFLGSGILAFTLLPELPDPDPVKYG
FT                   DFTTHLTEVCVIISLMGAGLALDRPFRWRGWSTTWRLLGIVMPLCILVMTLLGLWVLGL
FT                   GLAGAILVAGAIAPTDPVLASEVQVGKPADAEDDPDEDEVRFALTSEAGLNDGLAFPFV
FT                   YLAILISLVGASPDAWLGEWVALDVLWRTVAGVLVGFGTGKLLSMFFFAAKGKTFRLSE
FT                   HSEGFVALAATFLAYGAAEMVEGYGFVAVFLCALTIRSAEHNHSYHQVLHSYVEQLERL
FT                   MTVVILVLLGGAIARGLLEGIGWTEVLVALAFLLLVRPLAGWLGLMGGKTGPRERLAIS
FT                   YFGIRGIGSLFYVAYALTHGNFDAEARELWALIGLVVALSIVVHGATTAPLMNRLDRLR
FT                   VAEARKQHGDEGRAPTTAV"
FT   gene            complement(606569..607717)
FT                   /locus_tag="AAur_0587"
FT   CDS_pept        complement(606569..607717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0587"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08196"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D1"
FT                   /protein_id="ABM08196.1"
FT                   /translation="MCRGGFPCPGSTALLGLAACGVKMGAVVCALTTGTEPGPLVAGTD
FT                   SVAVAVDGAWCTPACADHHHPRSSRVSPTAARAENDAPLRRSARCLRKLLLLVASPAPA
FT                   HQQPACQEDDAHAAKAHQECSDDRCLLGSAGTGQSDGGIHIGALVPPCAGQGNCLIRSR
FT                   SCCSGSGCRSGRRRRRLSCSHRGGGRRRRRLSCSHRGGGRRRRRRRRRLSCSHRGGGRR
FT                   RRRLSCSHRGGGRRRRRLSCSHRGGGRRRLSRRLSCSHRGGGRRRRRRRLSCSHRGGGR
FT                   RRRRLSWSDRYRRRRGCGARGRRCCGRGDAGGGGHHVGVEGDLSVTGKQPPLHNCVGLS
FT                   CYRCQREDGPLETRSSAQRCRAANLPEHVARLGAVSEHDAAG"
FT   gene            607731..608141
FT                   /locus_tag="AAur_0588"
FT   CDS_pept        607731..608141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08811"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D2"
FT                   /protein_id="ABM08811.1"
FT                   /translation="MGMDQAVVSLAPTVQELELNSIVPPHTPDAYWLSPYGMPGEGSMN
FT                   TTYVVGHSWEGGASPFNNISTLAKAGDLLTITTAEGQLDFKVDDVTTEYKETLRDSKIW
FT                   DIVPGRLILITCYAADLWGKNIIVQASPLPAP"
FT   gene            608242..609369
FT                   /locus_tag="AAur_0589"
FT   CDS_pept        608242..609369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08409"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D3"
FT                   /protein_id="ABM08409.1"
FT                   /translation="MKPRPQSDAVDNEGPTPLSKGRRHLAMRLDDAWLGFQTRLAIRRG
FT                   RVETVIPYTGYGSTSWVRVLARIVRSDPRDAAGHTNPLQESMRGWRNFTSAPVAHASVQ
FT                   VTIDGTVHDVVADRGGVVDARIPVALDAGWHTITLRSGESETVEAPVEIVADDAVFGVV
FT                   SDIDDTVMVTALPRPFLAAWNTFVLNEHARTPTPGMAVLYERIARTAPSAPVLYLSTGA
FT                   WNVAPTLSRFLSRNLYPAGPKLLTDWGPTPDRWFRSGQEHKRTSLERLAEEFPNIKWLL
FT                   VGDDGQHDEAIYSEFAQRHPASVRAIAIRQLSAGEAVLAGGRSKSGGQPTPGVPWIYAP
FT                   DGAGMSAQLEELGIIRNEVRSADDPEEGEVTTGSD"
FT   gene            complement(609511..610446)
FT                   /locus_tag="AAur_0590"
FT   CDS_pept        complement(609511..610446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0590"
FT                   /product="putative CAAX amino terminal protease family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09967"
FT                   /db_xref="GOA:A1R2D4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D4"
FT                   /protein_id="ABM09967.1"
FT                   /translation="MKVADGGRWAWPLFLVLAYGITWAVQIPAYLYLVPRNVVPTNESN
FT                   FLMLGQLGGGGVDAGAAVAVLLLCFSFGPSIAGIIVIALARGRPGLRELFSRLAKARIP
FT                   GKWIAFVVVFPAALSVTAVSLGWVLGGMPAINYRFLVPLALAVPFLLFLIVCTGLAEEL
FT                   GWRGFALPHLQRTRTAERASWILGLAWGLWHVPSVVLLPLMTGAANIFQAAFSVVGLTI
FT                   GVVGYTIVLTWLYNNTGSLLWIVVLHGYANAWQSYVVLSSGNFTAQVVYGVLPWVLAAW
FT                   LLKKYGTESLTNRKPRPDAPGRPRSVPNTG"
FT   gene            complement(610503..612224)
FT                   /locus_tag="AAur_0591"
FT   CDS_pept        complement(610503..612224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0591"
FT                   /product="putative PHP domain protein"
FT                   /note="identified by match to protein family HMM PF02811;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06539"
FT                   /db_xref="GOA:A1R2D5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D5"
FT                   /protein_id="ABM06539.1"
FT                   /translation="MCTAEENTTTHSRSVELADAELKTMGLSRRRILQSAGILAAGTAA
FT                   SAAMARPAMANPGGNDPQLKWLVGDHHVHTQYSHDAKYLIKQQLDAAQSYGVDWLALTE
FT                   HSNFGHANNGGAVNANKEIQAQRSARPELLIFQGLEWYIPGAEHASVLVAPGPNEVNLL
FT                   RTFELVWDGKLNQWEKPAPGTAQVETFERKAVEAIAWLANQRRSGYIDDVVALANHPMR
FT                   LGIDSPHELRAWRDAAREVMIGMEGAPGAQGSGVSQFSRAGDQRGEYTNNPTQYSFPGY
FT                   PADAFRPYGGFDWATATVGGVWDSMLAEGLPFWITSNSDNHLTVKDTWKTGPYPAEEPY
FT                   LSLPNEFDRWSVTGNCPDPFDTGEKQGGSDYWPGQFSRLHTGVTKHSYTGVLDAMRNGR
FT                   MWVDHGHLLQGLDVRVREVRGNGGNGNGRNGVTLGSRLQVKRGADVEISITITTTDYRN
FT                   FAGILPNLAHVDVIGGAVTGAAADRDTLKAPGTTVWNQIDVSGRTETFTIKHVIKDVQA
FT                   SCYFRLRGSDGNRHGAGYYGASVDPAGPIRHGDNLGDADPWTDTWFYANPVFIDVA"
FT   gene            complement(612367..613284)
FT                   /locus_tag="AAur_0592"
FT   CDS_pept        complement(612367..613284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0592"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10211"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D6"
FT                   /protein_id="ABM10211.1"
FT                   /translation="MNTGKSNTIGVVVGDIENPHFGLAMRGITDTAKKSGYNVILINTD
FT                   EERAAEVDAVRVLLDKRVDGLIVAPASSVETSHLQQVRESGRPLVLLDRAAAGVDVETF
FT                   AVDMGSISYESTQHLIKAGHRRIAFVSTVRTDAPYVPGMTLDSSQISDRLDGIRRAFDE
FT                   AGLPHPTDLIRLNAGDADSIIRITRDLLSGPDAATAIIASDGLIALSVVEAIQEAGLSI
FT                   PGDVSFLMYDDFAWTRLTTPPLTVIAQPVYDMGIAAASALIRQIEGRKAAGPGPELAAT
FT                   LIQRGSVGAPGIGAEIAGILPDRW"
FT   gene            613696..614517
FT                   /locus_tag="AAur_0593"
FT   CDS_pept        613696..614517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0593"
FT                   /product="amino acid ABC transporter"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06846"
FT                   /db_xref="GOA:A1R2D7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D7"
FT                   /protein_id="ABM06846.1"
FT                   /translation="MAAILALSGCGGSTASSSPSAENPYGLIEPGTIRVASLGDSKPYT
FT                   FTDSSGNFTGFDVELFKDVAHRAGVDNVVFTGQDFSGLLAAVANGQFDVGVAAIGITDK
FT                   RKETVDFSDGYLAGYLTVITTKTSGINDADGLNGKRLGVVQGTLQEAYAVKNFTSAQLV
FT                   RFPDNNTAISAVNSGSVDAHFLDYEAAKEYQEQFGLVSAADIPSFDAPAGFAIAKDKPA
FT                   FKEALNKGLAEAMEDGTWKKLYEKWFPGSPMPEQYLPKAEQTSSPSPTASK"
FT   gene            614551..615339
FT                   /locus_tag="AAur_0594"
FT   CDS_pept        614551..615339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0594"
FT                   /product="putative amino acid ABC transporter, permease
FT                   protein, His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07360"
FT                   /db_xref="GOA:A1R2D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D8"
FT                   /protein_id="ABM07360.1"
FT                   /translation="MDWLNTISRTFFDFDAMVEVLPQLLGVGLLNTLIISIAATILGVV
FT                   MGMVVAVMGISRSKWLRIPARIYTDLFRGLPAILTILLIGQGFARLSQSVFGPSPYPLG
FT                   IIALSLIASAYIGEIFRAGIQSVDKGQGEACRALGMSYSKSMALVVVPQGIRRVLPALV
FT                   NQFIAIVKDSSLVYFLGLLVSERELFRVGQDAAVLSGNLSPLVMAGIFYLIITVPLTHL
FT                   VNYFDNKFRTGRRRPTAPTSGLKEVKELDAASPLITGSNT"
FT   gene            615336..616127
FT                   /locus_tag="AAur_0595"
FT   CDS_pept        615336..616127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0595"
FT                   /product="putative glutamine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09294"
FT                   /db_xref="GOA:A1R2D9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2D9"
FT                   /protein_id="ABM09294.1"
FT                   /translation="MNLTSSSSATSTNQPSSDIEKFHGSSLELQNLTMAYGDVEVLRNV
FT                   SLNVAPGTTTCIIGPSGSGKSTLLRGVNRLHEPKSGDVLLAGESALKVKPDILRARIGM
FT                   VFQHFNLFPDHTALENVALALWSVKGMSKSEARERAQRRLAEVGLAERADHRPRDLSGG
FT                   QQQRVAIARALAMEPEVMLFDEATSALDPELVKGVLNLMAGLGRRGMTMLVVTHEMGFA
FT                   RKVADQVVFMDEGEVVEIGTPTELFDNPRSERLQRFLSEVL"
FT   gene            616127..617188
FT                   /locus_tag="AAur_0596"
FT   CDS_pept        616127..617188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0596"
FT                   /product="oxidoreductase family, NAD-binding Rossmann fold
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF01408; match to protein
FT                   family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08041"
FT                   /db_xref="GOA:A1R2E0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E0"
FT                   /protein_id="ABM08041.1"
FT                   /translation="MGGTPLPGMATAAPIRTAVVGFGVSGKVFHAPLIEADPDYSLDVI
FT                   VTADPHRMAEAGRLYPQARIVPTPEDMFALADDLDLVVLGTPPLTHLELGATAIAHGLN
FT                   VVVDKPFVTTVAHGAELAGRASDAGVQLTVFQNRRWDADFLTLRKLLQDGTLGEVRTFE
FT                   SRFEWWRPEGFGNWRDSATLAQGGGILHDLGAHLIDQAIQLFGPVEESYGETANHGPHT
FT                   EAADTEAFVSLRHESGVRTRLWMNGMAAQVGPRFHVLGSKAGYTKWGLDGQEPALAAGI
FT                   TPSDATYGTEPQESWGLLGVDGSATPVPAEKGDYPQFYRELAASLRGRGPLPVQPAEAL
FT                   ETLRIIENIHAFA"
FT   gene            617253..618365
FT                   /locus_tag="AAur_0597"
FT   CDS_pept        617253..618365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0597"
FT                   /product="fructosyl-amino acid oxidase"
FT                   /EC_number="1.5.3.-"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07460"
FT                   /db_xref="GOA:A1R2E1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E1"
FT                   /protein_id="ABM07460.1"
FT                   /translation="MSSTKHVAVIGGGILGVSTAVHLLRQGASVTLLTEQGLASEATGR
FT                   SLSWLNSAGERSTPYHQLRVAGVDRYRTLFAADPSREWLQFGGGLMWNAAGQSEVTEAR
FT                   HAYEKSIGYDSKLLAPEEIASVTPGIDAGAVPEKAIFNPGEGWVSLPDLVNFLMEEFHA
FT                   LGGQLVLNAGKASVMVDGGRATGVETTGGETYPADAVLVACGAATPAVVKPLGVEIPNG
FT                   SPVSMLVVTKPVEHQVTAVMNTPRAAVRPNPGNTFALDHDWYEEHITEHADGSFTIPDD
FT                   VVQQLADESSKLIAGNPELKPASWKIGYKPIPGDGEPVFGELGQVPGCFVAFTHSGATL
FT                   GLIAGELLSGEILSGEEHPMLATFRPGRFS"
FT   gene            complement(618445..618879)
FT                   /locus_tag="AAur_0598"
FT   CDS_pept        complement(618445..618879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06806"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E2"
FT                   /protein_id="ABM06806.1"
FT                   /translation="MTPRNSFLRALVIVAVVVFGLIVAPTAAVAAFTDIEQATPQFSAA
FT                   SIPAPATASVTMKCTLGLHTVVTVNSYGPVANANYYEVKIFDRLGNLEFTGDLSQAAGR
FT                   TYSSGIEIIGTWSYEVRGYYKVPGSTNFWTGKPLKGTMTC"
FT   gene            complement(619008..619688)
FT                   /locus_tag="AAur_0599"
FT   CDS_pept        complement(619008..619688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0599"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08696"
FT                   /db_xref="GOA:A1R2E3"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E3"
FT                   /protein_id="ABM08696.1"
FT                   /translation="MSAREAEKERPAGPAVASRKDHTQMAISLKTTSGKILASVALVGT
FT                   AAAVAGMGTYGAFTSSTSASQAVTAGTVTIALGAPGPANTLNVPVTGLLPGDKVEKLVT
FT                   LANTGNSDLNNVTLTTSAGATASLLTTDATNGLQLTIENCSVAWTGAAAPYNCTGTKTT
FT                   VLASGPVIAANKALNNLTSLTSAKTDNLKVTTAFPTTANNDFQGAASTIAFAFTGTQRT
FT                   ETTK"
FT   gene            619859..620317
FT                   /locus_tag="AAur_0600"
FT   CDS_pept        619859..620317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07898"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E4"
FT                   /protein_id="ABM07898.1"
FT                   /translation="MTDTEKSATKEKSYDGFTEEERAAMKERAQELKKAPRKKSSKADG
FT                   EADVLAKIAEMPEADKALAERIHAIVKEHAPELTPKTWYGMPAYARDGKNIVFFQSSHK
FT                   FKARYATLGFEENAQLDDGAMWPTSFALTEITPETEARIVELIKKALS"
FT   gene            complement(620329..621465)
FT                   /locus_tag="AAur_0601"
FT   CDS_pept        complement(620329..621465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0601"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08705"
FT                   /db_xref="GOA:A1R2E5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E5"
FT                   /protein_id="ABM08705.1"
FT                   /translation="MTAPEETAPVSVRKPSKPDLWKDSLGRTATRALQILLILTLTVVA
FT                   VFGLLQIRLLVIPVLIALILAAAIGPFVNMLRRRGWRGGLATGVAFLGLLIVLGGVITV
FT                   IVMSVRSQWDELISQAAAGLDELESFLLTGPFPIDREQLNQAREAVVEFAQSSQVRSGA
FT                   VTGLSVVTEFLAGASLVVVILFFFLKDGAKIWEFFLRPFKGRREAKLRRVGKRTMEVLG
FT                   GYVRGTAIVALVDTVAIGAALLIMQVPLAIPLAIIVFIGAFIPLVGATVAGILAALVAL
FT                   VANGPIVALIVIIVVIAVNQLEGDLLQPVVMGKSLELHALVILMALTAGTILAGIIGAV
FT                   LAVPIAAVTWAIIQVWTAEDPDLEPMNPELPPANSQPT"
FT   gene            621938..623005
FT                   /locus_tag="AAur_0602"
FT   CDS_pept        621938..623005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0602"
FT                   /product="putative saccharopine dehydrogenase"
FT                   /note="identified by match to protein family HMM PF03435"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E6"
FT                   /protein_id="ABM10161.1"
FT                   /translation="MTDFLELDTTGPVLIVGGYGTVGTALTRLAAAEWPLLLTGRNPER
FT                   GSHLISSNVPGEQQKVTVQKWDLNQTEPFAAKIRAVISTVNDPHDRVLRAAVSAGIPYV
FT                   DVTRWTSRVTRALTLATLLQPTAPVLLSSGWMGGVTNIVAAALAHDAGGGDQIDVAIRY
FT                   DINDKAGVDSVDFMDRLGLDFEVRKGGQAAVVRPLTDARWVDIAGHRTKVARLDTPEQF
FT                   TLPLTLGAGSVSTRIGFSSNASTTALLAARAVGLFRWGSGARWAPLRRSFLYSPGSGGT
FT                   AHIRIDVKGPAGTRTAVISDPQGQAHLTALGGLLGLRSVLAEGAGPGVTFPESAPDPAS
FT                   RLAELESHGVTILRS"
FT   gene            623002..623616
FT                   /locus_tag="AAur_0603"
FT   CDS_pept        623002..623616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0603"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09583"
FT                   /db_xref="GOA:A1R2E7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E7"
FT                   /protein_id="ABM09583.1"
FT                   /translation="MTESKGALRKAALLDAAQQVLVTKGNANAAMRDFAAAAGVRIGHL
FT                   QHYFPTRADLIRAVLERSLERSLQRLSEEAGLDLGADAAGSLTREDSHRLLTALLHEHS
FT                   ALEDVKMHLEIWALASADQQAAAALRSFYGQYAAHVSSVVRRGRPELSEPELAGVAAAI
FT                   VSLFEGAAVTRSDIAGLRTEHGDGAIIRAAQWLIHGQEPTQ"
FT   gene            623613..624887
FT                   /locus_tag="AAur_0604"
FT   CDS_pept        623613..624887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06431"
FT                   /db_xref="GOA:A1R2E8"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E8"
FT                   /protein_id="ABM06431.1"
FT                   /translation="MTHLVPTPAQVRWQQLEFGVFIHYGINTFAGKEWSDGTVPASIFN
FT                   PTELDAGSWVRAAKEAGARYLVLTAKHHDGFCLWPTVTTDYSVASSPWRDGQGDVVREA
FT                   ADACAEHGIGLGLYLSPWDRNAECYNDPAAYDDFYVQQLTELCTGYGPLMELWFDGAGS
FT                   VGREYDWGRIIAVVKEHQPEAMIFNMGQPTIRWVGNENGLASDPVNYVVDRTSDTQYTE
FT                   TSSGLLAELYLPPECDVSIRRGWFWHPDDQPKSVEHLLAIYYQSVGMGANLLLNLPPDS
FT                   RGRLPDEDSARLREWKRELDRRLSGVVEASVENHDGQATLSFPASVTFNHLELVEDLSS
FT                   GQRIRRHVVAADGVDLADGMTVGNRRIHQLPATTASRLHVRFGGAGDGEGSGGRLVSAR
FT                   VYTGALDAGVPAIPEGYEAPTDEPE"
FT   gene            624932..626470
FT                   /locus_tag="AAur_0605"
FT   CDS_pept        624932..626470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0605"
FT                   /product="putative HNH endonuclease domain protein"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06959"
FT                   /db_xref="GOA:A1R2E9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2E9"
FT                   /protein_id="ABM06959.1"
FT                   /translation="MDMERIRERQAGAVVADALVAASSRGLPASALQLGPVPASKVPAG
FT                   PVPAGPVPASKVPASPVPASTVSSDLIEQLRVLEEMKSAISGLQARVAVAFDLAQRAEQ
FT                   AEAGVPASERGQGVGAQIALARLESPNRGSRLLGLAKALVTEMPRTLAALQSGQLNEWR
FT                   ATLLVRETACLSVEDRCAVDEELAADTGTFAGKGDKAIIAAAKAAAYRRDPRSVARRAS
FT                   RAAAERTVSLRPAPDTMTYLTALLPVAQGVAAYASLTRAADSARASGDTGPGGDTGSRG
FT                   DVRGRGQIMADTLVERITGVPGGVSGVELQLIMTDRTLLQGDNEPARLQGYGIVPSEWG
FT                   RKLLRLGRPESTAAVGEPGQTRQEQVPDSLEPANLSPEQADQDHEFRIWLRRLYTAPAS
FT                   GELLTMDSKARLFPTRLRRFIEIRDDTCRTPYCDAPIRHIDHVLPWRSGGTTTVENGAG
FT                   LCEACNHTKESPGWNNKTVNRDGQGNHTLEVSTPTGHTYQSKAPPLPGHRPSRT"
FT   gene            626757..627311
FT                   /locus_tag="AAur_0606"
FT   CDS_pept        626757..627311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0606"
FT                   /product="putative RNA polymerase sigma (70) factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07269"
FT                   /db_xref="GOA:A1R2F0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F0"
FT                   /protein_id="ABM07269.1"
FT                   /translation="MTDALTDEALQALKGNNAELFGAVYQAYAGQVLGYLTAKGVSDPE
FT                   AVTQDVFLAVLPRLDGINGGVHGLRTFVFSVAHARMVDEHRKQSRSPEQHEFEAERDTR
FT                   EASSAEAEAMGRLAPYEVMALLDHLGAEQREVLTLRIVAGLTVDQVAEIMGKSAGAVKQ
FT                   LQRRALITLRELSAVKEYVSP"
FT   gene            627407..628168
FT                   /locus_tag="AAur_0607"
FT   CDS_pept        627407..628168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0607"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07862"
FT                   /db_xref="GOA:A1R2F1"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F1"
FT                   /protein_id="ABM07862.1"
FT                   /translation="MGSFANLEAPTPGPELSAMLAGPHDEVSKRRWRHKHRTAVVSVAV
FT                   VAAMGLGVSGVAAASSGFTRNPSFIDELLGNYSPQPAAAPVLPVPDAPRVTTEPAPVVD
FT                   PAAVPPIPAASSIPVPGSAAPAETQAQAQAQAAAPTEALAQPQPQAPAAQAQPPVPSVV
FT                   QPPADAPPSNVAPNPARSPQAEPGPAKDEKQQAAKPDASPQDAGKPAKPLPGVEGNRPG
FT                   HVPPGLINQRAEEQFQGGVDKWKQWLKSGDH"
FT   gene            628181..628603
FT                   /locus_tag="AAur_0608"
FT   CDS_pept        628181..628603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0608"
FT                   /product="putative CoA binding domain protein"
FT                   /note="identified by match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09559"
FT                   /db_xref="GOA:A1R2F2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F2"
FT                   /protein_id="ABM09559.1"
FT                   /translation="MHVNDPAVVERLMRTKGTWAVVGLSTNQWRSAYDVSLYVRDTMGM
FT                   EIIPVNLKGEDVHGEKGYKSLADIPEAKHPIDVVECFVNSQRVGAVIDQAIAIGAKAVW
FT                   LQLGVFDDDAAQRAREAGLDVVVNSCPAREGWHYGL"
FT   gene            628667..629581
FT                   /locus_tag="AAur_0609"
FT   CDS_pept        628667..629581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0609"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07793"
FT                   /db_xref="GOA:A1R2F3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F3"
FT                   /protein_id="ABM07793.1"
FT                   /translation="MFGGHSAVSISTPSRRAVFSVLGASVVAGLTACTAAEGAETTQGA
FT                   GTTQGAGTTQGAGTAQRSTPALTPTTAAESPGVPPASASPTPTPTPTKRIRRTFIPDYQ
FT                   LPPIVSGLAPVITKIETKHPVVFLTIDDGNIKTPESIKLMAEYDYPSSLFLTKDTIADN
FT                   PAFFNAFKAQGSLIENHTVTHNINMVRQWGYQQQLNDMVGMQEYALQHYGRRPTLFRPP
FT                   GGAYSNVMRQAVADAGMKAIITWEAKANAGKMDYQVGNALRPGDIVLMHFRAEFAADLA
FT                   AFRAAQLAAGLEVVLLEDFLGVA"
FT   gene            629631..630041
FT                   /locus_tag="AAur_0610"
FT   CDS_pept        629631..630041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0610"
FT                   /product="putative Protein of unknown function (DUF419)"
FT                   /note="identified by match to protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06419"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F4"
FT                   /protein_id="ABM06419.1"
FT                   /translation="MDVPTLRAICLGFPGAFEDFPFGPETSVFKVRSAVAGGSRQEAKM
FT                   FALSSMDPENWSVSLKCEPALAEQLRAANPEITGAWHMNKTHWNGVRLDGTLPDDMIRD
FT                   MVEDSYDLVVATLSRRQQEQLGWARLAKPQGN"
FT   gene            630138..630764
FT                   /locus_tag="AAur_0611"
FT   CDS_pept        630138..630764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0611"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06462"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F5"
FT                   /protein_id="ABM06462.1"
FT                   /translation="MLDQKTLDHLWNFRDPAASEATFRAAMSEKAYDADERAELATQLG
FT                   RAISLQGRFEEADALLDDIDDDEPTVGVRILLERGRVLNSGGRGAMAVPLLEQAAELAD
FT                   HLGEEFLAVDALHMLSIADAANAEVWMRSALEYASTAHDERTKRWMIALHVSLGELLQG
FT                   KKRLTEAMVEYQLAEQWAERLGTERQRVMARHAITECGKALAEGP"
FT   gene            630942..632351
FT                   /locus_tag="AAur_0612"
FT   CDS_pept        630942..632351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0612"
FT                   /product="putative extracellular solute-binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08779"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022386"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F6"
FT                   /protein_id="ABM08779.1"
FT                   /translation="MNVQHQSVGRRGFLRGALAAAVLVPMGGTIASCAAGGGSTTAGPT
FT                   GTVSDTNPFGMAEKATLDAVIFKGGYGIDYVEFAGKIFEKTHEGSTAKISPSTDIAQEL
FT                   QPRFVGGNPPDLIDNSGAKRIGFSTILPQLEDLTSVVEAKNLEGKVIKDTLYGGVLAPG
FT                   TFEGKLAAVNYVLTVYALWYSDSLLKENGWTVPKTWDELYALGEQAKAKGKYLFVWGKE
FT                   AATYYQELAIDSAIKEGGDEVRLGLENLKEGCWSHPAIQSVFTALDKIVKAGFFKPGGS
FT                   GTQFTAAQAQWSNAQDAVFYPSGSWIENEMKDQTKAGFNMMGAPVPTLTSSPKMPYTAL
FT                   HSAAGEPFIVPSQGKNAAGGKELLRIMLSKEAATNFAKTKLAPTIVKDTVPADGFGSTA
FT                   LVSQTKLLEDAGDDIFTWTFVDLYGTNKDQLVVWNTFLDGKSDVATLTSALQNITDKVR
FT                   NDSSVKKIEVK"
FT   gene            632357..633373
FT                   /locus_tag="AAur_0613"
FT   CDS_pept        632357..633373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0613"
FT                   /product="putative ABC-type sugar transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09246"
FT                   /db_xref="GOA:A1R2F7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F7"
FT                   /protein_id="ABM09246.1"
FT                   /translation="MKTQQSRSDDGLTAVVPATAPQQVVKRRRKPLTWDKVSFFAVFLG
FT                   LPLAIYLLFVIWPFVQAFGYSLTDWSGFSPTQNFIGLENYAKIFTDDIFMKAMGNNILL
FT                   VIFLPIITIILSLVLASLVTVGGSSKGQIKGLRNSSFYRVVSFFPYTIPAIAIGIMWGQ
FT                   IYDPSGGLLNGILTGLGFDQFKDFAWLGDKNTAMIATMFVIVWGFVGFYMVLFVAGIKG
FT                   IPAELFEAARIDGAGRFRTAVSITIPLIRDNIQTAYIYMGILALDAFVYMAALNSGGGP
FT                   DNSTLVMAQQLFFTAFSKGQFGLASAMGVVLAVATLIFSGLVFLVNRLTGGDKDVSL"
FT   gene            633373..634266
FT                   /locus_tag="AAur_0614"
FT   CDS_pept        633373..634266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0614"
FT                   /product="putative ABC-type sugar transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07388"
FT                   /db_xref="GOA:A1R2F8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F8"
FT                   /protein_id="ABM07388.1"
FT                   /translation="MTTKVSTPEMKSLHFQPRTPATTTGDKVVGAVSHTALTIWTLIVI
FT                   LPLLWTVMSSFKTSSEIFASPFALPAEWKLDNYTKAWSEAGIGSAFLNSVLVVAVALVI
FT                   VMVLGAMCAYVLARYTFPGSRAIYYLMLAGLTFPIFLAMVPLFFVLKNMGLLNTLPGLI
FT                   LVYVGFALPFTVFFLFSFFKSLPHEITEAAALDGAGEWRTFFQVMLPMAKPGLASVAIF
FT                   NFLGLWNQFLIPVSINAAGPRVLSQELAAFAGQMGYAVDFGALFAAVTVTVVPVLIVYI
FT                   IFQRQLQGSVSQGTSK"
FT   gene            634388..634708
FT                   /locus_tag="AAur_0615"
FT   CDS_pept        634388..634708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0615"
FT                   /product="putative antibiotic biosynthesis monooxygenase
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06471"
FT                   /db_xref="GOA:A1R2F9"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2F9"
FT                   /protein_id="ABM06471.1"
FT                   /translation="MIFIVVKFNVKPEWSERWMDLVADFTEATRAEPGNLWFDWSRSVD
FT                   NTNEFVLVEAFQDDAAEAHVNSDHFKKAMADMPQALVETPHIISRQFEGSGWDRMGELT
FT                   IA"
FT   gene            complement(634831..635355)
FT                   /locus_tag="AAur_0616"
FT   CDS_pept        complement(634831..635355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0616"
FT                   /product="nitrilotriacetate monooxygenase component b"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08465"
FT                   /db_xref="GOA:A1R2G0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G0"
FT                   /protein_id="ABM08465.1"
FT                   /translation="MSLAPAFTIPDAMGMRRAMGRFLTGVAVVTTQHEDEQYGMTISSL
FT                   TSISLEPPILMISLNFGTRTGEALMESGKFAVSILGAKQESVARRFAVRGGDRFGDGDF
FT                   DITDNGLPVIKGALAQADCTVVQQYDVGDHQVFFGQVTTCRDRDGEVLAFKAGRFGSFS
FT                   DFGHAEIPWMF"
FT   gene            complement(635357..635728)
FT                   /locus_tag="AAur_0617"
FT   CDS_pept        complement(635357..635728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09356"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G1"
FT                   /protein_id="ABM09356.1"
FT                   /translation="MAKPEFEFTPVSSVDFAPCNPHIEGLSEAILARDSDNDSVTRILK
FT                   FEPGTDTSPNGVLTHDFWEEVFIFEGSFVDQRLGRTFKAGDWATRPPGMEHGPWVSENG
FT                   AKMFEVRYYTEPTPAERSN"
FT   gene            complement(635731..637203)
FT                   /locus_tag="AAur_0618"
FT   CDS_pept        complement(635731..637203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0618"
FT                   /product="putative 4-hydroxyphenylacetate 3-monooxygenase"
FT                   /note="identified by match to protein family HMM PF03241"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07257"
FT                   /db_xref="GOA:A1R2G2"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G2"
FT                   /protein_id="ABM07257.1"
FT                   /translation="MRTGKEYLKSLNDGRSVILDGEVVGNVLEHPAFANVARTMAELFD
FT                   IAADPENGMQFHSEEIDGPANRTFAAPRTQEELVLRRQAIEKWAKHTHGWVGRSPDHVG
FT                   TFFAAFGSHPDVFKNDERDFAGNVERYYKKILSENLYLSYAIIPPQVSRATTASGWEGE
FT                   YLQVGVVRETEEGIIVRGSQMLATGAAIADEVFVTCIKPLGPDDVDFAVSFAIPVATDG
FT                   LKLYCRRPFAPAATSDFDYPLTSHYDEPDALVVFDDVLIPWDRVFINRNIDTLRRQFFD
FT                   TGAHALGNWQAQIRFSTKLKFIASVARKVTQVNGTDKIPGVQEKLGELAAIVQSVESAV
FT                   LAAEYTATTDDAGMRVPGKSALYGAMGLQSETYPRVISILRDVVGGGVLQLPSSIADMT
FT                   SSVTRPDMERYVQSPGVTSEERVKLFKLAWDIIGSEFAGRHQQYEMFYAGAPFVVRGAY
FT                   TYRNYGYDALVAELDTFLGSYSIASATESEGI"
FT   gene            complement(637203..637886)
FT                   /locus_tag="AAur_0619"
FT   CDS_pept        complement(637203..637886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06659"
FT                   /db_xref="GOA:A1R2G3"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G3"
FT                   /protein_id="ABM06659.1"
FT                   /translation="METTRQVPLTFRVVGTDQTIVVSDFHGVVAGYTGRDPKAVQHHID
FT                   ELAAIGVAPPPEVPMFYRMDSDLFETSGEHDTSENLTSGEIEPLYIRHNGQYYLGIGSD
FT                   HTDRDIEARDIGDSKRACPKPVAGEVIAVESLEDLDLDTCTARSWVDGTLYQEGSLSGL
FT                   RKPADVVERLLARTDIGDADFMCLGGTLPLLNGKFVDGTSWKLELSFPNGTTIEHNYKI
FT                   KKGSL"
FT   gene            complement(637924..638718)
FT                   /locus_tag="AAur_0620"
FT   CDS_pept        complement(637924..638718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0620"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08474"
FT                   /db_xref="GOA:A1R2G4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G4"
FT                   /protein_id="ABM08474.1"
FT                   /translation="MKIALVQVASPDSETREDRIDRVEAILRGINGAELIVLPELWSAG
FT                   YFHFDEYEALAETLTGPTVSMCSRVAADLGVYLHLGSIIEAGQDGQLSNTSILLGPDGS
FT                   VVHTYRKIHVFGYKSKEASLLTAGSSLPVVPLPFGSVAGITCYDLRFPGLWMELSTRGA
FT                   EIVIVPAAWPAARREHWRLLTTARALEHQIFVIACNAAGTQEGVALGGHSRVVDPSGTV
FT                   LAEADSDEAVLMVDIDPLQVDAVRSEFPVIGDRLPAYNTLTV"
FT   gene            complement(638715..640076)
FT                   /locus_tag="AAur_0621"
FT   CDS_pept        complement(638715..640076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0621"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09911"
FT                   /db_xref="GOA:A1R2G5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G5"
FT                   /protein_id="ABM09911.1"
FT                   /translation="MTELKKAELRQQKHSSLPVVAASSLAGTAVEWYDFFLYGTAAALV
FT                   FNKLYFPTDDPLVGTMLALGTFAAGFLARPIGAIVLGHLGDKHGRRATLVASLMLMGVA
FT                   TTLIAFIPSYAAIGLAAPLLLLLLRLIQGFALGGEWGGAVLLVSEHSNESTRRAFWASW
FT                   PNMGPPLGNLMAAGVLAILAATMPESEFLAWGWRIAFGLSALLVVIGLILRLYVQETPL
FT                   FKEAQRKREAEGNKERKMPLTILFRRNWREILIATGSRMGENAGFYIYSLFIITYVTQI
FT                   MGLQRQTGLTAVMIGQGVAVVAIPILAIYADKVGRKPILIGASIATMVWAFAFFFLLNT
FT                   GQVWGIIAAAVGGLLIFAAYSSVIGAFFSELFPTDVRYSGTSVSYNLASLIAGSLSPII
FT                   ALALYSAFGTGYAIGIYLAAMGLISMVSVMFAKETKGLKLSDLDEPTSKEKEQA"
FT   gene            640298..640939
FT                   /locus_tag="AAur_0623"
FT   CDS_pept        640298..640939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0623"
FT                   /product="transcription regulator, GntR-family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09444"
FT                   /db_xref="GOA:A1R2G6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G6"
FT                   /protein_id="ABM09444.1"
FT                   /translation="MIQMTPAAQSQPEVAYQWMKSFISALPREEETFLNEAVLAKTTGT
FT                   SRTPVREALLRLEAEGFVKRIPHKGAFVPPISDPDVRAILQARSVVEKWAVSALESMLD
FT                   AQIDAFQRVIDQQQEAKDDPARFIELDTEFHTLMVRAGGNPVLADFYASLRQKQLRIGV
FT                   KAVSQQTDRAGDVLREHQLIVDALRSRSLDAAHQAIDAHLNSTRLAVIGY"
FT   gene            complement(640936..641229)
FT                   /locus_tag="AAur_0622"
FT   CDS_pept        complement(640936..641229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0622"
FT                   /product="putative protein of unknown function (DUF503)"
FT                   /note="identified by match to protein family HMM PF04456"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07052"
FT                   /db_xref="InterPro:IPR007546"
FT                   /db_xref="InterPro:IPR036746"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G7"
FT                   /protein_id="ABM07052.1"
FT                   /translation="MWIGWIEFDVLLGDVHSLKEKRSLVRPLVAELKRRFDVSAAETGL
FT                   QDQHRRALVGAAVVAPDHAHLQQVLDAVERFVAARPEFELLSARQRELHSED"
FT   gene            complement(641324..641833)
FT                   /locus_tag="AAur_0624"
FT   CDS_pept        complement(641324..641833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0624"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08203"
FT                   /db_xref="InterPro:IPR028953"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G8"
FT                   /protein_id="ABM08203.1"
FT                   /translation="MSTDVQSMMDRLGPAASLAHYTIENYPDGSWCIYNLGGEVKLWFR
FT                   QENDWFVLSESERDRDERIFFAGADLWDMELVLVYRLANRHRRRMGNPLLVPTSVPVTS
FT                   DQTAKDFELGRNQYGAWVLRNSATGSAWLGRMITLTEFSHFAGLAPWQLWDVMTEQAQS
FT                   SFSTVN"
FT   gene            complement(641823..642155)
FT                   /locus_tag="AAur_0625"
FT   CDS_pept        complement(641823..642155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07918"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2G9"
FT                   /protein_id="ABM07918.1"
FT                   /translation="MAFSPPNLARMGLGVGGFEDGSYLYALKEGKPESFEARSLPVSAL
FT                   ELPYFSYRVADDWPDGMAGWKIQSSSVAPWFGRAGGATQVLFFDEEDTLISVEDLLKMG
FT                   VLTYEY"
FT   gene            642308..643486
FT                   /locus_tag="AAur_0626"
FT   CDS_pept        642308..643486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0626"
FT                   /product="putative GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07325"
FT                   /db_xref="GOA:A1R2H0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H0"
FT                   /protein_id="ABM07325.1"
FT                   /translation="MVLDAFSVRVALGVVTVTLLLLFCASFHRTRSPYAGWWSLALLEF
FT                   MVGNAAFLLNGTPHQLWANPLGNVLVVAGAFSVWAGAKTLRNRKAAPWQLALGPAVTAV
FT                   ASFLENPGNNVWSGGLVYLAMMTLGIALAAYDLWFIKSSHSQVHKALSVAAGMLAVYYL
FT                   CRWVVYALEGPASYTFRTYFGPGPSALISMVLLVTVSFSMTALTSDQLIKGLRERATRD
FT                   HLTGLLNRGAFLDLATTELERLQSTGSGASVVLADLDHFKAVNDEHGHGAGDVALRAFA
FT                   EACAGSVRSTDLIGRYGGEEFVLFLPGATQDRAENIASEISRRMAAMQTPEGVVFPTVS
FT                   YGVTSSIPAVADLNFMIEVADAALYSAKAQGRNRIVGADRLEAATIADEARS"
FT   gene            643483..643986
FT                   /locus_tag="AAur_0627"
FT   CDS_pept        643483..643986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08999"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H1"
FT                   /protein_id="ABM08999.1"
FT                   /translation="MTFNELTTRIQIQHTQELSAFRQDITSAPYKAGTPTTLNADRRSV
FT                   RMSPVQSVEDSNANLTIVADVEGLAWFTADKGLLGSCITVSIAGHRRNTGTRVHLPLAE
FT                   CDAWIEAILGGAWITHVYRAGNKVEPDGRLDIASYRLFLDERRNPVSKPQAVADSSLRR
FT                   LEES"
FT   gene            643983..645401
FT                   /locus_tag="AAur_0628"
FT   CDS_pept        643983..645401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0628"
FT                   /product="putative GGDEF domain/EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08422"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H2"
FT                   /protein_id="ABM08422.1"
FT                   /translation="MSATKPHRLVPADSRIEKLERHVQALMQELHQARYEQRRDALTDA
FT                   LTGLGNRQALVNSFIEAQDAAAKGAVPPALLLVNLDGFKALKNSAGHAASDQILVTVAM
FT                   RIRSAVRENDVVTRLGGDEFAVLLPATPQNRATAVGNRILAALEPNIDLGNNSIRCGAS
FT                   VGLRTAEPHHSIEDILQEADLAMEDSKNEGRNKLKVFDPATLHAQLLQRQIVGELREAI
FT                   RADQLVLYYQPIVELSTGRIEGCEALVRWNHPVHGLIMPDQFIPIAEATGLIAELGRWV
FT                   LRTAVRQLRRWRDHPVTAQQDFSMRINASAADLQSLEFVDAVSAALAEEHLAPDSLVLE
FT                   LTESAIIQNNELDRYTLASLHRLGVGLEIDDFGAGYSSMGYLRKLPVDRVKVDRQFVKD
FT                   LGKDPSQLGFLAAIQHVIHSCGLEGVWEGIETAEQAEALRSIGCASGQGYYFGRPLPEA
FT                   EFTEQLSRLRTWPG"
FT   gene            complement(645476..647785)
FT                   /gene="purL"
FT                   /locus_tag="AAur_0629"
FT   CDS_pept        complement(645476..647785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="AAur_0629"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01736"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09773"
FT                   /db_xref="GOA:A1R2H3"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H3"
FT                   /protein_id="ABM09773.1"
FT                   /translation="MTTETTKKFNIDTVEHAAKTPDTELPWAELGLKQNEFDEIVKVLG
FT                   RRPTGAELAMYSVMWSEHCSYKSSKNHLRQFGEKVTEEMKKDMLVGIGENAGVTNLGDG
FT                   WAVTFKIESHNSPSFVEPYQGAATGIGGIVRDIISMGARPVAVMDPLRFGAIDHPDTAR
FT                   VMHGAVAGIGGYGNCLGLPNIGGEMVFDSVYQGNPLVNALAVGVMRHEDIRLANASGKG
FT                   NKVVLFGARTGGDGIGGASVLASESFDDTKPSKRPAVQVGDPFAEKVLIECCLELFKGS
FT                   LVEGIQDLGAAGISCATSELASNGDGGMEVELTSVLLRDPTLTPGEILMSESQERMMAV
FT                   VTPENIAAFEAVMDKWAVEYSWLGEVTDTGRLIITWEGEVIVDVDPRTVAHDGPVYDRP
FT                   FARPEWQDSVQANSFTGSVEDAGRPSAPTELAAAVTELVASPNMCSKAWITKQYDRYVG
FT                   GNTAMAFPDDAGVVRVDEETGLGVALATDANGRYTYLEPYQGAQLALAEAYRNVATSGA
FT                   VPMAVSDCLNFGSPEDPDVMWQLAEAIRGLSDACMELGIPVTGGNVSLYNQTGTTPIHP
FT                   SPVVAVLGKLDDVARRTPSGWREDGQAIYLLGTTAAELDGSEWSNLRGHLGGLPPKVDL
FT                   AAERALGEILINASRDGMVDAAHDLSEGGLAAALVESSLRYGVGARIALEELMERDGVD
FT                   LFTALFSESQARAIVSVPRSEEVRFKDMCTARGFAHLRIGVVDAAGGKLEINGVDELSL
FT                   DALREAHEATLPKYFG"
FT   gene            complement(647782..648552)
FT                   /gene="purQ"
FT                   /locus_tag="AAur_0630"
FT   CDS_pept        complement(647782..648552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="AAur_0630"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07584"
FT                   /db_xref="GOA:A1R2H4"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H4"
FT                   /protein_id="ABM07584.1"
FT                   /translation="MTSIPLIGEAVAVAAEPRLAGAKIGVVTFPGTLDDRDAARAVRLA
FT                   GGTAVSLWHADTELGDVDAVIIPGGFSYGDYLRAGAISRFAPLMSKIIDAANSDAKLPV
FT                   LGICNGFQILTESHLLPGSMIKNDHLKFICRDQTLRVENANTAWTVDYTDGQEIVVPLK
FT                   NQDGQYIADEKTLDALEAEGRVVFRYVGFNPNGSRRDIAGISNAAGNVVGLMPHPEHAV
FT                   ETGFGPESLDGAPRDTDGLGFFTSVLTKIVGGDK"
FT   gene            complement(648554..648805)
FT                   /gene="purS"
FT                   /locus_tag="AAur_0631"
FT   CDS_pept        complement(648554..648805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="AAur_0631"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02700;
FT                   match to protein family HMM TIGR00302"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06655"
FT                   /db_xref="GOA:A1R2H5"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H5"
FT                   /protein_id="ABM06655.1"
FT                   /translation="MPRIVVDVMPKPEILDPQGKAIVGALPRLGFNSFSAVRQGKRFEL
FT                   TVDGEVTDAILAQAREAAETLLSNPVIEDVVNVEVVEA"
FT   gene            649111..649293
FT                   /locus_tag="AAur_0632"
FT   CDS_pept        649111..649293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0632"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06437"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H6"
FT                   /protein_id="ABM06437.1"
FT                   /translation="MAEKPKSMVLGVVAAAVFAGLGRMVIQKIMADRAAREHRVTAPLD
FT                   KETRAKISDALRTPK"
FT   gene            complement(649434..649742)
FT                   /locus_tag="AAur_0633"
FT   CDS_pept        complement(649434..649742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0633"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06912"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H7"
FT                   /protein_id="ABM06912.1"
FT                   /translation="MLVRQAVGGLTAGANLDVVCFAHEVVVVDAFGALASANVGKNLGK
FT                   ATHGIRVNERSAGGVVLAATDGDSECGASVVVESARANATGGYFGNVFGHCSSWCGS"
FT   gene            complement(649809..650777)
FT                   /locus_tag="AAur_0634"
FT   CDS_pept        complement(649809..650777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0634"
FT                   /product="catalase, Mn-containing"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by match to protein family HMM PF05067"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07655"
FT                   /db_xref="GOA:A1R2H8"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H8"
FT                   /protein_id="ABM07655.1"
FT                   /translation="MYLHTQLLINEIAADEPDPAAANALQEGLGGQFGEMRTMMQYLFQ
FT                   SMNFRGDAASKPYKDLLQGIGTEEISHVELIGTTISQLLDGSPRYQGKKSDPVDQPGAG
FT                   GATPLKIALDTSNIHHYLVGAQGALPVDAAGNPWSGSYVYNSGNLVLDLLYNLMLESTG
FT                   RLQKCRIYEMTENKTARSTIAYLIVRDQAHENAYAKALESLGVNWGKVLPIPKTNAEQF
FT                   PEVKKLLDKGLQSIQYTFSADNLSEAGKLYRGASPSNDGTELSTDVMPEGFPITISPER
FT                   KEEFAPGLDPELLALIQATAEQEMKEADSPKEAKPAATKKK"
FT   gene            complement(650903..651850)
FT                   /locus_tag="AAur_0635"
FT   CDS_pept        complement(650903..651850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0635"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09424"
FT                   /db_xref="GOA:A1R2H9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2H9"
FT                   /protein_id="ABM09424.1"
FT                   /translation="MKILVPDTIELDLAHLVAAGDDVVVYAVDKPVPSEHRDAEVLVVW
FT                   RNTSENLSDAAKEMSALRLVQTLAAGPDSVLAAGFADNVAITSGRSLHDGPVAEHALAL
FT                   ILATVRRLDQLMESQKASSWNQAYNAAQSVPDTEYLYTLDGAKVTIWGFGSIAGRLAPL
FT                   LAALGAKVTGVASSKGERYGFPVVAEDEFPDVLRTTDVLVSILPATQDTADALNEEILR
FT                   SLPASAVFVNVGRGATVDEEALIAALEEGRLRAAALDVTKDEPLPADSKLWSAPNLIIT
FT                   PHVAGNRPKGSAKLVTANISALRDGKPLTNKVAG"
FT   gene            651982..654996
FT                   /locus_tag="AAur_0636"
FT   CDS_pept        651982..654996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0636"
FT                   /product="BNR/Asp-box repeat domain protein"
FT                   /note="identified by match to protein family HMM PF02012;
FT                   match to protein family HMM TIGR01451"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09704"
FT                   /db_xref="GOA:A1R2I0"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I0"
FT                   /protein_id="ABM09704.1"
FT                   /translation="MARNTSSLHVVVSHPPARSSFERTSDLRSCSSPLARIAAVGTVSL
FT                   GLLAGLGLPATAAPIPPSNPAAAPGAFTEANIGADRTAANFFYRIPALTYLGNNVVLAA
FT                   WDGRPGSAADAPNPNSIVQRRSTDGGQTWGPVTVIAAGHVGDASGPKYGYSDPSYIYDA
FT                   EAGKVLAFFVYSKDQGFGGSQFGNNDADRTVISSAVIESSDGGVTWSQPRLITNVTKPG
FT                   TSKTSPVAGDVRSNFASSGEGIQLKYGQYKGRLIQQFAGDIRQTDGTNKIQAYSVYSDD
FT                   HGATWHKGANVGDRMDENKTVELSDGRVLLNSRDNANQGYRKVAISTDGGATYGPVTQD
FT                   TELPDPANNGAIARMFPNAAQGSADAKKLIFTNANSKTGRENVSARVSCDDGATWPGVR
FT                   TIRSGFSAYSTVTRLENDKFGVLYEGNYTDNMPFAKFDDAWLNYVCAPLAVPAVTTAPG
FT                   ATQQVPVTVTNQEAATLSGASATVYTPSGWSATTVPVPDVAPGASVTVNVALTAPANAS
FT                   GPQNLNAAFTTANGRVSQFTFTATVPAAPQVGLAITGTAPARDVVASPYQMGDVLSYSL
FT                   NVKSTANVTANSVPVSGTFDSGFLPPSAPNCRFNNLAAGASYTCTTAKHVITAADIQRG
FT                   YFVPEASFSITASSTPSLTKTVPFTGAAVALRDGLLTADISGARADVGRDLATQPYAAG
FT                   DQVPYAFTVKNTSPLVEKVVPTAGNFSPFLPEGPGNCRYSVLPAGQSYQCATPRHTVTA
FT                   EEAEQGFFIPKTTWEVSSAGQSTKTITVDGGEVDLKVREPKLEGTVSAEWSDADGDRFA
FT                   SVGDPVTYTYTVGNAGNVAVTGLEAPDAGISAATLPAGDTVTATRERVLTAADVAAGSL
FT                   GAVSFEATAWNGSRAVAAAAGSDPLALAVQPARPDSVPTLTVQELGTPPTDLGTADKYR
FT                   TGQKVVLKGLEYGNWYYVYLNKTGYRLGWIFPTTDNAVEFILPSDVKNGRDDAVVLDKD
FT                   GGQVSFDRLQVTPKG"
FT   gene            655313..658432
FT                   /locus_tag="AAur_0637"
FT   CDS_pept        655313..658432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0637"
FT                   /product="putative subtilisin-like serine proteinase
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF02225"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08478"
FT                   /db_xref="GOA:A1R2I1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I1"
FT                   /protein_id="ABM08478.1"
FT                   /translation="MAVGLPLLLSSMAMPAQAAPAPEAPGNVAGVAKKNLDPGSYKDGR
FT                   YMVVLAEKPAATYDGGTAGLAPTKPEEGKKLDVDSAEVKQYQQHLQQKQQEVAQQENVT
FT                   IKRDFTTAVNGFSATLTADQAINLAKDPKVLMVAPDTQYAPDYSTTDFLKLSGPNGTWA
FT                   TQYGGQDNAGKGTVVGVIDTGYTPSNPFFAGEPVGPLVGNPQVGVPYRTADGKIAMLKA
FT                   DGDTFVGECQPGTDTGADYDGSACNSKVLSTHYFADAFLETVPPENRAPEEVISPVDVD
FT                   SHGTHTASTAAGNANVDAVVDGRSFGTTSGIAPAAKLSVYKVCWEDTDPATGGCYGSAS
FT                   VDAIEQAILDGVDVLNYSISGSTTSTTDPVSLAFLSAASAGIFVATSAGNSGPTASTVN
FT                   HGAPWLTTVAATSFSQELQGTVEFSDGSKFRGASIMNREVTGAGVVLSTNAASGEGNAA
FT                   LCAPGSLDPAKVAGKVVVCDRGVVDRTAKSAEVLRGGGVGMILVNLTDSSLDTDKHIIP
FT                   TVHVNPPATQTIKDKVTANPAITVSLLNRDTTGLPAEAQPQIAGFSSRGPLLATDSDLL
FT                   KPDVSAPGVAILAGVSPIGTGGDNFGFLSGTSMASPHVAGFGALILAKNPQWSPATVKS
FT                   AMMTTAGPVKLANGAVNKDVFATGAGQVDPAKVLSPGLVYDATTEDYLKFIQGTGMDLG
FT                   MEGLGTTQARDMNVPSFALGNLAGKIEVTRTLTALTPGTYRASVNVPGVNVKVTPSVLT
FT                   FGAPGEKKTFKVQFENNNAALGKFAMGSLNWQGANKTVTSPIAVRPQSVIADKALAFTG
FT                   TGPNGSGTINITSGTNLPVGVTIDGLSKADSSAVELVPGPFAGETNASNYVKKVTVGEG
FT                   SALAKFSVISSNEAADFDMLVVTPSGQQLPAATASASETLSVPNPAAGDYYVYANLYAS
FT                   PNNQATKATVDAAVLGANQGNASVTPNPIRLANGKTGQISLNWKNLEPGSYIGRLTFAG
FT                   TSEPSFVTVLVNPGGAVVVPDEEDPKKDKKDKKHRGKIRADEPTQSNNAG"
FT   gene            complement(658523..658927)
FT                   /locus_tag="AAur_0638"
FT   CDS_pept        complement(658523..658927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08838"
FT                   /db_xref="GOA:A1R2I2"
FT                   /db_xref="InterPro:IPR023549"
FT                   /db_xref="InterPro:IPR036819"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I2"
FT                   /protein_id="ABM08838.1"
FT                   /translation="MVSANTSDTSTSEYDVDLTVTLTEAPGAESHEFFLRSATGILSPD
FT                   PDSLDSNLPDARAALAAVEQFGEEIFFPEPRPDRICTQQYGGPQVAVVEGWFRGRKVHS
FT                   QFSRTDGCEIARWKTLAALLGNTGGSTGAS"
FT   gene            complement(658957..659895)
FT                   /locus_tag="AAur_0639"
FT   CDS_pept        complement(658957..659895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07697"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I3"
FT                   /protein_id="ABM07697.1"
FT                   /translation="MAASRLRHLPQAQWLGLEAAHHARVARYADPYLARRSAGKKHPVE
FT                   DFLFTYYTQKPGQLLRWHPGDGVVLSGERALERAAWKFYRTLDDGELASVGLAPDTPAV
FT                   TFDRGSFMTDRAEAVRFAGIILGGTAKRPAQFGCFGLHEWAMVYRQEKFELRHEYLQLR
FT                   LGGDGTDAVVEENRIRCSHFDAFRFYTPDAIPLNELTPTRENQRSMEQPGCLHANMDLY
FT                   KWAYKLTPALPSELVMDCFELSWRIRAMDMQASPYDLEEWGYPPIRIETPQGKAEYVEY
FT                   QRAFAAESQELRARVLQAVGPLLDELSGLAA"
FT   gene            complement(659882..660415)
FT                   /locus_tag="AAur_0640"
FT   CDS_pept        complement(659882..660415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0640"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08257"
FT                   /db_xref="GOA:A1R2I4"
FT                   /db_xref="InterPro:IPR023549"
FT                   /db_xref="InterPro:IPR036819"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I4"
FT                   /protein_id="ABM08257.1"
FT                   /translation="MRMRFVRPLPAVLAVAGLAACSGSPTPGTTGSATQAPSSSATSSS
FT                   PSSTATPSASPTSTSAAPGQGNAELSITLLETPEAAPQMFTLVCTNGAPAAESSHPSAA
FT                   EACTALKNSPSLLSPAPTRTDQACTMQYGGPATAKVTGSVDGKEVSASFNRTDGCQIGL
FT                   WDAAKSVLGSDGGL"
FT   gene            complement(660529..660990)
FT                   /locus_tag="AAur_0641"
FT   CDS_pept        complement(660529..660990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0641"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07033"
FT                   /db_xref="GOA:A1R2I5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I5"
FT                   /protein_id="ABM07033.1"
FT                   /translation="MTAVDESTPETDDLLLERQLCFALTVASRSVVGVYKPVLERLGLT
FT                   HPQYLVMLALWERSPRTLKDISDSLLHEPATLSPLLRRLEEAELITRERVPGNERALAV
FT                   KLTDKGAALREQATAVPGEIRERLQLSREEVAELHQAMTGLIAATQRNN"
FT   gene            661107..661331
FT                   /locus_tag="AAur_0642"
FT   CDS_pept        661107..661331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0642"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09413"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I6"
FT                   /protein_id="ABM09413.1"
FT                   /translation="MAKESFTRKFMRATGKFRIIFGPAHSSSLDHEMTDANRKLLAQRQ
FT                   AETQQWETLRRPDGSTYVVPRNPEDKSLR"
FT   gene            complement(661339..662217)
FT                   /pseudo
FT                   /locus_tag="AAur_0643"
FT                   /note="putative transcriptional regulator, IclR family;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01614"
FT   gene            662339..663052
FT                   /locus_tag="AAur_0644"
FT   CDS_pept        662339..663052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0644"
FT                   /product="putative glycine betaine/carnitine/choline ABC
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10275"
FT                   /db_xref="GOA:A1R2I7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I7"
FT                   /protein_id="ABM10275.1"
FT                   /translation="MWAPILTPNEVKRRITLNDTLLSDLGQFLVKRSADIAESAAQHLV
FT                   VVLVSLLIATVIGVGVGVLVWNKPISRSMAIAGAGVGLTIPSMALLALLIPVLGLGWTP
FT                   TVVGLAFYALLPIIRNTVVGLREVPPAVSESALGMGMGTVKTLFRVQLPMAWPVVLTGV
FT                   RVSAQLSMGIAAIAAYVGGPGLGEMIFKGLSSLGSKNALNFAVVGTVGVIVLALLLDGA
FT                   FVLIRRVTTSRGLRV"
FT   gene            663045..664061
FT                   /locus_tag="AAur_0645"
FT   CDS_pept        663045..664061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0645"
FT                   /product="putative glycine betaine/L-proline transport ATP
FT                   binding subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01186"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08689"
FT                   /db_xref="GOA:A1R2I8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I8"
FT                   /protein_id="ABM08689.1"
FT                   /translation="MSESTTPAAGARIVLKDVTKTYPGQVIPAVESFSMDIAPGELIMF
FT                   VGPSGCGKTTTMKMINRIIEPSSGSITIDGEDVLSLNPNELRRRIGYVIQQIGLFPHMT
FT                   IAENISVVPKLLGWDKKRTRDRVEELLAVVELDPKTFASRYPRQLSGGQQQRVGVARAL
FT                   AADPPVMLMDEPFGATDPITREKLQSEFLRLQEKLSKTIVFVTHDFDEAVRLGDRIAVL
FT                   SERSQIEQFDTPANILANPANDYVSQFVGHGAALKRLGLIPVGHAALGPAGGQTAMTIG
FT                   VDDSLRDALDALVLSGGLPVSVLDRNGSSVGTIDIERISAVLGAEILPPALAGGVRP"
FT   gene            664058..664843
FT                   /gene="opuCB"
FT                   /locus_tag="AAur_0646"
FT   CDS_pept        664058..664843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuCB"
FT                   /locus_tag="AAur_0646"
FT                   /product="Glycine betaine/carnitine/choline transport
FT                   system permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07068"
FT                   /db_xref="GOA:A1R2I9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2I9"
FT                   /protein_id="ABM07068.1"
FT                   /translation="MTAQATRDLATSFGTASNRKGKYFSFKRFGTPLIIVGALLALFLW
FT                   ISSLTLDSIELRTLNWDYLADRTREHLLLTVTASAIVSLIAIPAGIALSRVHSKAVHAV
FT                   VFGIANVGQATPAIGLVILLAIVWKTGFEVALVGLVAYSVLPVLRNTLVGLQQVDSSLT
FT                   EAAKGMGMRPLEVLARIELPLAVPVIIAGLRTALVFCVGVATVATFINAGGLGDMIVNG
FT                   LKLQRWPVLITGAVVVSCIALTIDWLAGLAEDLLKPKGI"
FT   gene            664872..665807
FT                   /locus_tag="AAur_0647"
FT   CDS_pept        664872..665807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0647"
FT                   /product="putative substrate binding domain of a
FT                   glycine/betaine ABC transport system"
FT                   /note="identified by match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09534"
FT                   /db_xref="GOA:A1R2J0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J0"
FT                   /protein_id="ABM09534.1"
FT                   /translation="MKKPAMTLLATGVAVALSLTACGGSASSTSSGAGSNELEGLTGVF
FT                   GAKDFSEQFILSHITSQVLNAHGADTTTNTSVVGSANVRTAFETGQFAGYWEYTGTSWI
FT                   TYNKQTTPIKDKTEMFKAVKDADAKKGIAWLDPAPLNNTYAFAVREDKAKELGIKSLSD
FT                   VAKLPASEQTFCVESEFSTRDDGWPGLRKEYGLSPDAKVSMLDTGVIYTATQKGQDCNF
FT                   GEVFETDGRIPALKLQVMEDDKNFFPIYQGALTVKADILAKYPAITDIMAKVSPKLTTE
FT                   VMQQLNAKADVDGEDPEDIAKEWLESEGLI"
FT   gene            665780..666319
FT                   /locus_tag="AAur_0648"
FT   CDS_pept        665780..666319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0648"
FT                   /product="putative formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09357"
FT                   /db_xref="GOA:A1R2J1"
FT                   /db_xref="InterPro:IPR014826"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR037075"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J1"
FT                   /protein_id="ABM09357.1"
FT                   /translation="MARIRRTDLKMTEQLQIGESFIGDGVNAAHVNTVLGHRSGPAGTA
FT                   WATALASPSAGHVPFVAVLRPSLPVKPLTLFVTKAAPSNDQHGNLIWGAAQAGIAAGVA
FT                   DAVADGILTDEQADSHALIAAVWVNPNADDDDAVYRNNRESVRTALENGVKNLPSTAEV
FT                   IEARNSPSNPFFTPRG"
FT   gene            666325..667428
FT                   /locus_tag="AAur_0649"
FT   CDS_pept        666325..667428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0649"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08867"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J2"
FT                   /protein_id="ABM08867.1"
FT                   /translation="MKITAIRLTRMVLPLDPPFNAAWDPEPRTSFPATLVEVETDEGIT
FT                   GVGSGDTMDGFEAYEHLFIGTDPMAILNQVRRIETINFHGGRYWPLEAALWDIIGKVAG
FT                   LPVATLFGGAQDRLVAYASSGELKAPAARAESALAAKERGFKAMKIRISRDHLDQGVES
FT                   VRAAREAVGKDFDLMVDLNQMWRMSGDIEPALELAKVHRLAAQLAELDVRWLEEPLPQA
FT                   DIKGAQRVREQTGIQVSGGEMVRSMPEMMALIEADAYDIYQPDVALAVGMYRARQVAET
FT                   ANLKHRFFTPHTWSNGLGLLANLHVAAGVDAGPYLEFPYDPPGWTPERRDFFMEPLDID
FT                   DDGALRVPDLPGLGAVIDYDAVKKYSV"
FT   gene            667439..668956
FT                   /locus_tag="AAur_0650"
FT   CDS_pept        667439..668956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0650"
FT                   /product="aldehyde dehydrogenase (NAD) family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08170"
FT                   /db_xref="GOA:A1R2J3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J3"
FT                   /protein_id="ABM08170.1"
FT                   /translation="MATTKNDWIERAAAQQPATGLYIDGGFRSARSGETFPTVSPRDGS
FT                   ITAHVAAAGDQDVDDAVRSAHRTFESGVWSRTDRRHRQTVLTRLSDLILENLEELALLE
FT                   STDAGHPISDALAVDVPSCARTFRWYAEALDKVYDDVAPTPRNALAVISREALGVIGAV
FT                   VPWNYPLIITAWKVAPALAAGNSVVLKPSEQTSLTALRLAELATEAGVPDGVFNVVPGL
FT                   GHVAGAALGRHDLVDKITFTGSPEVGRYFQRYASESNGKQVALELGGKSPQVVLHDVGD
FT                   IAACASAVAWGIFYNAGQTCHGGSRLLVDERVHDELIEEVIKVGRSLQLGDPLDPATQI
FT                   GAIIDDRQLESILGYYAVAEGEGIAVASGGTQVHPAGVEHGYYLEPTVLDRVNNAGRIG
FT                   QEEIFGPVLAVSTFRGAAEGIRMANDTKYGLAASVWTQDITKAHTAARELRAGTVWVNT
FT                   FDVADIITPFGGFKESGFGRDRSLHALDAYSALKTTWINLGDAALDD"
FT   gene            668972..669970
FT                   /gene="mmsB"
FT                   /locus_tag="AAur_0651"
FT   CDS_pept        668972..669970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="AAur_0651"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09531"
FT                   /db_xref="GOA:A1R2J4"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J4"
FT                   /protein_id="ABM09531.1"
FT                   /translation="MRLDMTATTHVSATETQLLTPGTARIGFIGLGNMGSGMTRNLQAA
FT                   GFHLVVNDVRKESAAELLANGAEWAEDAAAVAAGSDVVITMLPTPKHVETVAMGPGGIL
FT                   AGMPDGGTWVDMSTSVPEVANRVREAGSVRGIRVLDAPVSGMSVGAANGMLQIFVGGEP
FT                   ADVERLRPVFEAMGDPERILHVGGHGAGYAVKLMINQLWFSHLVATAEVLSTGVKAGVD
FT                   LEVLRQALIASPANSNFVQNDVLSILNHGDYDEGFAIALACKDLGLSVDLARSVGVPME
FT                   LSGLVEQLYRRAKALYGDKAGEMTPVKLYEDAIGIQLRTPVQASGSATEGA"
FT   gene            669976..671163
FT                   /locus_tag="AAur_0652"
FT   CDS_pept        669976..671163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0652"
FT                   /product="NAD(P)-dependent methanol dehydrogenase"
FT                   /EC_number="1.1.1.244"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09061"
FT                   /db_xref="GOA:A1R2J5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J5"
FT                   /protein_id="ABM09061.1"
FT                   /translation="MQTRMQIHAELASTELTLDPKPTAYFGRGRVVEIGGIVAALGAKS
FT                   ALIVTDPFLATTDVVAAVRESLEAAGLSVSVFDGVTPNPTTTCVDAGSDQAAASGVDVL
FT                   VPVGGGSSMDAAKGISLGAVNPARGAGLDYSNHFENPALPIVAVPTTAGTGAEVNAFGV
FT                   VTDVEAHRKFYVGHESALPKAAVLDPELTLGLPPKATAATGMDALTHAIESYSSIRQNP
FT                   YSDGIALQVVSMVAEFLPRAVADGSDIEARSQLLLASHIAGVGFSHTGLGLVHAIAHPL
FT                   GGRFNIPHGLALCLVIEDVLRLNLRNRLDRTARLAFALGVGDTAATVEQNADAAVEAVA
FT                   TLAREVGMTARLTDFGVTEADLDSLVEDTLADSVINNTPVPPTAVEIRTILEKAL"
FT   gene            671164..672663
FT                   /locus_tag="AAur_0653"
FT   CDS_pept        671164..672663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0653"
FT                   /product="putative succinate-semialdehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06626"
FT                   /db_xref="GOA:A1R2J6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J6"
FT                   /protein_id="ABM06626.1"
FT                   /translation="MENTLTFDTSALTGAERTFVESLPTQLYIDGQWTDASDGGTSVVE
FT                   DPSTGAVLTRIADATPADGHRALEAAARVQESWAATPPRERGEILRRAFELVTARAEDF
FT                   ALAMTLEMGKPLAESRGEVAYGAEFLRWFSEEAVRVSGRYSTAPDGKSRLLVTKRPVGP
FT                   CLFITPWNFPLAMATRKIAPAIAAGCTMVLKPANLTPLTALLFTRVLEEAGLPAGVLNV
FT                   IPTTRPGDVTGPLIRDSRLRKLSFTGSTGVGQQLIADSAHQVLRTSMELGGNAPFLVFE
FT                   DADLDAAIDGAMVAKLRNMGEACTAANRFIVHESLASEFSERLAERMSSLVLGRGSADG
FT                   TNIGPLIDAKSRAKVDELVTDAVDCGATVLTGGAPSDGEGYFYPPTVLTNVPASARILH
FT                   EEVFGPVAPVVSFSTEDEAIALANDTEYGLVAYAYTRDLNRGIRLSEKVDVGMFGLNTG
FT                   IVSNPAAPFGGVKQSGLGREGGTEGIEEFLETRYIGIADPS"
FT   gene            672663..673343
FT                   /locus_tag="AAur_0654"
FT   CDS_pept        672663..673343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0654"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08130"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J7"
FT                   /protein_id="ABM08130.1"
FT                   /translation="MLRLLVTGGTSGIGAALVRESLRAGHSVFATGRDPVKLAAFLETC
FT                   SGLGHVGGVVADAGDWEQTRDAVSAAHEFLGGIDVAVANAGFSAAGDLSDGDPDQWRHM
FT                   VLTNVYGPAILAKAALPQLLENRGHMVLIGSTAGRKVYPGNLYTATKWAVTGYAESLRQ
FT                   QLVGTGVRVLHIAPGHVDTPLWKEAPDALIPPESVAGTMLWALTQPPGVDVSEVMVRAT
FT                   GQAF"
FT   gene            673443..673673
FT                   /locus_tag="AAur_0655"
FT   CDS_pept        673443..673673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0655"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07658"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J8"
FT                   /protein_id="ABM07658.1"
FT                   /translation="MGRRMEGFVHVTERLQSVFGPATHGDTDGPVVHKHDDFETASEAD
FT                   LKNFDVETDSEGHHYAVRNNDPGPTSTDYSL"
FT   gene            673844..674227
FT                   /locus_tag="AAur_0656"
FT   CDS_pept        673844..674227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0656"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09039"
FT                   /db_xref="GOA:A1R2J9"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2J9"
FT                   /protein_id="ABM09039.1"
FT                   /translation="MSFQDDAASVPNSSARPDRGSSERRKPVTPTPSSGHDRPTRTAAL
FT                   WVAVAVGLVVLVMLIVFFVQNQDMITVRFFGLEGTLALGTTLFIAAVGGGVLVALAGGA
FT                   RILQLRMSNHRRKKAVGGPGVAP"
FT   gene            complement(674336..674635)
FT                   /locus_tag="AAur_0657"
FT   CDS_pept        complement(674336..674635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06721"
FT                   /db_xref="InterPro:IPR025242"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K0"
FT                   /protein_id="ABM06721.1"
FT                   /translation="MAADYDELRTDVKENQEQSLQALQSASAPTAKSVVLELDETDGLD
FT                   ANGPGGEIVAEELVIQVIPQANDEFTCHSCFLVRHRSQIAREKDGVAYCTDCEG"
FT   gene            complement(674791..677286)
FT                   /locus_tag="AAur_0658"
FT   CDS_pept        complement(674791..677286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0658"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="identified by match to protein family HMM PF00933;
FT                   match to protein family HMM PF01915"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06856"
FT                   /db_xref="GOA:A1R2K1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K1"
FT                   /protein_id="ABM06856.1"
FT                   /translation="MNPTLSAAVTAPSAGTQDAEAEIRDLAQSLTLEQQVQLLTGADVW
FT                   STHAIPEIGLSRVVMSDGPAGVRGEDFDERHDSVSLPSSSALSATWSVETARNYGQVLG
FT                   QEARRKGVHAVLGPTINLHRSPLGGRHFECMSEDPRLTATMAAGYVAGVQSMGVGATPK
FT                   HYLANEAETERFTADSVVDERPLRELYLAAFEDAITEARAWLVMSSYNSINGTTASENK
FT                   LLETPLSTEWGFDGVVVSDWTGVRSIDAANAHQDLEMPGPVGHWGPKLLAAVNEGRVSR
FT                   EAILEKVTRILRLAARVGSLEGFEPAVTHLPTELNGAAVAREVAVRGAVLVRNKGLLPL
FT                   DAKALGSVAVIGHNADEARTQGGGSATVMPKYTVSPLEGLRKALPEGVKVTYARGAKVA
FT                   EGIQAFPRTSLHNPVSNVPGIRVTFLAEDGTEISGEDRLASHLIWFGIGIPDGAASIRM
FT                   EADWTAETAGVHHLGVGTVGRIRFVLDGTEVFNSELEDDTEVLGAALFDPPKTVHAIDT
FT                   TAGQSIRIEAEYQLPKEQVIPFTAILLGEETVVAEPQAEIDAAVEAARASDVAVVVVGT
FT                   NAAIESEGFDRKDLDLPGYQNQLVKAVAAANPRTVVVVNSGSPVLMPWLDTVDAVLLGW
FT                   FGGQEFGSAVADILLGVEEPGGRLPTTWPSALDDVPVLNTTPTDGKVVYSEGIHIGYRA
FT                   WLKQQAEGGAAPALPFGFGLGYTTFEFGKAHAPQAVTAGKDLVVHVPVKNTGTRTGREV
FT                   VQVYVERTESAVERPVRWLAGYAGAHLAPAGTESVEIRIPAKAFAHYDGGWQFEQGTFR
FT                   LLVGRHAADDFQSLDIELR"
FT   gene            complement(677286..678542)
FT                   /locus_tag="AAur_0659"
FT   CDS_pept        complement(677286..678542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0659"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08940"
FT                   /db_xref="GOA:A1R2K2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K2"
FT                   /protein_id="ABM08940.1"
FT                   /translation="MAGAETVSPGLRSTPPKAASRAYVIGMPIASAGLWMAVLAPALVV
FT                   LAIKISEITTPDTRAGALSLVAGVGAAVALLANPFFGRLSDRTTSRFGMRKPWIVGGSL
FT                   VGLAALFLLGSATEVGVVLIAWVVAQLGFNAGLAALVATLPDQAGPMERGRLSGLIGMT
FT                   LPIGLVAAAFFAQMFETALQMAVVPGIVGTAIAIAFAFTFKDRVLTEKPAPLNFKEILG
FT                   SFYFNPKDYPGLGWAWVTKFLVYVGYCAGLLYLPYFFTDHLHVAETQVTSLVFQATLVS
FT                   SAGTVITSLAGGWISDRLGKRKSMVIISALIMMGGLVVIATSTNTGQVLVGQGILGLGL
FT                   GVFSAVDVALITDLLHSDQSENAKTFGVFNIAQALPQSLVPAIAFPVIALGGYPALFLG
FT                   GAVVGIIGALLVTRIKGVK"
FT   gene            678664..679305
FT                   /pseudo
FT                   /locus_tag="AAur_0660"
FT                   /note="putative transcriptional regulator, TetR family;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00440"
FT   gene            complement(679436..680782)
FT                   /gene="ask"
FT                   /gene_synonym="thrA"
FT                   /gene_synonym="metL"
FT                   /locus_tag="AAur_0661"
FT   CDS_pept        complement(679436..680782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ask"
FT                   /gene_synonym="thrA"
FT                   /gene_synonym="metL"
FT                   /locus_tag="AAur_0661"
FT                   /product="Asparate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00656; match to protein family HMM
FT                   TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09422"
FT                   /db_xref="GOA:A1R2K3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K3"
FT                   /protein_id="ABM09422.1"
FT                   /translation="MTMPTTEVKIEELSNEAAITKQLIVQKFGGSSVADADGIKRVAQR
FT                   VVDAQKAGNEVVVVVSAMGDTTDELLDLAGQVTDSAPAREMDMLLSAGERISMALLAMA
FT                   INKFGASAQSFTGSQAGMITDGIHGKARIIDVDPHRIRTALDKGHIAIVAGFQGMSRST
FT                   NEITTLGRGGSDTTAVALAAALEADVCEIYTDVDGIYTADPRVVTSAQKIDRISSEEML
FT                   ELAASGAKILHLRCVEYARRFGVPLHVRSSFSQHEGTWVIPGADEKFNIQEGVALEQPI
FT                   ISGVAHDRSEAKVTVVGVPDIPGKAAAIFQVIADAHSNIDMIVQNVSTHGTGRTDISFT
FT                   LPIVEGADALAALRAAEGQIGFESIEYNEHVGKLSLIGAGMRSHPGVSATFFKALSDAG
FT                   INIDMISTSEIRISVVTSADALDDAVRAIHNAFELDGDAEATVYGGTGR"
FT   gene            complement(680943..681662)
FT                   /locus_tag="AAur_0662"
FT   CDS_pept        complement(680943..681662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0662"
FT                   /product="putative domain of unknown function (DUF427)"
FT                   /note="identified by match to protein family HMM PF04248"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09660"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K4"
FT                   /protein_id="ABM09660.1"
FT                   /translation="MTSYSGSFHPGPEPPVWSGKPAIAAHKPHELDGTPGTPQPIRRGP
FT                   GSDAPAFTGRSQPSVPPWDMVSSRSVSGVFRRPRPIKPKKGQESVWDYPRPPRIEPRSE
FT                   RVVVRLGGQVIVDTTDAVRVLETSHPPVYYLPFDAFPSGVLVPHAGTSFCEFKGEASYF
FT                   DVVAGGVVVSRGGWTYANPARGFEPLSSRVALYPQHMDSCEINGEQVTFQQGGFYGGWI
FT                   TQQIVGPFKGGPATSGW"
FT   gene            681697..682686
FT                   /locus_tag="AAur_0664"
FT   CDS_pept        681697..682686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0664"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07865"
FT                   /db_xref="GOA:A1R2K5"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K5"
FT                   /protein_id="ABM07865.1"
FT                   /translation="MTDRKPGTGPPLASGNFSVTAGEAWRNTRESFTSWWFWLACALGI
FT                   ALAWGIAAALVAWAESSGGFEAGVANAVHLLMAAFLALSAAVLGAVWGFRHPNGSVPSL
FT                   LLAGAMRGVALAVPACAVLMVVGFNVGGPIALAGAAVVVIVLEVALFGLIGAGSRRCFA
FT                   KVMPAGVLAVVLMAFLCIGNVAVTVLLLPATTGTGQASVPVNVERDDSGRITAYECVGN
FT                   LRPVEVAHTDRVAWLATTNPALLLGSVGGELAPTDNPIGWMLSGLQWAADGPSREVPCL
FT                   SGESSDGLAPSMPVALTGLVLQAALAALAIMSGRWLADRRAAASSGPG"
FT   gene            complement(682667..683272)
FT                   /locus_tag="AAur_0663"
FT   CDS_pept        complement(682667..683272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0663"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /note="identified by match to protein family HMM PF01872"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08792"
FT                   /db_xref="GOA:A1R2K6"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K6"
FT                   /protein_id="ABM08792.1"
FT                   /translation="MRELVYYVAVSLDGYIAGPGGEFDAFPVEGDHMAAQNERFSDAIP
FT                   TVIADAMGIKRTGTMFDTVVMGWNTYAVGLPVGMTSPYQHLKQVVFSRTRTESDVPGEH
FT                   PNLKVTDEDPVEVVRRLKSEPGQSIWLCGGGQLATQLAGEIDRLVLKRSPVLFGDGIPL
FT                   FAPGTYQPSAFNEVSTTAFGSGVVISEYARRQLSQDPN"
FT   gene            complement(683309..683908)
FT                   /gene="recR"
FT                   /locus_tag="AAur_0665"
FT   CDS_pept        complement(683309..683908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="AAur_0665"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06941"
FT                   /db_xref="GOA:A1R2K7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1R2K7"
FT                   /protein_id="ABM06941.1"
FT                   /translation="MYEGAVQELIDELGRLPGVGPKSAQRLAFHILEADPEDMKRLVTA
FT                   ITTVKERVKFCTVCFNVTEQETCNICRDQRRDPSVICVVEESKDVLAVERTRSFRGRYH
FT                   VLGGAINPIAGIGPEQLRIRELLTRLNDGAIQEIIIATDPNLEGEATATYLARMLKSIG
FT                   ITVTRLASGLPVGGDLEYADEVTLGRAFEGRRNALL"
FT   gene            complement(683942..687028)
FT                   /gene="dnaX"
FT                   /locus_tag="AAur_0666"
FT   CDS_pept        complement(683942..687028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="AAur_0666"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08219"
FT                   /db_xref="GOA:A1R2K8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K8"
FT                   /protein_id="ABM08219.1"
FT                   /translation="MTALRKNRVNHAYLFSGPRGCGKTTSARILARCLNCAEGPTDTPC
FT                   GKCPSCIELARGGSGSLDVIEIDAASHGGVDDARDLRERATFAPVRDRYKIFIIDEAHM
FT                   VTSAGFNALLKIVEEPPEHIKFIFATTEPDKVIGTIRSRTHHYPFRLVPPEPLMQYLEL
FT                   LCQQENVPVAPGVLSLVIRAGGGSVRDTLSVLDQLMAGAGPNGLDYELAVALLGYTHAS
FT                   LLDDIVDAVAAADAATVFRAVDRVIQTGHDPRRFVEDLLERFRDLIIVQAMPESAQAIL
FT                   RGMPADQIARMRNQATNLGAAELSRAADVTNTALTEMTGATSPRLHLELLCARILLPSA
FT                   EQTERGIAARIDRVERRLNYTGDGGAPAVAAAPPAAAATTPTASPVAPTTPAAAPAPAP
FT                   AAAVVASADAQPTPASAPAVSEPSAEAGSRDAITAPRVSTNDWPVEDRPAAGRSPQAAA
FT                   SHAASSQPQPGSASPQQTQPVQAPTPPPSQEAAPQVQPTAPVQAAQQPPAPTPQPAAAA
FT                   SVSGGSGDVEALRRAWPDVLQTLTKIKRSTWALVEPNAQVAQFDGQVLTLAFTTGGLAG
FT                   AFGRADHSENLRQAIHKTIGIDCQIVAVAGGNSSASSEPNPKAPTSRETPAAASSAGTP
FT                   ANPTSPPVESAPAPAPVSAVDSAWGLAPAAAASPAPAAVPAPEVPAAPTPAAPAPAPAA
FT                   ASPAAPAPAAPAPATSAPAEPSTDYSYPDDDWGPPLDEDAPPLDEEPPADWEPPSGYGR
FT                   TGSQPATPAPAQSPASGSPSSSPSPTAPRASAAPAQAVPSATASTAANPAGINGSDDPW
FT                   SRAVEQAPGTWVVGTESNVGKRPLDSPEESAPATDAPDYEPAAAQVPETPSGTYGHPTN
FT                   AEQNPSSSWDVAPASSWPGTQSMPDPAGSSDTAGSVPVTSGAPAASNAPATWPSLATQP
FT                   EESHGSVATLEEGAPSSSPNGRQSLYQRLTNSPEAQAGRVQAPVRTQAKPESVPEDIPS
FT                   PEDETIEESRVFGRAAVERILGGKLIEERALDGSPLQPR"
FT   gene            complement(687451..687774)
FT                   /locus_tag="AAur_0667"
FT   CDS_pept        complement(687451..687774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABM08666"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2K9"
FT                   /protein_id="ABM08666.1"
FT                   /translation="MAQLHALVVYVPETHIEEVLLAIGDAGAGRIGDYSHCAFTSPGTG
FT                   RFTPLPGAHPFVGEVGIEEQVLETRVECVVQEDMLDGVVRALRAAHPYEEPAFMTWPVN
FT                   GWR"
FT   gene            688080..688167
FT                   /locus_tag="AAur_0668"
FT   tRNA            688080..688167
FT                   /locus_tag="AAur_0668"
FT                   /product="tRNA-Ser"
FT   gene            688326..689399
FT                   /locus_tag="AAur_0670"
FT   CDS_pept        688326..689399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0670"
FT                   /product="putative acyltransferase"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABM06737"
FT                   /db_xref="GOA:A1R2L0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2L0"
FT                   /protein_id="ABM06737.1"
FT                   /translation="MDLLATRGDPVSDFSVGRVRGRHLAVPPIRHSAAPSNRHSEAPSS
FT                   RARAADLDAIRLTGIAAVVVGHVWTSGPFTDALFAWHVPVFFILTGYLWKSGRTVRDEI
FT                   SRRSKTLLVPYVAWLAVLSVAFASVEYLRGGSLPVEALRNAVYGGAFAVRPYSAFWFVP
FT                   VLFFTAVLFRWLERFPPWMAWIIAGLGLAASVFAGEVMAKTPLGIALAVPCLVFVLVGR
FT                   ALPAMVHRVRYKTAVGVGLVLAGVALTVGGVVQPLNMKDGDFGTVALSVVNASAISLGL
FT                   ILVFAALYRMVSPAVNRLTIQLASAGLVVVLTHAFFLYLLNTPASGSIFDAVVALAVPF
FT                   ALALLVLRSPLRRWLVG"
FT   gene            complement(689396..690322)
FT                   /locus_tag="AAur_0669"
FT   CDS_pept        complement(689396..690322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0669"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABM07205"
FT                   /db_xref="GOA:A1R2L1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2L1"
FT                   /protein_id="ABM07205.1"
FT                   /translation="MLDVRRLRLLHELKIRGTLAEVADAMQYSPSSVSQQLTLLEKEAG
FT                   VELLRKAGRRVQLTPQAEILVAHTAALLETLERAETELAASLSMVTGTVRLAVFQSAAL
FT                   ALLPDFLSIMRKEYPEVRVEMTQREPETALYETWARDFDLVVAEQYPGHAAPHHSGLDR
FT                   VTLTSDAIRLATPPVGLGGETVATLADTASMPWVMEPRGAASRHWAEQACRSAGFEPDV
FT                   RYETADLQAQIRLIESGNAVALMPDLVWTGRTRTVQLLDLPGLPERTVFTSTRTAGRIH
FT                   PAILACREVLERVAAAQQKDTEQRADG"
FT   gene            690446..693919
FT                   /locus_tag="AAur_0671"
FT   CDS_pept        690446..693919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0671"
FT                   /product="putative proline dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM PF01619"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM09972"
FT                   /db_xref="GOA:A1R2L2"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1R2L2"
FT                   /protein_id="ABM09972.1"
FT                   /translation="MTSTLPDATAPRTQDSGQFDALAQEAIALVRRWLTEASKIPVDVS
FT                   AQRLAGVLKDPNGLDFTVGFVDGVIRPEDLSVAGRKLAELAPKVPKFLPWYMRSAVRVG
FT                   GVMAPIVPQVVIPIARRVLREMVGHLIVDATDAKLGPAIAKIRQDGVHLNVNLLGEAVL
FT                   GEHEAQRRLEGTLKLLARDDVDYVSIKESSTVAPHSPWAFDEAVDHVVEKLTPLYRLAA
FT                   SFPKPKFINLDMEEYKDLSMTIAVFKRILDMPEFKNLEAGIVLQAYLPDALGAMQELQE
FT                   WASARRAQGGAPIKVRVVKGANLPMEQVEASLHDWPLATWGTKQDSDTSYKNVINYALT
FT                   PERIDAVRIGVAGHNLFDVAFAWLLAKQRGIAQQGQGSIEFEMLLGMATGQATAVRKDV
FT                   GSLLLYTPVVHPGEFDVAIAYLIRRLEEGASQENFMSAVFELSENEALFKREQQRFLDS
FT                   LAGMTDTVPGPNRQQDRRLPAEPAPVEGFANTPDTDPALPANRAWGRDILKRIPGSTAG
FT                   NKIVESTKVSDAAQLDRIIATAVDHGKAWGARPAAERAAILHRAGEVLEARRAELLEVM
FT                   ASETGKTIDQGDPEVSEAIDFAHYYAERAKDLETVDGATFVPANLTVVTPPWNFPVAIP
FT                   AGSTLAALASGSAVVIKPAKQARRSGSVMVDALWEAGVPREVLALVQLEERELGTQLVS
FT                   HPSVDRVILTGGYETAELFRSFRQDLPLLAETSGKNAIIVTPSADLDLAAKDVVYSAFG
FT                   HAGQKCSAASLVILVGSVAKSARFHNQLIDAARSLTVGYPENATTQMGPIIEPANGKLL
FT                   NALTTLGDGETWAIKPERLDETGRLWSPGIRSGVKRGSYFHLTEFFGPVLGVMTAETLE
FT                   EAIAIQNEIEYGLTAGLHSLDSAEMGVWLDTIQAGNLYVNRGITGAIVQRQPFGGWKKS
FT                   AVGAGTKAGGPNYLIGLGSWLPAEAKAKRGTVLQGAAAQILTAAKSADVTAEELQTLQQ
FT                   SLFSDAAAWESEFGTRKDVSALSAERNVFRYRSLPVTVRLSEGERLAELLRVVAAGAVA
FT                   GSALKVSSAVVLPDAVVTVFANLGVSVRIEDDAAWLARAAKFDAGRIRLIGGDFAALSA
FT                   AMGGRPDVAVYHGAVTQAGRIEMLPFLREQAVSITAHRFGTPNHLSDHLI"
FT   gene            complement(694086..695006)
FT                   /locus_tag="AAur_0672"
FT   CDS_pept        complement(694086..695006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AAur_0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AAur_0672"
FT                   /db_xref="E