(data stored in ACNUC10043 zone)

EMBL: CP000477

ID   CP000477; SV 1; circular; genomic DNA; STD; PRO; 1879471 BP.
XX
AC   CP000477; AAOR01000000-AAOR01000012;
XX
PR   Project:PRJNA15765;
XX
DT   26-OCT-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Methanosaeta thermophila PT, complete genome.
XX
KW   .
XX
OS   Methanothrix thermoacetophila PT
OC   Archaea; Euryarchaeota; Stenosarchaea group; Methanomicrobia;
OC   Methanosarcinales; Methanotrichaceae; Methanothrix.
XX
RN   [1]
RP   1-1879471
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Smith K.S., Ingram-Smith C., Richardson P.;
RT   "Complete sequence of Methanosaeta thermophila PT";
RL   Unpublished.
XX
RN   [2]
RP   1-1879471
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Smith K.S., Ingram-Smith C., Richardson P.;
RT   ;
RL   Submitted (20-OCT-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ac090864e827f0006e31bc2e1d5fec5c.
DR   BioSample; SAMN02598350.
DR   EnsemblGenomes-Gn; EBG00001132271.
DR   EnsemblGenomes-Gn; EBG00001132272.
DR   EnsemblGenomes-Gn; EBG00001132273.
DR   EnsemblGenomes-Gn; EBG00001132274.
DR   EnsemblGenomes-Gn; EBG00001132275.
DR   EnsemblGenomes-Gn; EBG00001132276.
DR   EnsemblGenomes-Gn; EBG00001132277.
DR   EnsemblGenomes-Gn; EBG00001132279.
DR   EnsemblGenomes-Gn; EBG00001132280.
DR   EnsemblGenomes-Gn; EBG00001132281.
DR   EnsemblGenomes-Gn; EBG00001132282.
DR   EnsemblGenomes-Gn; EBG00001132283.
DR   EnsemblGenomes-Gn; EBG00001132284.
DR   EnsemblGenomes-Gn; EBG00001132285.
DR   EnsemblGenomes-Gn; EBG00001132286.
DR   EnsemblGenomes-Gn; EBG00001132287.
DR   EnsemblGenomes-Gn; EBG00001132288.
DR   EnsemblGenomes-Gn; EBG00001132289.
DR   EnsemblGenomes-Gn; EBG00001132290.
DR   EnsemblGenomes-Gn; EBG00001132291.
DR   EnsemblGenomes-Gn; EBG00001132292.
DR   EnsemblGenomes-Gn; EBG00001132293.
DR   EnsemblGenomes-Gn; EBG00001132294.
DR   EnsemblGenomes-Gn; EBG00001132295.
DR   EnsemblGenomes-Gn; EBG00001132296.
DR   EnsemblGenomes-Gn; EBG00001132297.
DR   EnsemblGenomes-Gn; EBG00001132298.
DR   EnsemblGenomes-Gn; EBG00001132299.
DR   EnsemblGenomes-Gn; EBG00001132300.
DR   EnsemblGenomes-Gn; EBG00001132301.
DR   EnsemblGenomes-Gn; EBG00001132302.
DR   EnsemblGenomes-Gn; EBG00001132303.
DR   EnsemblGenomes-Gn; EBG00001132304.
DR   EnsemblGenomes-Gn; EBG00001132305.
DR   EnsemblGenomes-Gn; EBG00001132306.
DR   EnsemblGenomes-Gn; EBG00001132307.
DR   EnsemblGenomes-Gn; EBG00001132308.
DR   EnsemblGenomes-Gn; EBG00001132309.
DR   EnsemblGenomes-Gn; EBG00001132310.
DR   EnsemblGenomes-Gn; EBG00001132311.
DR   EnsemblGenomes-Gn; EBG00001132312.
DR   EnsemblGenomes-Gn; EBG00001132313.
DR   EnsemblGenomes-Gn; EBG00001132314.
DR   EnsemblGenomes-Gn; EBG00001132315.
DR   EnsemblGenomes-Gn; EBG00001132316.
DR   EnsemblGenomes-Gn; EBG00001132317.
DR   EnsemblGenomes-Gn; EBG00001132318.
DR   EnsemblGenomes-Gn; EBG00001132319.
DR   EnsemblGenomes-Gn; EBG00001132320.
DR   EnsemblGenomes-Gn; EBG00001132321.
DR   EnsemblGenomes-Gn; EBG00001132322.
DR   EnsemblGenomes-Gn; EBG00001132323.
DR   EnsemblGenomes-Gn; EBG00001132324.
DR   EnsemblGenomes-Gn; EBG00001132325.
DR   EnsemblGenomes-Gn; EBG00001132326.
DR   EnsemblGenomes-Gn; EBG00001132327.
DR   EnsemblGenomes-Gn; EBG00001132328.
DR   EnsemblGenomes-Gn; EBG00001132329.
DR   EnsemblGenomes-Gn; EBG00001132330.
DR   EnsemblGenomes-Gn; EBG00001132331.
DR   EnsemblGenomes-Gn; EBG00001132332.
DR   EnsemblGenomes-Gn; EBG00001132333.
DR   EnsemblGenomes-Gn; EBG00001132334.
DR   EnsemblGenomes-Gn; EBG00001132336.
DR   EnsemblGenomes-Gn; EBG00001132337.
DR   EnsemblGenomes-Gn; EBG00001132338.
DR   EnsemblGenomes-Gn; EBG00001132339.
DR   EnsemblGenomes-Gn; EBG00001132340.
DR   EnsemblGenomes-Gn; EBG00001132341.
DR   EnsemblGenomes-Gn; EBG00001132342.
DR   EnsemblGenomes-Gn; EBG00001132343.
DR   EnsemblGenomes-Gn; EBG00001132344.
DR   EnsemblGenomes-Gn; EBG00001132345.
DR   EnsemblGenomes-Gn; EBG00001132346.
DR   EnsemblGenomes-Gn; EBG00001132347.
DR   EnsemblGenomes-Gn; EBG00001132348.
DR   EnsemblGenomes-Gn; EBG00001132349.
DR   EnsemblGenomes-Gn; EBG00001132350.
DR   EnsemblGenomes-Gn; EBG00001132351.
DR   EnsemblGenomes-Gn; EBG00001132352.
DR   EnsemblGenomes-Gn; EBG00001132353.
DR   EnsemblGenomes-Gn; EBG00001132354.
DR   EnsemblGenomes-Gn; EBG00001132355.
DR   EnsemblGenomes-Gn; EBG00001132356.
DR   EnsemblGenomes-Gn; EBG00001132357.
DR   EnsemblGenomes-Gn; EBG00001132358.
DR   EnsemblGenomes-Gn; EBG00001132359.
DR   EnsemblGenomes-Gn; EBG00001132360.
DR   EnsemblGenomes-Gn; EBG00001132361.
DR   EnsemblGenomes-Gn; EBG00001132362.
DR   EnsemblGenomes-Gn; EBG00001132363.
DR   EnsemblGenomes-Gn; EBG00001132364.
DR   EnsemblGenomes-Gn; EBG00001132365.
DR   EnsemblGenomes-Gn; EBG00001132366.
DR   EnsemblGenomes-Gn; EBG00001132367.
DR   EnsemblGenomes-Gn; EBG00001132368.
DR   EnsemblGenomes-Gn; EBG00001132369.
DR   EnsemblGenomes-Gn; EBG00001132370.
DR   EnsemblGenomes-Gn; EBG00001132371.
DR   EnsemblGenomes-Gn; EBG00001132372.
DR   EnsemblGenomes-Gn; EBG00001132373.
DR   EnsemblGenomes-Gn; EBG00001132374.
DR   EnsemblGenomes-Gn; EBG00001132375.
DR   EnsemblGenomes-Gn; EBG00001132376.
DR   EnsemblGenomes-Gn; EBG00001132377.
DR   EnsemblGenomes-Gn; EBG00001132378.
DR   EnsemblGenomes-Gn; EBG00001132379.
DR   EnsemblGenomes-Gn; EBG00001132380.
DR   EnsemblGenomes-Gn; EBG00001132381.
DR   EnsemblGenomes-Gn; EBG00001132382.
DR   EnsemblGenomes-Gn; EBG00001132383.
DR   EnsemblGenomes-Gn; EBG00001132384.
DR   EnsemblGenomes-Gn; EBG00001132385.
DR   EnsemblGenomes-Gn; EBG00001132386.
DR   EnsemblGenomes-Gn; EBG00001132387.
DR   EnsemblGenomes-Gn; EBG00001132388.
DR   EnsemblGenomes-Gn; EBG00001132389.
DR   EnsemblGenomes-Gn; EBG00001132390.
DR   EnsemblGenomes-Gn; EBG00001132391.
DR   EnsemblGenomes-Gn; EBG00001132392.
DR   EnsemblGenomes-Gn; EBG00001132393.
DR   EnsemblGenomes-Gn; EBG00001132394.
DR   EnsemblGenomes-Gn; Mthe_R0001.
DR   EnsemblGenomes-Gn; Mthe_R0002.
DR   EnsemblGenomes-Gn; Mthe_R0003.
DR   EnsemblGenomes-Gn; Mthe_R0004.
DR   EnsemblGenomes-Gn; Mthe_R0005.
DR   EnsemblGenomes-Gn; Mthe_R0006.
DR   EnsemblGenomes-Gn; Mthe_R0007.
DR   EnsemblGenomes-Gn; Mthe_R0008.
DR   EnsemblGenomes-Gn; Mthe_R0009.
DR   EnsemblGenomes-Gn; Mthe_R0010.
DR   EnsemblGenomes-Gn; Mthe_R0011.
DR   EnsemblGenomes-Gn; Mthe_R0012.
DR   EnsemblGenomes-Gn; Mthe_R0013.
DR   EnsemblGenomes-Gn; Mthe_R0014.
DR   EnsemblGenomes-Gn; Mthe_R0015.
DR   EnsemblGenomes-Gn; Mthe_R0016.
DR   EnsemblGenomes-Gn; Mthe_R0017.
DR   EnsemblGenomes-Gn; Mthe_R0018.
DR   EnsemblGenomes-Gn; Mthe_R0019.
DR   EnsemblGenomes-Gn; Mthe_R0020.
DR   EnsemblGenomes-Gn; Mthe_R0021.
DR   EnsemblGenomes-Gn; Mthe_R0022.
DR   EnsemblGenomes-Gn; Mthe_R0023.
DR   EnsemblGenomes-Gn; Mthe_R0024.
DR   EnsemblGenomes-Gn; Mthe_R0025.
DR   EnsemblGenomes-Gn; Mthe_R0026.
DR   EnsemblGenomes-Gn; Mthe_R0027.
DR   EnsemblGenomes-Gn; Mthe_R0028.
DR   EnsemblGenomes-Gn; Mthe_R0029.
DR   EnsemblGenomes-Gn; Mthe_R0030.
DR   EnsemblGenomes-Gn; Mthe_R0031.
DR   EnsemblGenomes-Gn; Mthe_R0032.
DR   EnsemblGenomes-Gn; Mthe_R0033.
DR   EnsemblGenomes-Gn; Mthe_R0034.
DR   EnsemblGenomes-Gn; Mthe_R0035.
DR   EnsemblGenomes-Gn; Mthe_R0036.
DR   EnsemblGenomes-Gn; Mthe_R0037.
DR   EnsemblGenomes-Gn; Mthe_R0038.
DR   EnsemblGenomes-Gn; Mthe_R0039.
DR   EnsemblGenomes-Gn; Mthe_R0040.
DR   EnsemblGenomes-Gn; Mthe_R0041.
DR   EnsemblGenomes-Gn; Mthe_R0042.
DR   EnsemblGenomes-Gn; Mthe_R0043.
DR   EnsemblGenomes-Gn; Mthe_R0045.
DR   EnsemblGenomes-Gn; Mthe_R0046.
DR   EnsemblGenomes-Gn; Mthe_R0047.
DR   EnsemblGenomes-Gn; Mthe_R0048.
DR   EnsemblGenomes-Gn; Mthe_R0049.
DR   EnsemblGenomes-Gn; Mthe_R0050.
DR   EnsemblGenomes-Gn; Mthe_R0051.
DR   EnsemblGenomes-Gn; Mthe_R0052.
DR   EnsemblGenomes-Tr; EBT00001723640.
DR   EnsemblGenomes-Tr; EBT00001723641.
DR   EnsemblGenomes-Tr; EBT00001723642.
DR   EnsemblGenomes-Tr; EBT00001723643.
DR   EnsemblGenomes-Tr; EBT00001723644.
DR   EnsemblGenomes-Tr; EBT00001723645.
DR   EnsemblGenomes-Tr; EBT00001723646.
DR   EnsemblGenomes-Tr; EBT00001723647.
DR   EnsemblGenomes-Tr; EBT00001723648.
DR   EnsemblGenomes-Tr; EBT00001723649.
DR   EnsemblGenomes-Tr; EBT00001723650.
DR   EnsemblGenomes-Tr; EBT00001723651.
DR   EnsemblGenomes-Tr; EBT00001723652.
DR   EnsemblGenomes-Tr; EBT00001723653.
DR   EnsemblGenomes-Tr; EBT00001723654.
DR   EnsemblGenomes-Tr; EBT00001723655.
DR   EnsemblGenomes-Tr; EBT00001723656.
DR   EnsemblGenomes-Tr; EBT00001723657.
DR   EnsemblGenomes-Tr; EBT00001723658.
DR   EnsemblGenomes-Tr; EBT00001723659.
DR   EnsemblGenomes-Tr; EBT00001723660.
DR   EnsemblGenomes-Tr; EBT00001723661.
DR   EnsemblGenomes-Tr; EBT00001723662.
DR   EnsemblGenomes-Tr; EBT00001723663.
DR   EnsemblGenomes-Tr; EBT00001723664.
DR   EnsemblGenomes-Tr; EBT00001723665.
DR   EnsemblGenomes-Tr; EBT00001723666.
DR   EnsemblGenomes-Tr; EBT00001723667.
DR   EnsemblGenomes-Tr; EBT00001723668.
DR   EnsemblGenomes-Tr; EBT00001723669.
DR   EnsemblGenomes-Tr; EBT00001723670.
DR   EnsemblGenomes-Tr; EBT00001723671.
DR   EnsemblGenomes-Tr; EBT00001723672.
DR   EnsemblGenomes-Tr; EBT00001723673.
DR   EnsemblGenomes-Tr; EBT00001723674.
DR   EnsemblGenomes-Tr; EBT00001723675.
DR   EnsemblGenomes-Tr; EBT00001723676.
DR   EnsemblGenomes-Tr; EBT00001723677.
DR   EnsemblGenomes-Tr; EBT00001723678.
DR   EnsemblGenomes-Tr; EBT00001723679.
DR   EnsemblGenomes-Tr; EBT00001723680.
DR   EnsemblGenomes-Tr; EBT00001723681.
DR   EnsemblGenomes-Tr; EBT00001723682.
DR   EnsemblGenomes-Tr; EBT00001723683.
DR   EnsemblGenomes-Tr; EBT00001723684.
DR   EnsemblGenomes-Tr; EBT00001723685.
DR   EnsemblGenomes-Tr; EBT00001723686.
DR   EnsemblGenomes-Tr; EBT00001723687.
DR   EnsemblGenomes-Tr; EBT00001723688.
DR   EnsemblGenomes-Tr; EBT00001723689.
DR   EnsemblGenomes-Tr; EBT00001723690.
DR   EnsemblGenomes-Tr; EBT00001723691.
DR   EnsemblGenomes-Tr; EBT00001723692.
DR   EnsemblGenomes-Tr; EBT00001723693.
DR   EnsemblGenomes-Tr; EBT00001723694.
DR   EnsemblGenomes-Tr; EBT00001723695.
DR   EnsemblGenomes-Tr; EBT00001723696.
DR   EnsemblGenomes-Tr; EBT00001723697.
DR   EnsemblGenomes-Tr; EBT00001723698.
DR   EnsemblGenomes-Tr; EBT00001723699.
DR   EnsemblGenomes-Tr; EBT00001723700.
DR   EnsemblGenomes-Tr; EBT00001723701.
DR   EnsemblGenomes-Tr; EBT00001723702.
DR   EnsemblGenomes-Tr; EBT00001723703.
DR   EnsemblGenomes-Tr; EBT00001723704.
DR   EnsemblGenomes-Tr; EBT00001723705.
DR   EnsemblGenomes-Tr; EBT00001723706.
DR   EnsemblGenomes-Tr; EBT00001723707.
DR   EnsemblGenomes-Tr; EBT00001723708.
DR   EnsemblGenomes-Tr; EBT00001723709.
DR   EnsemblGenomes-Tr; EBT00001723710.
DR   EnsemblGenomes-Tr; EBT00001723711.
DR   EnsemblGenomes-Tr; EBT00001723712.
DR   EnsemblGenomes-Tr; EBT00001723714.
DR   EnsemblGenomes-Tr; EBT00001723715.
DR   EnsemblGenomes-Tr; EBT00001723716.
DR   EnsemblGenomes-Tr; EBT00001723717.
DR   EnsemblGenomes-Tr; EBT00001723718.
DR   EnsemblGenomes-Tr; EBT00001723719.
DR   EnsemblGenomes-Tr; EBT00001723720.
DR   EnsemblGenomes-Tr; EBT00001723721.
DR   EnsemblGenomes-Tr; EBT00001723722.
DR   EnsemblGenomes-Tr; EBT00001723723.
DR   EnsemblGenomes-Tr; EBT00001723724.
DR   EnsemblGenomes-Tr; EBT00001723725.
DR   EnsemblGenomes-Tr; EBT00001723726.
DR   EnsemblGenomes-Tr; EBT00001723728.
DR   EnsemblGenomes-Tr; EBT00001723729.
DR   EnsemblGenomes-Tr; EBT00001723730.
DR   EnsemblGenomes-Tr; EBT00001723731.
DR   EnsemblGenomes-Tr; EBT00001723732.
DR   EnsemblGenomes-Tr; EBT00001723733.
DR   EnsemblGenomes-Tr; EBT00001723734.
DR   EnsemblGenomes-Tr; EBT00001723735.
DR   EnsemblGenomes-Tr; EBT00001723736.
DR   EnsemblGenomes-Tr; EBT00001723737.
DR   EnsemblGenomes-Tr; EBT00001723738.
DR   EnsemblGenomes-Tr; EBT00001723739.
DR   EnsemblGenomes-Tr; EBT00001723740.
DR   EnsemblGenomes-Tr; EBT00001723741.
DR   EnsemblGenomes-Tr; EBT00001723742.
DR   EnsemblGenomes-Tr; EBT00001723743.
DR   EnsemblGenomes-Tr; EBT00001723744.
DR   EnsemblGenomes-Tr; EBT00001723745.
DR   EnsemblGenomes-Tr; EBT00001723746.
DR   EnsemblGenomes-Tr; EBT00001723747.
DR   EnsemblGenomes-Tr; EBT00001723748.
DR   EnsemblGenomes-Tr; EBT00001723749.
DR   EnsemblGenomes-Tr; EBT00001723750.
DR   EnsemblGenomes-Tr; EBT00001723751.
DR   EnsemblGenomes-Tr; EBT00001723752.
DR   EnsemblGenomes-Tr; EBT00001723753.
DR   EnsemblGenomes-Tr; EBT00001723754.
DR   EnsemblGenomes-Tr; EBT00001723755.
DR   EnsemblGenomes-Tr; EBT00001723756.
DR   EnsemblGenomes-Tr; EBT00001723757.
DR   EnsemblGenomes-Tr; EBT00001723758.
DR   EnsemblGenomes-Tr; EBT00001723759.
DR   EnsemblGenomes-Tr; EBT00001723760.
DR   EnsemblGenomes-Tr; EBT00001723761.
DR   EnsemblGenomes-Tr; EBT00001723762.
DR   EnsemblGenomes-Tr; EBT00001723763.
DR   EnsemblGenomes-Tr; Mthe_R0001-1.
DR   EnsemblGenomes-Tr; Mthe_R0002-1.
DR   EnsemblGenomes-Tr; Mthe_R0003-1.
DR   EnsemblGenomes-Tr; Mthe_R0004-1.
DR   EnsemblGenomes-Tr; Mthe_R0005-1.
DR   EnsemblGenomes-Tr; Mthe_R0006-1.
DR   EnsemblGenomes-Tr; Mthe_R0007-1.
DR   EnsemblGenomes-Tr; Mthe_R0008-1.
DR   EnsemblGenomes-Tr; Mthe_R0009-1.
DR   EnsemblGenomes-Tr; Mthe_R0010-1.
DR   EnsemblGenomes-Tr; Mthe_R0011-1.
DR   EnsemblGenomes-Tr; Mthe_R0012-1.
DR   EnsemblGenomes-Tr; Mthe_R0013-1.
DR   EnsemblGenomes-Tr; Mthe_R0014-1.
DR   EnsemblGenomes-Tr; Mthe_R0015-1.
DR   EnsemblGenomes-Tr; Mthe_R0016-1.
DR   EnsemblGenomes-Tr; Mthe_R0017-1.
DR   EnsemblGenomes-Tr; Mthe_R0018-1.
DR   EnsemblGenomes-Tr; Mthe_R0019-1.
DR   EnsemblGenomes-Tr; Mthe_R0020-1.
DR   EnsemblGenomes-Tr; Mthe_R0021-1.
DR   EnsemblGenomes-Tr; Mthe_R0022-1.
DR   EnsemblGenomes-Tr; Mthe_R0023-1.
DR   EnsemblGenomes-Tr; Mthe_R0024-1.
DR   EnsemblGenomes-Tr; Mthe_R0025-1.
DR   EnsemblGenomes-Tr; Mthe_R0026-1.
DR   EnsemblGenomes-Tr; Mthe_R0027-1.
DR   EnsemblGenomes-Tr; Mthe_R0028-1.
DR   EnsemblGenomes-Tr; Mthe_R0029-1.
DR   EnsemblGenomes-Tr; Mthe_R0030-1.
DR   EnsemblGenomes-Tr; Mthe_R0031-1.
DR   EnsemblGenomes-Tr; Mthe_R0032-1.
DR   EnsemblGenomes-Tr; Mthe_R0033-1.
DR   EnsemblGenomes-Tr; Mthe_R0034-1.
DR   EnsemblGenomes-Tr; Mthe_R0035-1.
DR   EnsemblGenomes-Tr; Mthe_R0036-1.
DR   EnsemblGenomes-Tr; Mthe_R0037-1.
DR   EnsemblGenomes-Tr; Mthe_R0038-1.
DR   EnsemblGenomes-Tr; Mthe_R0039-1.
DR   EnsemblGenomes-Tr; Mthe_R0040-1.
DR   EnsemblGenomes-Tr; Mthe_R0041-1.
DR   EnsemblGenomes-Tr; Mthe_R0042-1.
DR   EnsemblGenomes-Tr; Mthe_R0043-1.
DR   EnsemblGenomes-Tr; Mthe_R0045-1.
DR   EnsemblGenomes-Tr; Mthe_R0046-1.
DR   EnsemblGenomes-Tr; Mthe_R0047-1.
DR   EnsemblGenomes-Tr; Mthe_R0048-1.
DR   EnsemblGenomes-Tr; Mthe_R0049-1.
DR   EnsemblGenomes-Tr; Mthe_R0050-1.
DR   EnsemblGenomes-Tr; Mthe_R0051-1.
DR   EnsemblGenomes-Tr; Mthe_R0052-1.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC2576706; 18776026.
DR   EuropePMC; PMC3346471; 22344667.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01373; CRISPR-DR60.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000477.
DR   SILVA-SSU; CP000477.
DR   StrainInfo; 159807; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000271
CC   Source DNA and bacteria available from Kerry S. Smith
CC   (kssmith@clemson.edu)
CC   Bacteria also vailable from DSMZ: DSM 6194
CC   Contacts: Kerry S. Smith (kssmith@clemson.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1879471
FT                   /organism="Methanothrix thermoacetophila PT"
FT                   /strain="PT"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Methanosaeta thermophila"
FT                   /db_xref="taxon:349307"
FT                   /culture_collection="DSM:6194"
FT   gene            complement(100..1020)
FT                   /locus_tag="Mthe_0001"
FT   CDS_pept        complement(100..1020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0001"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: mbu:Mbur_1680
FT                   quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13804"
FT                   /db_xref="GOA:A0B530"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A0B530"
FT                   /protein_id="ABK13804.1"
FT                   /translation="MTYHQIRTIMFEKEILRLKSERNAIILAHNYQPGDVQDIADLTGD
FT                   SLELSRAAATIDCKVLVFCGVDFMAETAAILSPEKIVIHPDTSACCPMAQMISPHDVRS
FT                   LREKHPDAAVVCYVNSSADVKAESDICCTSANGVQVVNALDADEILFIPDRNLAAYVAR
FT                   HTDKRIIPWDGYCYVHDRYTASDVSEARKKHPDAELLVHPECRPEVIDMADGVYSTSGM
FT                   LKHARASGANEFIIGTEVGILHRLCAENPEKMFYPLSSGAVCEDMKKISLKKVLRALET
FT                   LSPRVEVPQTTAVRARRAIERMLAV"
FT   gene            1246..1319
FT                   /locus_tag="Mthe_R0001"
FT                   /note="tRNA-Val1"
FT   tRNA            1246..1319
FT                   /locus_tag="Mthe_R0001"
FT                   /product="tRNA-Val"
FT   gene            complement(1966..2574)
FT                   /locus_tag="Mthe_0002"
FT   CDS_pept        complement(1966..2574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13805"
FT                   /db_xref="GOA:A0B531"
FT                   /db_xref="UniProtKB/TrEMBL:A0B531"
FT                   /protein_id="ABK13805.1"
FT                   /translation="MLFALALSLLILTSGSRSIELNNATVIDLAEGKAVIEQPVSGKIF
FT                   NITAIARIENISVIHNSHTARCSVEESFWRGVYRYRITADSPVSGILRYEAPLRGQQFI
FT                   SPIVLNGTVVVAIPEGYTTGARALGIPRPEPYEIFHENRTVVVWRLERESIVEVGFYRN
FT                   DAPQILGYFFVLLLAAGIFLAAGYYSSIKKLEAMRRGLK"
FT   gene            complement(2618..3631)
FT                   /locus_tag="Mthe_0003"
FT   CDS_pept        complement(2618..3631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0003"
FT                   /product="RNA-3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="PFAM: RNA 3'-terminal phosphate cyclase; RNA
FT                   3'-terminal phosphate cyclase, insert region; KEGG:
FT                   mba:Mbar_A0961 RNA-3'-phosphate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13806"
FT                   /db_xref="GOA:A0B532"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B532"
FT                   /protein_id="ABK13806.1"
FT                   /translation="MNKPQMIEIDGSYGEGGGQIVRTSVALSTLTGIPVRIKNIRRNRP
FT                   RPGLAAQHVRAIEALAQISRAETRGVHLGSEEIEFIPGRISAGSYDVDIGTAGSVTLLI
FT                   QCLLPALTAAEGPVTVTVRGGTDVRWSPTVDYLEHVALPAMHLFGVTATFRCERRGYYP
FT                   RGGGVVVLSTRPSRLRPARLELIEEGICGISHCGSLPEHVARRQADAALELLKEKGYDA
FT                   RIDIQTMSSSSPGSGITLWSGFRGSSALGERGVRAEDVGREAAKALIDELKSKASVDVH
FT                   LADQLIPYIALAGGEYTTREISSHTRTNIWTAQRILRCRIDIDEGEVFRIHSTGSG"
FT   gene            complement(3628..3903)
FT                   /locus_tag="Mthe_0004"
FT   CDS_pept        complement(3628..3903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0004"
FT                   /product="DNA-directed RNA polymerase, subunit L"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase, dimerisation; KEGG:
FT                   mbu:Mbur_1439 RNA polymerase, dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13807"
FT                   /db_xref="GOA:A0B533"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR022905"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B533"
FT                   /protein_id="ABK13807.1"
FT                   /translation="MNLKVLKKTEDELRIEFEGERHTLLNLLRSELLEDERVVIATYDA
FT                   KFPIMDNPVFRLKTRGVDPLDVIRDASARIADLCDEFLREYEEAVR"
FT   gene            complement(3914..4471)
FT                   /locus_tag="Mthe_0005"
FT   CDS_pept        complement(3914..4471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0005"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="SMART: RNA binding S1 domain protein; KEGG:
FT                   mba:Mbar_A1636 putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13808"
FT                   /db_xref="GOA:A0B534"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR030850"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:A0B534"
FT                   /protein_id="ABK13808.1"
FT                   /translation="MDGALVLPGDRIGSAEEFVPGHDTYVFGGNIYASTTGVVDIDPES
FT                   RLVSVIPRSNALPRVENGDIVVGEVVDIKENLVILALAFKKGYESRPLPELDATIHISN
FT                   VKSSYVKDLKQMFGLRDIVRAKVIDARQMRLSTEPDDMGVIKAYCSSCTTPLVKKDSRL
FT                   ECPECKRTEMRKLSTYYGTGLV"
FT   gene            complement(4476..5105)
FT                   /locus_tag="Mthe_0006"
FT   CDS_pept        complement(4476..5105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0006"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: putative RNA methylase; methyltransferase
FT                   small; KEGG: mac:MA0719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13809"
FT                   /db_xref="GOA:A0B535"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0B535"
FT                   /protein_id="ABK13809.1"
FT                   /translation="MRKKQLEILLQHVRGFPSPSAAMEQYMTPPSLASDLLYIAYMRGE
FT                   LSQVIDLGCGTGILAIGAALLGAMAYGVDIDRQALRIARENAEMLGVHVDFILGDIERI
FT                   AFRRVKTVIMNPPFGAQRASRGDRAFLKKAVEIADVIYTIHNAGSLNFVRSFVSPCRVE
FT                   EVYKARIPIKRTFEFHRKDVEWIEVELYRIACKQWSDVRHNRGTQV"
FT   gene            complement(5227..6981)
FT                   /locus_tag="Mthe_0007"
FT   CDS_pept        complement(5227..6981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0007"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; ABC transporter related; Possible metal-binding
FT                   region in RNase L inhibitor, RLI; SMART: AAA ATPase; KEGG:
FT                   mbu:Mbur_1854 ABC transporter, fused ATPase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13810"
FT                   /db_xref="GOA:A0B536"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B536"
FT                   /protein_id="ABK13810.1"
FT                   /translation="MRIAVVNRDRCQPRKCARECEYFCPPVRTGDETIVFVDDKPVITE
FT                   NLCVGCGICVRKCPFGAITITNLPEEIGAPVHRYGSNGFALYGLPIPVEGKVTGILGPN
FT                   GIGKSTAVAILSGLLRPNLGKDATWDEVLERFAGSAIGDYLKKVAEKGVRTAYKPQYID
FT                   RIPKSYRGSVRELLKRTNERGELDALVDRLGLSHLLDREIDSLSGGELQRVAIAATAAR
FT                   DADFYFFDEISPYLDINQRILAARMLQDLASNKAVMVVEHDLALLDLLAESVHLAYGTP
FT                   GAYGVITRPKGIRVGINQYLRGFLPEENVRIRSESIEFEVHAPRDEKDVPVLVEYGEFS
FT                   KSYNGFELSAMPGVIRRSEVVGILGPNGIGKSTYIKILGGIEKPTNGRIDAKLKISYKP
FT                   QYLKAESDVTVEALLRSITPDFDSSYYQSEFVKPLALDRLLDQSMTELSGGELQRVAII
FT                   ACLSMDADLYLLDEPSAHLDVEQRMMAARVMRRFAESTERSVVVVDHDIYLIDMLSERL
FT                   IVFEGKPGVRGIANPPCDMREGMNKFLSAIGITFRRDEDTKRPRVNKPGSKLDRAQREM
FT                   GEYYYALS"
FT   gene            complement(6991..7410)
FT                   /locus_tag="Mthe_0008"
FT   CDS_pept        complement(6991..7410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM0427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13811"
FT                   /db_xref="GOA:A0B537"
FT                   /db_xref="UniProtKB/TrEMBL:A0B537"
FT                   /protein_id="ABK13811.1"
FT                   /translation="MAKQKKKAKSRETGRKEPPQKPPETQKEVKKVLKKKTPEERRKAQ
FT                   IEGIKKTLVPSILGIISGILCYYILGTGTDMMLGGVRVEWHFILLNLILITTIVQRFIY
FT                   PLIGIDVLAFKGKDWFYVEFIVVDLWAVTWTILLN"
FT   gene            8008..8286
FT                   /locus_tag="Mthe_0009"
FT   CDS_pept        8008..8286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0009"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="TIGRFAM: MoaD family protein; PFAM: thiamineS
FT                   protein; KEGG: afu:AF1624 molybdopterin converting factor,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13812"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0B538"
FT                   /protein_id="ABK13812.1"
FT                   /translation="MRIKIRAFASFREILGKEMMVEIESGSNVSDLINHLCEIKPDLRR
FT                   ALYSDTGELRDYFIIMLNRRRLNMPEDLGAALSDNDEVAIFPPVAGG"
FT   gene            8287..8682
FT                   /locus_tag="Mthe_0010"
FT   CDS_pept        8287..8682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0010"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   tko:TK2115 molybdopterin converting factor, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13813"
FT                   /db_xref="GOA:A0B539"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A0B539"
FT                   /protein_id="ABK13813.1"
FT                   /translation="MISDSEIDLEEILGRSINPDYGAVVAFIGVVRADPGVLGMEVEAY
FT                   DEAALEELKRIKEEAIARFGLSFVDVVHRKGRLLLGEVIVAVVCASSHRKEAFQACEYV
FT                   IDELKRRVPMWKKELTEEGGRWVKGDA"
FT   gene            8661..8978
FT                   /locus_tag="Mthe_0011"
FT   CDS_pept        8661..8978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0011"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   ape:APE1668 106aa long hypothetical periplasmic divalent
FT                   cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13814"
FT                   /db_xref="GOA:A0B540"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A0B540"
FT                   /protein_id="ABK13814.1"
FT                   /translation="MGERRCMMVITTAPPGDADRIAYTLVEERLAACVNVIPVRSHFIW
FT                   EGKISREKEEMLFVKTTPDAAERVRRRILELHSYQLPEIIALEIADGHEPYMRWIHESV
FT                   Q"
FT   gene            9232..9699
FT                   /locus_tag="Mthe_0012"
FT   CDS_pept        9232..9699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0012"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   rba:RB3283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13815"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0B541"
FT                   /protein_id="ABK13815.1"
FT                   /translation="MDENGPLRKPFSYQLTGMVHITKQNPEPWYREGLRFECIRCGRCC
FT                   RSQGIVWVSPEECSAIADFLGVSQDVLIRDYLLECEHGFVLRDHLDMSCVMLQGDRCII
FT                   YPARPHQCRSYPFWAEILESRDAWLSEASRCPGINRGRLWSFRDIRERMLK"
FT   gene            10103..11386
FT                   /locus_tag="Mthe_0013"
FT   CDS_pept        10103..11386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0013"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: afu:AF1070 coenzyme F390 synthetase (FtsA-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13816"
FT                   /db_xref="GOA:A0B542"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0B542"
FT                   /protein_id="ABK13816.1"
FT                   /translation="MRFGYHNEKLETASREKLRDIQTKGLRRTVRHVYESNPVYRRLFD
FT                   AHGVSPEEIKTLDDLQRLPMTNKELLRENYPLGLSCVPRDSIVEMHMSSGSTGTPVIMP
FT                   YTEGDLAQWAECMARCYMMSGARRGDAVQITPLFGLFNGGFGMYHGARAAGLFVIPAGP
FT                   GNTVRQIKLAKDLKTRIITGVVSYGVRLIEVMNELNEELPDLEIGIFGAETFSDAMKRR
FT                   ISTGLGVEVFDIYGMTETGGVGTLGMDCAAHDGIHVWEDHYIVEIVDPKTGEPVEDGET
FT                   GELVVTSITREALPVIRFRTADLTRIISRERCDCGRTHIRIAPITGRIDDMLIVKGVNF
FT                   FPKQVEQALMQIPGIGANYQIIVEDIDGVKEIRINVEAEPGVTGYIVEKALKEALGFSP
FT                   KGDVFPIGSLPRTEGKAQRVIHRKRQTG"
FT   gene            11419..11802
FT                   /locus_tag="Mthe_0014"
FT   CDS_pept        11419..11802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0014"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: mhu:Mhun_2474
FT                   phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13817"
FT                   /db_xref="GOA:A0B543"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0B543"
FT                   /protein_id="ABK13817.1"
FT                   /translation="MPDVSIISGSRSDQHIVDRILRVLDEHGASYEHRVISAHRNPKEL
FT                   DQYIESSNARVFIAVAGMSAALPGAVAARTERPVIGVPVSGKLLGIDALLSIVQMPPGV
FT                   PVACVGIDAGENAALLALRMLKS"
FT   gene            11856..12287
FT                   /locus_tag="Mthe_0015"
FT   CDS_pept        11856..12287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0015"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: Anticodon-binding domain protein; UspA domain
FT                   protein; KEGG: mba:Mbar_A3147 universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13818"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0B544"
FT                   /protein_id="ABK13818.1"
FT                   /translation="MYKRILIATDGSDKSRLAAEEGLELAKALGAEVLALYVVNEVVIA
FT                   SAVRQLGADKKEVEAKLQRQGEKALDDIKEMGEKLGVKVETVIRIGAPANVIIDVARTE
FT                   NIDCIVMGSHGESGVSKLLIGSVVQKVLYWATTPVLVVR"
FT   gene            12657..13691
FT                   /locus_tag="Mthe_0016"
FT   CDS_pept        12657..13691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0016"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mba:Mbar_A0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13819"
FT                   /db_xref="GOA:A0B545"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:A0B545"
FT                   /protein_id="ABK13819.1"
FT                   /translation="MPEKWVHDATGSFHNYLPPGCEICRQGASLVLFVTGVCTRGCFYC
FT                   PLSVERRGREIIFANERIVSSPKDILEEARAIDALGTGITGGEPLFKLDLVLDTIRMLK
FT                   RNLGSEHHIHLYTGIVPGESVLSKLRKAGLDELRIHPDPEQEDVRLVGVLKSARNLGIE
FT                   AGVEIPAIAPAPWIAEAVQSAGAFLNINELEFSETNADMLRARGFRVNPNSCAAIGSES
FT                   IARSFMHYGIKLHYCSSVFKDSVQLRERLKRRAERIRRAFDIVSDDGTLLTGIILASDL
FT                   QAAIRVLENLGVPESMYELADNGIEIAAWILEEIADEVRQIGSPQIVERYPTEDGLVVE
FT                   RIPL"
FT   gene            13730..14032
FT                   /locus_tag="Mthe_0017"
FT   CDS_pept        13730..14032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13820"
FT                   /db_xref="InterPro:IPR020501"
FT                   /db_xref="UniProtKB/TrEMBL:A0B546"
FT                   /protein_id="ABK13820.1"
FT                   /translation="MESAEERIQERLRNYLKRDGIGIRKAVLKLFLSDSSFTTEDIFTH
FT                   LEKEGFNVSYRGVSAMVGLMNTRLGILSIDVSGDHNVYSLKNDHKMIVKSVLENY"
FT   gene            complement(14069..15562)
FT                   /locus_tag="Mthe_0018"
FT   CDS_pept        complement(14069..15562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0018"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mka:MK1429 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13821"
FT                   /db_xref="GOA:A0B547"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A0B547"
FT                   /protein_id="ABK13821.1"
FT                   /translation="MSGKRIVLTSDRTMMSSYHGGVLLGFAAIMPRAVMPDWLLRSLFC
FT                   PPVKAYPDGRAVYAPCGMRKVEAALLEAGFSRDEVMVAHPDHLDKAIGSDTEIVGITHD
FT                   DPMGKIAVREIEDIINKGPPHNRHSFLRLINHPLIKKHDPVIVVGGNGAWELADEDVGV
FT                   DHIYLGEGESKFPEVCMAILSGKNPPRIIEGTPVAGDRIPVNRGATIAGIVEIGRGCWR
FT                   GCAFCSPTMRSLRHRPVSSILEDVRVNMREGMRDVLLHSEDVFTYGSRGMRPEPDKVLE
FT                   LFRSVKELSPHTIDVSHLSLATVHQSMDLLREISEIVGVGTDQRYMSAWIGIETGSCRM
FT                   LEMHMPRKALPESPERWPDIVRECYALFHEEHWVPVASLVLGLPGETADDVVRTTELVE
FT                   SLKDYTGLMLPLFFTPMAGTSLGSYKGLGKDNALPEHWELVGTCMEYNLRHLKKLHNLY
FT                   KERMTPNPMVHVGLRMINIAADIILQKYMRRMKRGEPPN"
FT   gene            15964..17475
FT                   /locus_tag="Mthe_0019"
FT   CDS_pept        15964..17475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0019"
FT                   /product="protein of unknown function DUF39"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF39; KEGG: mma:MM0241 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13822"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="InterPro:IPR016426"
FT                   /db_xref="UniProtKB/TrEMBL:A0B548"
FT                   /protein_id="ABK13822.1"
FT                   /translation="MEAKKSLSEINERIRDGSVRVVTAEEMPSIVEELGPDGAVREVDV
FT                   VTTGTFGAMCSSGVFLNLGHSDPPIKISRAWLNQVEAYGGVAAVDLFLGATQPSEDRGI
FT                   EYGGAHVIEDLVSGRAVDVMGEGVGTDCYPRMEIETTLHLEDLNQALMVNPRNAYQRYN
FT                   AATNSSDRTLHTYMGTLLPHFGNVHYSGAGVLNPISNDPGFEYIGTGVRIFLGGAQGYI
FT                   VGPGTQHSPGTGFATLMVSGDLKRMSSEFLRAATFTKYGPTLYVGVGVPIPILNERLAL
FT                   STAVRDSDITVPVVDYGVQRRDRPVLKSTSYAELRSGFVEINGKEVPTASLSSFHMARM
FT                   VAGTLKKWIERGEFLLTEQAEPLSKSGVSRPMKQTKELPYVGDVMNRDVVTVGENISVP
FT                   EAARVIVGSRFDHLPVVSDDGKLMGIITTWDISKAVANGNISRVSEIMTRRVYTATPDE
FT                   PIELAARTMDIHSISALPVVDKDNRVIGMITSNDLSRLFAGRRSI"
FT   gene            17472..17858
FT                   /locus_tag="Mthe_0020"
FT   CDS_pept        17472..17858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0020"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mbu:Mbur_0310 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13823"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="UniProtKB/TrEMBL:A0B549"
FT                   /protein_id="ABK13823.1"
FT                   /translation="MKLMLRVAPGIVRKPLIASVILETGALINIERASIDAVSGEIVLD
FT                   VSDDKCKQVKDAFERRGVDVVLLEIPVMRNEEECVHCGACIAICPTGTFRFDDWKVVTD
FT                   PGKCIQCGACVTACPHRALQLVLR"
FT   gene            18006..18992
FT                   /locus_tag="Mthe_0021"
FT   CDS_pept        18006..18992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0021"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: protein of unknown function Met10;
FT                   Methyltransferase type 11; KEGG: mba:Mbar_A1392
FT                   1-methylguanosine tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13824"
FT                   /db_xref="GOA:A0B550"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR040601"
FT                   /db_xref="UniProtKB/TrEMBL:A0B550"
FT                   /protein_id="ABK13824.1"
FT                   /translation="MGERIRRALIEMGALDKGKRIRSDDSHVYIPVLDSISPDALKGLA
FT                   DVEIVHMEFDEDRRRITVEEILGRRPSFETIGDIAVVEDEEPERSAEAIMAVHRGIRTV
FT                   LTPISDVEGEFRLRRYRHVAGEMKTLTIHREHGIRYKVDLERAYFSPRLSTERLRVAEQ
FT                   VRPGDLVVDMFAGVGPFSLLMAKRGARVIAIDKNPCAAKLLKENARMNRLDVEIREGDA
FT                   SSLTEDLADKADHVVMNLPHSASLFLTEAIRTAKNGGVVHYYTFAPEDDLYRDVRIIEE
FT                   KARELGCKAAVTYRSVVRSYAPRKYNVVIDFMVKKDAQRGRSTSMET"
FT   gene            complement(19073..20974)
FT                   /locus_tag="Mthe_0022"
FT   CDS_pept        complement(19073..20974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0022"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit E"
FT                   /EC_number="6.3.5.7"
FT                   /note="TIGRFAM: putative aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit; PFAM: GatB/Yqey domain
FT                   protein; GAD domain protein; GatB N-terminal region; GatB,
FT                   central domain protein; KEGG: mba:Mbar_A2389
FT                   glutamyl-tRNA(Gln) amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13825"
FT                   /db_xref="GOA:A0B551"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004414"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A0B551"
FT                   /protein_id="ABK13825.1"
FT                   /translation="MDYPDMDYRALGLVCGIEIHQQLDTRCKLFCSCPTVHREVEDSNF
FT                   EFFRYLRPARSELGEIDRAALEETLVSRRFVYKSYNTTCLVEADEEPPRELNREALEIA
FT                   LVIARLLKMRIVDEIHTMRKTVIDGSNTSGFQRTAFIASSGSIDTSCGPVGIGILCLEE
FT                   EAARIVEDRGDEVVYSLDRLGIPLVEIGTAPDIVSPQHAREVAQHIGMILRSTGRVKRG
FT                   LGTIRQDVNVSIAGGARVEIKGVQELNLIERIVELEVIRQVRLLEIRDELRRRNARVCG
FT                   DVVDATGLFSNTRSKVVAKALKSGGAVLATKLAGFKGIIGKEVQPGRRLGTELSDRAKR
FT                   AGVGGIFHTDELPAYGITEEEVSSLRSLLSCEESDAVVMVAAPPERARKAIEAVIERAR
FT                   EAIAGVPEETRRALPDGTSEYMRPLPGSARMYPETDVPPVVVNKEMVERLRLPELVVER
FT                   AERYQREYGLSPEQARIMAASSNYQLFEEIVRVYRVQPSLVVRSLESTPVELARDGVPV
FT                   YRLSERHFMGCFDLLSQKRIAKEGIPALLKAMAENPDADPESAAEAAGLMSLGASEVER
FT                   IIHEIVSAKVDLVRERGERAIGPLMGLAMEQLRGKADGAAVSALIKKEINAILGKAV"
FT   gene            complement(21000..21227)
FT                   /locus_tag="Mthe_0023"
FT   CDS_pept        complement(21000..21227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0023"
FT                   /product="archaeal histone"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/archaeal
FT                   histone; Histone core domain protein; KEGG: tko:TK1413
FT                   archaeal histone A"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13826"
FT                   /db_xref="GOA:A0B552"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A0B552"
FT                   /protein_id="ABK13826.1"
FT                   /translation="MAVLPVAPVARLIRMAGAKRVSEDASIELASILENYGIEIAKEAI
FT                   DWANHAKRKTVRAEDIKEAAKRVRPLKPGE"
FT   gene            21765..22250
FT                   /locus_tag="Mthe_0024"
FT   CDS_pept        21765..22250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0024"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   mba:Mbar_A1338 3-isopropylmalate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13827"
FT                   /db_xref="GOA:A0B553"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A0B553"
FT                   /protein_id="ABK13827.1"
FT                   /translation="MARAWKFGNDIDTDVIIPGRYLVINDPEELAKHLFEGIRPEFAES
FT                   VRHGDIIVAGTNFGCGSSREHAPLAIKAAGVEAVIARSFARIFFRNSINIGLPLLICAD
FT                   AEKIDDGDSVVVDISRGIVQNISKKESYPTTPLPPFLQEIVRSGGLLNYTKKQVVRA"
FT   gene            22247..23371
FT                   /locus_tag="Mthe_0025"
FT   CDS_pept        22247..23371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0025"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: mac:MA0201 3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13828"
FT                   /db_xref="GOA:A0B554"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A0B554"
FT                   /protein_id="ABK13828.1"
FT                   /translation="MIYKVPVIPGDGIGPEIIAEGRKVLETAADKHGFDIEWIEYPLGA
FT                   DHYLRTGELVSEETLKELGRYRAIYLGAIGDPRVKPGVLEKGILLAMRFYFDQYINLRP
FT                   VKLLEGVWTPLKDKGPKDIDFVVVRENTEDFYIGQGGRARSGRSHADLEVKRSLYNVKF
FT                   GLDIDSDSDEIAYQIGMVSREGCTRVIKYAFDLAMERRKHVSSVDKANVLSDIYGFWRE
FT                   IFEDVGKSYPEVTTDFNFVDAITMWFVKNPEWFDVVVAPNMFGDIITDLGAMIQGGLGL
FT                   APGANLNPEGTSMFEPIHGSAPKYKGMNKINPIATIWAGAMLLEHLGEKEAAQDVVRAI
FT                   ELSLREGRVRTYDLGGSSTTSEVGDEIARLVRNL"
FT   gene            23457..23544
FT                   /locus_tag="Mthe_R0002"
FT                   /note="tRNA-Lys1"
FT   tRNA            23457..23544
FT                   /locus_tag="Mthe_R0002"
FT                   /product="tRNA-Lys"
FT   gene            23572..23808
FT                   /locus_tag="Mthe_0026"
FT   CDS_pept        23572..23808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0026"
FT                   /product="DNA-directed RNA polymerase, subunit H"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase subunit, RPB5; KEGG: afu:AF1885
FT                   DNA-directed RNA polymerase, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13829"
FT                   /db_xref="GOA:A0B555"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020608"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B555"
FT                   /protein_id="ABK13829.1"
FT                   /translation="MKRFAVQDHELVPEHILLTPEEAQQVLMQYGVEARHLPKIHVTDP
FT                   VAKEIGAKVGDIIKIKRKSPTAKESIFYRLVID"
FT   gene            23826..25316
FT                   /locus_tag="Mthe_0027"
FT   CDS_pept        23826..25316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0027"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3; KEGG:
FT                   mac:MA1265 DNA-directed RNA polymerase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13830"
FT                   /db_xref="GOA:A0B556"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A0B556"
FT                   /protein_id="ABK13830.1"
FT                   /translation="MLDRSVLYRAYFTKDKLVHHHINSFNEFIDRGLQKVIDEVRIIET
FT                   NIENTYVKLGKIRVEKPVVMEADGSVERLYPNDARLRNLTYASPIKLEMSIVDRGEEKE
FT                   PVEAMIGMLPIMVMSKVCNLYGMSEEEMVSYGEDPLDPGGYFIVNGSERVIMTLEDLAP
FT                   NKILVEYNQRYDEFIEVAKVFSQRQGYRSLVIVERGKRSILEVSFPSVAGRINFVTLVR
FT                   ALGLETDMDIVKAVSDNPEIMKFMLENLEEAEVSTTEEALEKIGNRVAAGQAKEYQKKR
FT                   AAYVLDRYLLPHIGVEEKDRYAKALFLSRMAEACFELALGKRGEDDKDHYANKRLKLSG
FT                   DLMEDLFRVAFNRLTRDIKYQLERASMRNRELNVITTVRADVLTERMIHPLATGNWVGG
FT                   RTGVSQLLDRTDYMASLSHLRRVISPLSRSQPHFETRDLHATQWGRICPSETPEGPNCG
FT                   LVKNFAQGVELSKGVEDYEEVKTMLINLGVRPVGGYGG"
FT   gene            25309..27123
FT                   /locus_tag="Mthe_0028"
FT   CDS_pept        25309..27123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0028"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase
FT                   Rpb2, domain 7; RNA polymerase Rpb2, domain 4; RNA
FT                   polymerase Rpb2, domain 5; KEGG: mma:MM2272 DNA-directed
FT                   RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13831"
FT                   /db_xref="GOA:A0B557"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:A0B557"
FT                   /protein_id="ABK13831.1"
FT                   /translation="MADARVFINGEIVGHHPEPEKLVAEIRRLRRAGVISNQINVAYYD
FT                   RTNEIVINTDSGRARRPLIIVENGQPLVTEEDIRRLERGEATFDDLVREGKIEYLDAEE
FT                   EENAYIAIWENDLTEEHTHLEVDPSLILGICTALVPYPEHNASPRNTMGAGMIKQCLGF
FT                   PMANIRLRPDTRGHYLHYPQQPIVSTRTAKAIGFDKRPAGQNFVVAVLAYEGYNIEDAL
FT                   VMNKSAVERGLARSHFFRVSEAEERKYPGGQEDKFEIPDLEVRGARGSETYGQLDADGL
FT                   VNPNADVGPNDVLIGKTSPPRFLEEPTEFGISPQQRRETSVTMRSNEKGVVDLVILTES
FT                   QNGNRLAKVKTRDQRIPELGDKFASRHGQKGVVGLLLPQEDMPFSESGMVPDLLLNPHA
FT                   IPSRMTVGHVLEMIGGKVGSLEGRFIDATAFLGEKEWDLRSALTRLGFAHTGKEVLYDG
FT                   ATGERIQADIFVGVILYQKLYHMVTGKMHARSRGPVQVLTRQPTEGRAREGGLRFGEME
FT                   RDVLIAHGAALALKERLVEESDKVTELVCSKCGVIAIHDRRRNMDLCPVCGTDTDIYPV
FT                   EMSYAFKLLLDEIKSLGVAPRLMLEDAV"
FT   gene            27132..29762
FT                   /locus_tag="Mthe_0029"
FT   CDS_pept        27132..29762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0029"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: mba:Mbar_A3692 DNA-directed RNA polymerase,
FT                   subunit A; TIGRFAM: DNA-directed RNA polymerase subunit A';
FT                   PFAM: RNA polymerase, alpha subunit; RNA polymerase Rpb1,
FT                   domain 3; RNA polymerase Rpb1, domain 1; RNA polymerase
FT                   Rpb1, domain 4; SMART: RNA polymerase I subunit A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13832"
FT                   /db_xref="GOA:A0B558"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0B558"
FT                   /protein_id="ABK13832.1"
FT                   /translation="MSVPKRIGKIRFGLISPQEFRKMSVVKVITADTYDDDGFPIEMGL
FT                   MDPRLGVIDPGLRCRTCGGRPGECPGHFGHIDLVAPVIHVGFAKLIRKILRAICRECSK
FT                   LMLSELEKKEFLRQIRTLEDLGQPTEDVVNKVFAEARKHKTCPYCGAPQREIKFERPLS
FT                   YIEDGHKLTPSDIRDRFERISDEDIMVMGMNPETARPEWTILTVLPVPPVTMRPSITLE
FT                   SGQRSEDDLTHKLVDIIRINQRFQENREAGAPQLIIEDLWELLQYHVTTFLDNTVSGVP
FT                   PARHRSGRPLKTLSQRLKGKEGRFRGSLSGKRVNFSARTVISPYPNLSINEVGVPIEVA
FT                   KELTVPIMVTPKNIEVVRKYVMRGPDNHPGVNYVTRADGRRVKVTERNCQEVAEQLEVG
FT                   WKVDRQLADGDIVLFNRQPSLHRMSIMAHRVKVMPYKTFRLNPAVCPPYNADFDGDEMN
FT                   LHVPQTEEARAEAEILMRVQENILSPRFGGPIIGGIHDYVTGSFLLTHKERRLNKDRLM
FT                   EVLKKLDISDIPVPAGYDENGDPYWTGKQIFSLILPKDLNLTFKADFCSNCPVCKGEDC
FT                   ENDAYVVIRNGVLLKGTIDAEAVGAFKGKVIDRIIKEYDPGVASQFLDRMTLLALRGIM
FT                   LAGFSFGISDEDVPREAAEQIQDVTRSAKESVQRLIEAYRAGELEPLPGRTLEETLEMR
FT                   IMQTLGKARDAAGQIAGRYLGLDNSGVVMAVSGARGSMLNLTQMAACVGQQSVRGERIK
FT                   RGYTDRTLPHFKRGDLGAEAHGFVESSYKKGLSPTEFFFHAIGGREGLVDTAIRTSQSG
FT                   YLQRRLVNALQDLEVNYDGTVRETRGMIVQFKYGEDGVDPSRRDYASPENVHRIIRKVL
FT                   AGENA"
FT   gene            29759..30913
FT                   /locus_tag="Mthe_0030"
FT   CDS_pept        29759..30913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0030"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: mba:Mbar_A3691 DNA-directed RNA polymerase,
FT                   subunit A; TIGRFAM: DNA-directed RNA polymerase, subunit
FT                   A''; PFAM: RNA polymerase Rpb1, domain 5"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13833"
FT                   /db_xref="GOA:A0B559"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:A0B559"
FT                   /protein_id="ABK13833.1"
FT                   /translation="MKLPESWLKRIDELDLPISLKDAIKSGLEEAERVTEEQFETIIKE
FT                   VVEDYEHARVEPCEAVGVVAAQSIGEPGTQMTMRTFHYAGVAEINVTLGLPRLIEIVDA
FT                   RKIPSTPTMTIRLLPEYASDRDMAREVAWAIEATSILHLGSIATDLAEMNVVIELNEDA
FT                   MAQRKITAEDVAEKLRDATGLTVDQKGNTIIMAPEEPSYRELLQLVERIKKVTLKGVDG
FT                   IKRVVIRKEGDEYVLYTEGSSLKEVLEFEGVDPTRTKTNNINEICEVLGIEAARNAIIN
FT                   EATETLREQGLQVDVRHIMLVADIMTCDGDVKQIGRHGVSGEKASVLARAAFEVTVNHI
FT                   LDAAIRGDVDDLRGVTENVIVGQPIRLGTGDVQLVAKRIDEVVR"
FT   gene            30910..31221
FT                   /locus_tag="Mthe_0031"
FT   CDS_pept        30910..31221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0031"
FT                   /product="LSU ribosomal protein L30E"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   mac:MA1261 ribosomal protein L30e"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13834"
FT                   /db_xref="GOA:A0B560"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B560"
FT                   /protein_id="ABK13834.1"
FT                   /translation="MINIDRALRSSIRTGKVVLGSNSSLEHGLRGDAKLIIYASDCPEH
FT                   VRQKLRSLEVPVYAYQSSGRDLGAACGKPFPVAALAVIEPGDSEIMALLREIRGVANE"
FT   gene            31214..31645
FT                   /locus_tag="Mthe_0032"
FT   CDS_pept        31214..31645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0032"
FT                   /product="NusA family KH domain protein"
FT                   /note="TIGRFAM: NusA family KH domain protein; PFAM: KH,
FT                   type 2 domain protein; KH, type 1, domain protein; KEGG:
FT                   mba:Mbar_A3689 transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13835"
FT                   /db_xref="GOA:A0B561"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:A0B561"
FT                   /protein_id="ABK13835.1"
FT                   /translation="MSEFKLTTEGIRYIALFESLTGGMARDCIVDEENDRIIFVIQKGD
FT                   MGAAIGRKGSNINRVKKSIGKQIEIVEYSDDVKEFLQNLFQPADVKNIMVVNKNNKRLA
FT                   YVEVANKDKGIAIGRDGRNILKAKMLAQRHHGVDDIIIQ"
FT   gene            31707..32129
FT                   /locus_tag="Mthe_0033"
FT   CDS_pept        31707..32129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0033"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S23 (S12); PFAM:
FT                   ribosomal protein S12/S23; KEGG: afu:AF1892 30S ribosomal
FT                   protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13836"
FT                   /db_xref="GOA:A0B562"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B562"
FT                   /protein_id="ABK13836.1"
FT                   /translation="MGINAARKMEDDWKKLRWSDPHYCRRALGLKVKADPLGGAPRARG
FT                   IVLEKVGVEAKQPNSAIRKCVRIQLIKNGRQVTAFCPGDGAIGFIDEHDEVVVERIGGR
FT                   MGRSMGDIPGVRFKVVAVNNVSLEEMVSGRKEKPVR"
FT   gene            32134..32691
FT                   /locus_tag="Mthe_0034"
FT   CDS_pept        32134..32691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0034"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: mac:MA1258
FT                   ribosomal protein S7p"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13837"
FT                   /db_xref="GOA:A0B563"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B563"
FT                   /protein_id="ABK13837.1"
FT                   /translation="MKVFGKWDASEVEIPDLSVKGYINLKPRIVLHTGGRHAKQQFKKS
FT                   ELHVVERLINKMMRKEKNTGQKQIAYRIVEEAFDIIHSRTKENPLSVLVRAISNAGPRE
FT                   EVVRLKYGGITVPKAVDTAPQRRVDTALMLIAKGAWQASFKSRRSIQNCLADEIIAAAN
FT                   YDVKSFAVSRKDSIERVAKAAR"
FT   gene            complement(32799..33515)
FT                   /locus_tag="Mthe_0035"
FT   CDS_pept        complement(32799..33515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0035"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: mhu:Mhun_2204 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13838"
FT                   /db_xref="GOA:A0B564"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0B564"
FT                   /protein_id="ABK13838.1"
FT                   /translation="MCIRVDGENRSVVWDSVAEERQLELRINGDLLRRVTLSPCHIREF
FT                   VVGHLLSEGYMGALEDIAAIHIEGHLADVTLRPACDQKRTEKHTVHSEKTEGLAVRTDT
FT                   VFRAMRMLLDSDAHRITGGFHRAGVFCEDGTAWMAEDIGRHNAMDKAIGHCLLERIDLS
FT                   RVFVVMTSRISSGLTLKCSRAGISILASRGAPTSLALEIADAVGITLMGFVREERMNIY
FT                   THPERLADLSPTSTAK"
FT   gene            33791..34768
FT                   /locus_tag="Mthe_0036"
FT   CDS_pept        33791..34768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0036"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mhu:Mhun_1529 daunorubicin resistance ABC
FT                   transporter ATP-binding subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13839"
FT                   /db_xref="GOA:A0B565"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B565"
FT                   /protein_id="ABK13839.1"
FT                   /translation="MEHAIETRGLVKRFDGLVAVDDVNLSVKRGEIFGLLGPNGAGKST
FT                   IIKMLTTMLRPTGGEAYVWGHHIVRERDAVRSCIGVVFQDPSVDGKLTARENLDFHGRM
FT                   YGMPGDERKRRIAEVLELVELSDKADVLLEEFSGGMRRRLEIARGLMHRPHVLFLDEPT
FT                   LGLDTQTRRYIWDYIRDLNKEDVTVVITTHYMEEADNLCNRVAIIDHGRIVALDTPMSL
FT                   KSMIGTDTLTLEVSDGLERLRDLLLEFSWVQSFDASNGYVRLSVDSAQSRIPEVVLAAC
FT                   RAGVQIKSVSVHEPTLEDVFLKYTGRSMRDETGKGDLVRALMRR"
FT   gene            34770..35537
FT                   /locus_tag="Mthe_0037"
FT   CDS_pept        34770..35537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0037"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mma:MM2454 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13840"
FT                   /db_xref="GOA:A0B566"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0B566"
FT                   /protein_id="ABK13840.1"
FT                   /translation="MRAFDPYAIYSLWLREMIRFFRLKSRVVGSIAPPFFFLAFLGTGF
FT                   SGMASRVPAGVDYINYLAPGIIGMTLLFSSTFAGMSVLWDREFGFLREIMVAPVTRLSI
FT                   VLGRTAGGVTQAVLQGIIILIPGIAMGVKIKGLTGLLLSLALMVIISATFIGVGLAFAS
FT                   RMKDMSGFGLIMNFMIFPVFLLSGALFPVQNLPGPVRILSYIDPLTYGVDALRGCLVGA
FT                   NSFPVILDALLLTGCCAATMAIGAYLFETSDID"
FT   gene            complement(35534..35950)
FT                   /locus_tag="Mthe_0038"
FT   CDS_pept        complement(35534..35950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13841"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="PDB:5HT7"
FT                   /db_xref="UniProtKB/TrEMBL:A0B567"
FT                   /protein_id="ABK13841.1"
FT                   /translation="MKNKILLIFFVAVLIGLLCVSAQRNIMMPGGFGPGVSDFQGVVAG
FT                   AGSASTSGPSEAVLFADANQRGVHKHIFESDADVGADIAFNATPRSMVVLSGVWRLYRE
FT                   PNFQSPYEAEFGPGIYPSIADYGINVIGSMKRIS"
FT   sig_peptide     complement(35801..35950)
FT                   /locus_tag="Mthe_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.344 at
FT                   residue 50"
FT   gene            36677..37084
FT                   /locus_tag="Mthe_0039"
FT   CDS_pept        36677..37084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13842"
FT                   /db_xref="InterPro:IPR012546"
FT                   /db_xref="UniProtKB/TrEMBL:A0B568"
FT                   /protein_id="ABK13842.1"
FT                   /translation="MRLRVVSSKKEISDLNRNEQVVHLAFRASNMDVMNLVRTCPRLKA
FT                   VQIPPSYYQTMSKAAQQFLELQGIEIIKGDVWGHRKDIDEYYSVSEKVIDRIASLMAEG
FT                   YSIDETVKKVHRETKLSEDLIRYLLKEQVMA"
FT   gene            37127..37600
FT                   /locus_tag="Mthe_0040"
FT   CDS_pept        37127..37600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13843"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0B569"
FT                   /protein_id="ABK13843.1"
FT                   /translation="MELERLIRDFLVRSRRDLRAQLEAKYGLDPDEIDEILDRMIHRIY
FT                   GPALGLAESLKHGRVALFIEREGCPVCRDAAPELERFLKDHPDFSCIRLEYSKPEGLIY
FT                   HILHQEESGRLPLVALISDGTVMMLETGGARAFAEYEGSAKCEGLCEVRTPGK"
FT   gene            37597..38292
FT                   /locus_tag="Mthe_0041"
FT   CDS_pept        37597..38292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0041"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase;
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   mbu:Mbur_1995 triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13844"
FT                   /db_xref="GOA:A0B570"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022891"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A0B570"
FT                   /protein_id="ABK13844.1"
FT                   /translation="MRWSQSLGGMALTLIVLNFKTYREATGDSAVALSKICESIASEYG
FT                   VDIAVAPQAADIRAVASAVSIPVYAQHVDGVGFGSFTGHITAASVKAAGASGSLINHSE
FT                   RRLRLADIEASLRACRSEGLTSIICTNNVATTRAAAALRPDYVAVEPPELIGSGIPVSK
FT                   ADPEVVRGSVEAVRAIEKDVGVLCGAGITHGDDLRAAIELGAVGVLLASGIVKAKDQRK
FT                   ALEDLVTGV"
FT   gene            38297..38569
FT                   /locus_tag="Mthe_0042"
FT   CDS_pept        38297..38569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0042"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: pfu:PF0283 putative
FT                   acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13845"
FT                   /db_xref="GOA:A0B571"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B571"
FT                   /protein_id="ABK13845.1"
FT                   /translation="MTICVRVRVSGRVQGVGYRYYTTTHAKALGVKGWIRNLPGGGVEA
FT                   VLEGERKSVGELLGLMKSGPSGAMVSGMEIAEVECKGHDDFKIIY"
FT   gene            38588..38767
FT                   /locus_tag="Mthe_0043"
FT   CDS_pept        38588..38767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0043"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mbu:Mbur_1307 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13846"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0B572"
FT                   /protein_id="ABK13846.1"
FT                   /translation="MITINRYVCGYCGACVGVCPVCALELVETWLEVSDGCIECGRCVK
FT                   LCPTGALSLEEAQG"
FT   gene            38764..39939
FT                   /locus_tag="Mthe_0044"
FT   CDS_pept        38764..39939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0044"
FT                   /product="2,3-di-O-geranylgeranylglyceryl phosphate
FT                   reductase"
FT                   /EC_number="1.3.99.-"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase, FAD-binding; FAD dependent oxidoreductase;
FT                   Lycopene beta and epsilon cyclase; KEGG: mbu:Mbur_1308
FT                   geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13847"
FT                   /db_xref="GOA:A0B573"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023590"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B573"
FT                   /protein_id="ABK13847.1"
FT                   /translation="MRCDVVVVGAGPGGSMAAKTAAEKGLKVVLVEKRQEIGDPVRCAE
FT                   GVSKARLSSMIKPDPKWIASEVKGARLYAPDGSNVVMSEDKSGDEVGYVLERKIFDRAL
FT                   AMDAARAGARVMVKTRALDLLRANGSVKGIRAMRYGEIIDIEADVVIGADGVESKVGRW
FT                   AGIDTALKPGDIEVCAQFLLYDKGIDDEYCEFFLGNELAPGGYVWSFPKGEHLANVGLG
FT                   VIGSRSEPGAPVKLLRRFVERRMPEARIVEMVVGGVPVSGPIERTIADGVMLVGDAARQ
FT                   SDPITGGGILNAMQAGMIAGEVVADAVSSGDTGVEGLMAYEKRWRESIGKQIARHLDLK
FT                   EFFIRLSDDDLNKLMHSIQSEDVSKMDLRGMLRVLIRLNPKMLWELRHLVM"
FT   gene            complement(40177..40641)
FT                   /locus_tag="Mthe_0045"
FT   CDS_pept        complement(40177..40641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0045"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mba:Mbar_A3616 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13848"
FT                   /db_xref="GOA:A0B574"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0B574"
FT                   /protein_id="ABK13848.1"
FT                   /translation="MADNRRVLLKTSLGDVVIELYDDMPITAGNFLKLVESGFYDGVIF
FT                   HRVIAGFMIQTGDPTGTGYGGPGYTIPDEFSRHNRNDRGTVAMANAGPNTGGSQFFINL
FT                   VNNNYLDRMHPVFGRVVEGMDVVDKIGDVRTDAEDRPIEDVVIVSARVLG"
FT   gene            complement(40700..40771)
FT                   /locus_tag="Mthe_R0003"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(40700..40771)
FT                   /locus_tag="Mthe_R0003"
FT                   /product="tRNA-Gly"
FT   gene            41252..43309
FT                   /locus_tag="Mthe_0046"
FT   CDS_pept        41252..43309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0046"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG: mma:MM1054
FT                   surface layer protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13849"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A0B575"
FT                   /protein_id="ABK13849.1"
FT                   /translation="MGLWRAVLIMSLVVMIVSASSARILVVDQEATGAIRSVNAALANA
FT                   QNGDEILVMAGYYRESVDVNKLVSIKGYGAIIDGMGRTTFQMRSYGSSISNLTILGSGR
FT                   DPAVVVEGYASVTGCNIKNSSIGIAAYKGVVSNNTISATAYGIRLNGSAIVENNTISGP
FT                   LGAGIEVRCNSSRILSNIVTSAGNAIDVVGNNNTVLFNHLSSSNIGIRLKSSSDNIMMN
FT                   NTCEKNRIAGVYLEDSRNNSVSSNRFLRNGNGILLKSSSGNKIIGNIVELNEYGISMKG
FT                   SGGNLLRENVLISNIYSLRIEAGNLGDLRLISDPRARMDDNSFNQSIDESNTIDGRPVL
FT                   YLVGARNVSIDKSYGFVGLIDCENITMRNQSISNSSAAIMLVGAIDSRISDCRLSRSEI
FT                   GLSILDSKGCVVENTTAESCGIGFWFGRSQDIFVRKSAALNCTESGFRLEGDRRSRITD
FT                   SRAENCTAGMHLLDALSSEIVRSRISSSSEDGIRLVRSHRSTVKENEVTGNDNGIAISG
FT                   SNQCVLAMNNASANGIGIRIEQLSGGSAADNIAFRNREGIFVNGVKEFQFIGNNISMNE
FT                   RFGMRMGSSSGCNISDNRFVGNGMLGLSLTDCSDNRIYHNSFIENGSMFGQNAVDNGSN
FT                   LWDMGPVIGGNYWSDHQVSGNPGDTPKNVPSKGVDRYPFERDNGWRSPAL"
FT   sig_peptide     41252..41320
FT                   /locus_tag="Mthe_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.385 at
FT                   residue 23"
FT   gene            43314..43802
FT                   /locus_tag="Mthe_0047"
FT   CDS_pept        43314..43802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0047"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="SMART: regulatory protein, AsnC/Lrp family; KEGG:
FT                   mba:Mbar_A1460 heme d1 biosynthesis protein NirH"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13850"
FT                   /db_xref="GOA:A0B576"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0B576"
FT                   /protein_id="ABK13850.1"
FT                   /translation="MQEDASRMSQEMDQTDLTLLRALQDGIPIVPHPFKEIGDRLGLDE
FT                   NTVISRLRALRESGVVRRFAATIGHRALGIIANAMIVWKVEDDIERIGCIMASFEEVTH
FT                   CYQRATCDGWPYNLYTVVHSRSREECEEIASRISEATGVKEYRILFSEKEYKKTSARI"
FT   gene            43799..44323
FT                   /pseudo
FT                   /locus_tag="Mthe_0048"
FT   gene            44469..45704
FT                   /locus_tag="Mthe_0049"
FT   CDS_pept        44469..45704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0049"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase; KEGG: mac:MA0577 glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13851"
FT                   /db_xref="GOA:A0B577"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B577"
FT                   /protein_id="ABK13851.1"
FT                   /translation="MLVTHKKASISEIENAWHGDVEALLKWVSSHDTVEECAVLKTCNR
FT                   VEIYVVSPRGEKVLFEIAKKARVSSRIIDIHDHDESLLHLLRLASGLESMIIGEDQILG
FT                   QMKELYRTAKSLGYTGWVLDTAFKKAIQVGKRVRKETAINERSVSVGSAAVDLAEQILG
FT                   GLEGKSVLVIGAGETGELISKALVSKNIGSLYVTNRTFGTALSLAASLGGTAVPYEEMK
FT                   RKIREADVVISATSAPHYILLKDDIERAMEGRKNKLLIIDIANPRDVDEAVREIEGVEL
FT                   HNIDSLKQISDENMRLRMREIERVEAIIEEELELLRAKYKRREAEELLARIYSEAEKIK
FT                   EQEVRRAMNKLSAYHTLGEIEQKVLMDMSHSIVNKIFAEPTKALKSAAERGNTEMLRYA
FT                   MELFRLNQEESD"
FT   gene            45701..46654
FT                   /locus_tag="Mthe_0050"
FT   CDS_pept        45701..46654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0050"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   afu:AF1974 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13852"
FT                   /db_xref="GOA:A0B578"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A0B578"
FT                   /protein_id="ABK13852.1"
FT                   /translation="MRRMRRLRRPGIREMVAETRISVRDLIMPVFVDERIDQPVPISSM
FT                   PGQMRQSLNSVAEEAGRIEDLGIPAVILFGIPSRKDDLGSGAYDHDGVIQKAVRRIKES
FT                   TDLVVITDLCLCEYTSHGHCGVIRGQEIVNDETLPLLGRTAVSQAESGADIVAPSGMMD
FT                   HMVRAIRSALDDNGYTDVAILSYAAKYASYFYGPFREAAESGFAFGDRRSYQMDPANAN
FT                   EALWEVQLDIEEGADMVMVKPALPYLDILRMVKERFSMPTAAYQVSGEYSMIMAAAERN
FT                   WIDGDGVMLETLTSIKRAGADMIITYYAKDFAARFA"
FT   gene            47213..47662
FT                   /locus_tag="Mthe_0051"
FT   CDS_pept        47213..47662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13853"
FT                   /db_xref="UniProtKB/TrEMBL:A0B579"
FT                   /protein_id="ABK13853.1"
FT                   /translation="MRVLLVFLFLIIMVTASASDVVRIGLSPKEIAIIGLPVKNTTHIS
FT                   WARYGGLDEERSIHAEWLPPLSDYSHTPELYEFLLPTWTSPGFGVDTHIKPIYEFIQEG
FT                   WQPPNINYTEHTPEIAEFMSESWQPSPPSEAAYTGEGTGLAAFLR"
FT   sig_peptide     47213..47269
FT                   /locus_tag="Mthe_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.982 at
FT                   residue 19"
FT   gene            47742..48332
FT                   /locus_tag="Mthe_0052"
FT   CDS_pept        47742..48332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13854"
FT                   /db_xref="UniProtKB/TrEMBL:A0B580"
FT                   /protein_id="ABK13854.1"
FT                   /translation="MRKLIVARIVHSPEDMGSMREGLERMGVSRLGREKWEENRIRIER
FT                   FWDELEREIDRLELDPTRLRIYQDGLPAGGEIGERIIRETASKGSRNYQIIEKLMERGA
FT                   RIEATESPELLLREYQHIKAMVSTTGEEQRRALEAYNKEKDRLLDERDAYIARRIAETL
FT                   QDDETGLLFIGAHHNVVPRLPADVEVSYLGDPG"
FT   gene            complement(48431..49045)
FT                   /locus_tag="Mthe_0053"
FT   CDS_pept        complement(48431..49045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13855"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:A0B581"
FT                   /protein_id="ABK13855.1"
FT                   /translation="MSNGYEDRLEKIERRLDEIEKVLKSLTSEGAVKGGPEEKAVEEPS
FT                   IVSGIVSQFIPGLGGIIKALEASSPEFKRRIAETDAEVRHRIEVGWSSRPVVDYNISVR
FT                   PLSKPGARRPSARLPEVRIPGTPRKDPIVDVMDEGKSITVVAELPGVEEDELSVTVREG
FT                   VLEIRAGEFLKEVKLPPDAGDIISRSFKNGILQLRIDRVRS"
FT   gene            complement(49204..49476)
FT                   /locus_tag="Mthe_0054"
FT   CDS_pept        complement(49204..49476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13856"
FT                   /db_xref="UniProtKB/TrEMBL:A0B582"
FT                   /protein_id="ABK13856.1"
FT                   /translation="MTRRSRIMENRMIQHAKVTEHRMRLRDEILPYLRSRREEMACKAA
FT                   SHRLRIKRAWRDSLAKSTRHMLEVRRKHMSKVALHKKRLAEIRSR"
FT   gene            complement(49689..50306)
FT                   /locus_tag="Mthe_0055"
FT   CDS_pept        complement(49689..50306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0055"
FT                   /product="Gas vesicle synthesis GvpLGvpF"
FT                   /note="PFAM: Gas vesicle synthesis GvpLGvpF; KEGG:
FT                   mba:Mbar_A0332 GvpF"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13857"
FT                   /db_xref="GOA:A0B583"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:A0B583"
FT                   /protein_id="ABK13857.1"
FT                   /translation="MIRSEDADFGPIGFGNSEVHTIEYRDLYPVVSEAVLREYDVDERD
FT                   VEIHRRVVRRVMEEHDVLPVAYGMVFKGRKNLAVAMSAGYAAMKKAWPVVEGKVELGVK
FT                   VIRPKNANGQYDELKREIVECLSASSVDFKNLDLFSDRLLLNTAFLVERSRIDEFSKRV
FT                   SAVIEEHSDLRTSYSGPWPPYNFVDIHILGKGRKGFRQARIT"
FT   gene            complement(50355..50627)
FT                   /locus_tag="Mthe_0056"
FT   CDS_pept        complement(50355..50627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0056"
FT                   /product="Gas vesicle synthesis family protein"
FT                   /note="PFAM: Gas vesicle synthesis family protein; KEGG:
FT                   hal:VNG7028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13858"
FT                   /db_xref="GOA:A0B584"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:A0B584"
FT                   /protein_id="ABK13858.1"
FT                   /translation="MEKPNLKDMLRIARTSAEELLGKRFESISSISRTEDGWIVNVEVL
FT                   ERRAIPDTQDIIGRYEMSFDENGDITGYRRMELRHRGGLERIEEE"
FT   gene            complement(50640..51002)
FT                   /locus_tag="Mthe_0057"
FT   CDS_pept        complement(50640..51002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13859"
FT                   /db_xref="UniProtKB/TrEMBL:A0B585"
FT                   /protein_id="ABK13859.1"
FT                   /translation="MDRIGATIQDVRIARVGEIFSRRPKGLRINETEALIVRARTDDGR
FT                   IATRTFYLCLRPDGTTDLDTIASGRSRTRRRRLASFLKYYGLMNRERRCNLREAVKGWC
FT                   GRHVEAMRDCDLIFVP"
FT   gene            complement(50995..52050)
FT                   /locus_tag="Mthe_0058"
FT   CDS_pept        complement(50995..52050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0058"
FT                   /product="gas vesicle protein GvpN"
FT                   /note="KEGG: mba:Mbar_A0330 hypothetical protein; TIGRFAM:
FT                   gas vesicle protein GvpN; PFAM: ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13860"
FT                   /db_xref="GOA:A0B586"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013462"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B586"
FT                   /protein_id="ABK13860.1"
FT                   /translation="MRYVVTHPRRVRGESVHQTSWEKKLLLSKEREEIQVKVQSQTAAR
FT                   DPETLRKEIEEAFLMPEVEHFVETPEVRETEARMKLWLDAGYPVHLIGPTGCGKTSLAM
FT                   HVARQFGRPVVWINGDESITTADLIGGYSQIENESVRDKYIHNVFKSKDVMKVEWVDNP
FT                   LSLACKYGYTLIYNEFSRTKPAANNVFLSVFEEGVLELPTKFGEDRYIRVHPEFRAILT
FT                   SNSIEYAGIHRPQDALLDRMVGIYTDYYGYETELRIVMEHTGLEEDVARRVVEIVRYLR
FT                   DRLPDAQKPGTRACIMIGKGLKMLNRSSGIGLDQICIDVIANKTSSKKEMEEKRELVCE
FT                   AIAAVQEGSGG"
FT   gene            complement(52091..52990)
FT                   /locus_tag="Mthe_0059"
FT   CDS_pept        complement(52091..52990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB20 similar to myosin heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13861"
FT                   /db_xref="UniProtKB/TrEMBL:A0B587"
FT                   /protein_id="ABK13861.1"
FT                   /translation="MEETVEELVTKHTRRELEEMAVKLGIQSLGGTKAQLAESIVEARR
FT                   RAQPQIAESGTAEVQVKPEEQKGVPEKAAEVKPQVSPEVPPVVPGKGVRARQEAMRRKS
FT                   SELRSAGVAIREEGVSRMAKSVNALKKSIEGQVTENKKGIAKIRTGVRQMKLSINKTSD
FT                   ELRKSGERIREEGARELNEGLRRFRADLDSQIRKNRDAVSRMGSGAAEIRSAMDKMSVD
FT                   FRKSGDHIREEGARELNEGLRRFRADLDSQVRENRDAISRMNIAAKELHSRALALRDEM
FT                   QRYVDQDVNKYIRDFYYG"
FT   gene            complement(53028..53258)
FT                   /locus_tag="Mthe_0060"
FT   CDS_pept        complement(53028..53258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0060"
FT                   /product="gas vesicle protein GVPa"
FT                   /note="PFAM: gas vesicle protein GVPa; KEGG: hal:VNG6241G
FT                   gas vesicle synthesis protein GvpA"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13862"
FT                   /db_xref="GOA:A0B588"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:A0B588"
FT                   /protein_id="ABK13862.1"
FT                   /translation="MVTSTPDSSSLAEVLDRILDKGIVVDVWARVSLVGIEILTVEARV
FT                   VVASVDTFLHYSEEMAKIEQAAIAAAPGVPA"
FT   gene            complement(53270..53494)
FT                   /locus_tag="Mthe_0061"
FT   CDS_pept        complement(53270..53494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0061"
FT                   /product="gas vesicle protein GVPa"
FT                   /note="PFAM: gas vesicle protein GVPa; KEGG: hal:VNG6241G
FT                   gas vesicle synthesis protein GvpA"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13863"
FT                   /db_xref="GOA:A0B589"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:A0B589"
FT                   /protein_id="ABK13863.1"
FT                   /translation="MVTSTPDSSSLAEVLDRILDKGIVVDVWARVSLVGIEILTVEARV
FT                   VVASVDTFLHYSEEMAKIEQAAIAAAPSA"
FT   gene            complement(53506..53730)
FT                   /locus_tag="Mthe_0062"
FT   CDS_pept        complement(53506..53730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0062"
FT                   /product="gas vesicle protein GVPa"
FT                   /note="PFAM: gas vesicle protein GVPa; KEGG: hal:VNG6241G
FT                   gas vesicle synthesis protein GvpA"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13864"
FT                   /db_xref="GOA:A0B589"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:A0B589"
FT                   /protein_id="ABK13864.1"
FT                   /translation="MVTSTPDSSSLAEVLDRILDKGIVVDVWARVSLVGIEILTVEARV
FT                   VVASVDTFLHYSEEMAKIEQAAIAAAPSA"
FT   gene            complement(53742..53966)
FT                   /locus_tag="Mthe_0063"
FT   CDS_pept        complement(53742..53966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0063"
FT                   /product="gas vesicle protein GVPa"
FT                   /note="PFAM: gas vesicle protein GVPa; KEGG: hal:VNG6241G
FT                   gas vesicle synthesis protein GvpA"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13865"
FT                   /db_xref="GOA:A0B589"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:A0B589"
FT                   /protein_id="ABK13865.1"
FT                   /translation="MVTSTPDSSSLAEVLDRILDKGIVVDVWARVSLVGIEILTVEARV
FT                   VVASVDTFLHYSEEMAKIEQAAIAAAPSA"
FT   gene            54364..54723
FT                   /locus_tag="Mthe_0064"
FT   CDS_pept        54364..54723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0064"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   gme:Gmet_3211 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13866"
FT                   /db_xref="GOA:A0B592"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0B592"
FT                   /protein_id="ABK13866.1"
FT                   /translation="MKVLVVDDAPFILRALRDSLEARGFEIHEAQSGEEALSAYRDIRP
FT                   DVVLMDILMPGMNGISVTREIMNIDPSANIIVITAIGKPGLEKECMDAGAKGFILKPFR
FT                   MRDLLDLIDSLGKGR"
FT   gene            54727..55860
FT                   /locus_tag="Mthe_0065"
FT   CDS_pept        54727..55860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0065"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mbu:Mbur_0694 external sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   PAS fold-4 domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13867"
FT                   /db_xref="GOA:A0B593"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0B593"
FT                   /protein_id="ABK13867.1"
FT                   /translation="MRGIEIVRGYQEDIIETIPSTIIIVDRRLEVLYANRNFYLKSFRT
FT                   EKNAIGMHLSKIFSPVFMQRLNSRIEKVFSAGEPFDGEQIRYPGGRFYFYRIHPLKEAG
FT                   GYVSKAVIFIEDITEMTRLEEELRDSYIKLENAYAELKELDSIKSEFVSMVSHELRTPL
FT                   TVINSYIEMFEDGMLGDLTDVQKEKLQLIRSQTDTMIQLVNDMLDILRIGSRRLRLKKE
FT                   LSSMEELIRSVIASLSRLAALKEHTITFRCERANTLIECDPKKIMQVLSNLLTNAIKYT
FT                   PDRGQIEVVLGGDAENVLVSIRDNGIGIREEDKDRIFEKFFVMSNEKSADIGMGLGLSI
FT                   TKDIVEAHGGRIWFESRFGEGSTFYFTLPCGKDTERS"
FT   gene            55886..56485
FT                   /locus_tag="Mthe_0066"
FT   CDS_pept        55886..56485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pab:PAB1160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13868"
FT                   /db_xref="InterPro:IPR008553"
FT                   /db_xref="UniProtKB/TrEMBL:A0B594"
FT                   /protein_id="ABK13868.1"
FT                   /translation="MPLTEPVSTRISEELSRGSAYLVREKKPELSFQIFSSLVRGQCAS
FT                   CEHPDAFNCESIGCEKCTLKCPCKSCSQKRAQGLCFTTQHPEQIRNRYVLQTTPIFWIS
FT                   RRGESQTTVSNLEIMADITARFLEKSHNPVVLLDGLELLVVTNGFVQAIRFLRDIMEMV
FT                   FISRGILIVPVNPSALSEREMALIERDMQEIPARWS"
FT   gene            56694..57083
FT                   /locus_tag="Mthe_0067"
FT   CDS_pept        56694..57083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0067"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mba:Mbar_A0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13869"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B595"
FT                   /protein_id="ABK13869.1"
FT                   /translation="MSLASVGGALIGEINLEQDDREEVLSRFVKPNKDILILSILGERP
FT                   MCGYDLIKEIYRRYNVLLSQGAVYPILYSMVDDGILRSEYSRGNMRTKIYTLTPKGQEV
FT                   MRRKIGKMVYALEYMLSFLKGSCSE"
FT   gene            57080..57760
FT                   /locus_tag="Mthe_0068"
FT   CDS_pept        57080..57760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0068"
FT                   /product="RecA-superfamily ATPase, implicated in signal
FT                   transduction"
FT                   /note="KEGG: mbu:Mbur_0822 RecA-superfamily ATPases,
FT                   implicated in signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13870"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B596"
FT                   /protein_id="ABK13870.1"
FT                   /translation="MSIDGLDRILEADPPAGSVLLVTGGEGTLKSSLVLAMMSRYLEGS
FT                   AEHGLYASLEQTKDSHLRNMDSIGIRWHENLHIFDYRDMRIEWKDHRLDMFSMTKDVLD
FT                   MYIDRYRDLTIFAMDSLNALYALSSKTNLRRNVYDFLTMLRDRCLTSILILETGDDSGK
FT                   GGERFLSDGIIELGVIESYNGVKRYLQIRKMRGVRHLMEKHHLVVKPGGLEVVGPIYGQ
FT                   PSTS"
FT   gene            58024..58272
FT                   /locus_tag="Mthe_0069"
FT   CDS_pept        58024..58272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13871"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:A0B597"
FT                   /protein_id="ABK13871.1"
FT                   /translation="MFVIDDLLLRSIGISVPGLDLIWTLEQIRGYAQRELYNPERIRNQ
FT                   IKETRLLYEFGEMSHEDYLERTEQLMQRLRIAEQLQR"
FT   gene            58334..58714
FT                   /locus_tag="Mthe_0070"
FT   CDS_pept        58334..58714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0070"
FT                   /product="gas vesicle protein GVPa"
FT                   /note="PFAM: gas vesicle protein GVPa; KEGG: mba:Mbar_A0335
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13872"
FT                   /db_xref="GOA:A0B598"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:A0B598"
FT                   /protein_id="ABK13872.1"
FT                   /translation="MVLPEKDSDRGLAGAIDRILDKGLVINADITVSVAGVELLGIKVR
FT                   AALASFETAAKYGLEFPSGISCETGAWRDAMLEREECPQCGKKVLREELMHECCPWCGW
FT                   TSALARDRMLKMPFVLKDDYGT"
FT   gene            58704..59396
FT                   /locus_tag="Mthe_0071"
FT   CDS_pept        58704..59396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0071"
FT                   /product="gas vesicle protein GVPa"
FT                   /note="PFAM: gas vesicle protein GVPa; KEGG: mba:Mbar_A0339
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13873"
FT                   /db_xref="GOA:A0B599"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:A0B599"
FT                   /protein_id="ABK13873.1"
FT                   /translation="MEPERCTNAGLVDLLDRVLTKGVVLNADVIISVAGVPLLGLSLRA
FT                   VLAGMETMIKYGMWRDWDTAQRAWVAEQQRLKSFTTNFMLKGEEVRMRAFGTYWYSRGI
FT                   YQAWRPGDVCVTNRRIAVFRKDPPEIIFEAYYEDIEGFALEKGEIVAKRDTDILHIHLR
FT                   NGAVAKIHSAEIQALKDVAEREMRSLRSHLNGRPDGDAERRAPTNILSNVSTTNGYAER
FT                   QMECKMPR"
FT   gene            59420..59734
FT                   /locus_tag="Mthe_0072"
FT   CDS_pept        59420..59734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0072"
FT                   /product="Gas vesicle K"
FT                   /note="PFAM: Gas vesicle K; KEGG: mba:Mbar_A0337
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13874"
FT                   /db_xref="GOA:A0B5A0"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A0"
FT                   /protein_id="ABK13874.1"
FT                   /translation="MTLNIDESNLKHGILGLVIALVEVIRDALRIQALRRMESGTLTEE
FT                   EVNRLGEALMELDIALDEIKREQGITESVKAVRDGLDEIVDDVLDRMLNPERWDEHEGE
FT                   "
FT   gene            59721..60755
FT                   /locus_tag="Mthe_0073"
FT   CDS_pept        59721..60755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0073"
FT                   /product="Gas vesicle synthesis GvpLGvpF"
FT                   /note="PFAM: Gas vesicle synthesis GvpLGvpF; KEGG:
FT                   mba:Mbar_A0338 GvpL"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13875"
FT                   /db_xref="GOA:A0B5A1"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A1"
FT                   /protein_id="ABK13875.1"
FT                   /translation="MRESDLRDAIAEMVRAEVKAIGDELAPVISEVVRAELMPALRAAI
FT                   REAILRELSTYSGDADFREVSQGSVFSEPEKIKNVTAEAVAPETVPSNENGLYLYCIVD
FT                   ASVSTSLGHMGIDGCEVYTIPHEGVSAVVHSCPLEPYRSDDEETVKRWVKSHQEVVELA
FT                   AERFGTVMPFGFDTIIMPKEFCTAEEVLKKWISDELDEIRAKMERIQGKKEYGIQIFYD
FT                   PLVFTKRVEDESDDVRIIKEEMASKPPGIAYMYRQRLEAAVRRRMDELIGAYFKDFYER
FT                   IQSNADDIKVEKVRKSDGDMVMMMNLSVLASDEKALGQALDGIAAEPGISVQFTGPWQP
FT                   YSFV"
FT   gene            61464..61539
FT                   /locus_tag="Mthe_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            61464..61539
FT                   /locus_tag="Mthe_R0004"
FT                   /product="tRNA-Ala"
FT   gene            complement(61853..62692)
FT                   /locus_tag="Mthe_0074"
FT   CDS_pept        complement(61853..62692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA3149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13876"
FT                   /db_xref="GOA:A0B5A2"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A2"
FT                   /protein_id="ABK13876.1"
FT                   /translation="MTKRSEGVTYDFLLDLKRLTDAYRGFETRVSALEALAIAIAIYII
FT                   FIPLGLVAYFRFYWSGTLLEHAPVVVSFIFGVILSHIIRRRRRTSVFDLFEEELSEKLK
FT                   AAYDNRFHDSIVMRSLAQDLGHILSGISGRDIIDTSRLYKRVLLVFVMLALAVVVSTSI
FT                   SEEITPANLGVVGEIKDLAEDLLSPKQPVSEIRDNVSIYGKPSLAVLSETRLELELYPG
FT                   SGVGSRAKPTETSERLFREGPPGQGVAVPSEVYIESLPPKHREIIRRYFTLLNEVRS"
FT   gene            complement(62703..63122)
FT                   /locus_tag="Mthe_0075"
FT   CDS_pept        complement(62703..63122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13877"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A3"
FT                   /protein_id="ABK13877.1"
FT                   /translation="MKASALIALCILFVGLSSSFPVPVNYAAGQDPRFSESLFIVSGGS
FT                   ALSESYTSVERLERFTEVRTSYSGTPSPQQSMLEANIRSNVIGSAHIGWLSADSRGVYG
FT                   RSIEDLTGVFSIEKFIQLWNNSTAGEISVDWMPCI"
FT   sig_peptide     complement(63033..63122)
FT                   /locus_tag="Mthe_0075"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.753 at
FT                   residue 30"
FT   gene            complement(63154..63480)
FT                   /locus_tag="Mthe_0076"
FT   CDS_pept        complement(63154..63480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0076"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: mbu:Mbur_2035
FT                   PRC-barrel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13878"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A4"
FT                   /protein_id="ABK13878.1"
FT                   /translation="MDSYAFGEPLPSLHSGGFMKKVFASDLAGKEIVTVDGIVLGELEN
FT                   ITFNADTGELVDLVVKPDRNLSRVRYRADGKFVRIPFSAVCAIKDYIVVDEGKSILSRG
FT                   QGRD"
FT   gene            complement(63480..65699)
FT                   /locus_tag="Mthe_0077"
FT   CDS_pept        complement(63480..65699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0077"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: nph:NP3072A AAA-type ATPase (transitional
FT                   ATPase homolog); TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily; PFAM: AAA ATPase VAT domain protein domain
FT                   protein; AAA ATPase, central domain protein; cell division
FT                   protein 48, CDC48, domain 2; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13879"
FT                   /db_xref="GOA:A0B5A5"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A5"
FT                   /protein_id="ABK13879.1"
FT                   /translation="MWEVKELQLKVAKAYPNDSARGIARLDPSALLTLRLSPGDIIEIE
FT                   GKKITAAKVWRADRQDWIQDYIRIDGFIRQNAGVGISDRVKVRKARYSDAARIVLAPPA
FT                   GSHMQFGPDAVDMIKRQTLKRPVVAGDILPVMSTSGQAFLGRMEAIPLVVTATDPGGIV
FT                   VITDRTEILLMDKPARGVGSIKATGVTYESVGGLRAEVQRVREMIELPMKHPEVFRKLG
FT                   IDPPKGVLLYGPPGTGKTLIAKAVANESGASFFSIAGPEIMSKYYGESEQRLREIFEEA
FT                   NSNTPSIVFIDELDSIAPKRSEVTGEVERRVVAQLLAMMDGLKERGQLVVIGATNRIDA
FT                   IDPALRRPGRFDREIEIGVPDRDDRVEILQIHVRNMPLADDVNLEELANRTHGFVGADI
FT                   AALCKEAAMKALRRYLPDLGTEDDIPPEIVESMKVTRDDFEMALKEIEPSAMREVLVEL
FT                   PKVSWDSVGGLGQIKQELIEAIEWPLKRPERFEHMGIKPPKGILLYGPPGTGKTLIAQA
FT                   VANETNANFISVRGPQLLSKWVGESERAIREIFRKAKQVSPTIIFFDELDAIAPMRGMD
FT                   EGARVTERVVNQLLAEMDGLEDLKNVIVIGATNRPDMIDPALLRSGRFDRLIMIGPPDR
FT                   DGRLEILRIHASRIPNSEDVNLEELAELTDGYVGADLGALCREAVLLALRENENAEIVE
FT                   MKHYLEALKRVRPSVEESMISYYERISERFRGGGRVESSSLIGYR"
FT   gene            complement(65888..67762)
FT                   /locus_tag="Mthe_0078"
FT   CDS_pept        complement(65888..67762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0078"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; Porphyromonas-type peptidyl-arginine
FT                   deiminase; KEGG: mhu:Mhun_0034 porphyromonas-type
FT                   peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13880"
FT                   /db_xref="GOA:A0B5A6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A6"
FT                   /protein_id="ABK13880.1"
FT                   /translation="MVRVGLVQTRVTEDLNFNLARALDLVEDAANRGAEIVCLPELYRT
FT                   SYFPREKNAKVQQYAETIPGESTAAFSRLAARMNVVVIVPLFERYGSVYYNSAAVIDAD
FT                   GSIAGVYRKSHIPCDPMFYEKMYFFQGDGFRVFRTRHACLAVLICYDQWFPEAARSVVL
FT                   DGADIIFYPTAIGRVRGVEQAEGDWQTAWETVQRGHAIANGVHVAAVNRVGVEGEIAFW
FT                   GGSFVCDSFGNLLAHAGSDEEVLLADLDLSKNLMVREGWGFIKNRRPDAYRVLVRDIER
FT                   RLLTPSSEGYHMPAEWERHDGVWLAWPHDTDTFNDIDSVERAYVSMIKALHVGETVNLL
FT                   VRDEEMRERVEHLLQRDVRMSSLRIHTIDYADVWFRDYGPTFVVNKKEKRLGMVAWNFN
FT                   AWGGKYCELMGDVKIPCYIARDLGVRCFRPGIVLEGGSIDVNGSGTLMTTEQCLLNPNR
FT                   NPLMSRWDMEFYLREYLGVRKIIWLRRGIAGDDTDGHVDDVARFVSPRRVVLAFEEDKD
FT                   DENHEPLRENYEILKHETDQDGNPLEVIRLPMPGYVGDEERLPASYANFYIGNRAVLVP
FT                   VFGHRNDARALSIIGALFPDREVVGIDALAMVYGLGTIHCVTQQQPAV"
FT   gene            complement(67781..68416)
FT                   /locus_tag="Mthe_0079"
FT   CDS_pept        complement(67781..68416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0079"
FT                   /product="SSU ribosomal protein S3AE"
FT                   /note="PFAM: ribosomal protein S3Ae; KEGG: mbu:Mbur_2336
FT                   ribosomal protein S3Ae"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13881"
FT                   /db_xref="GOA:A0B5A7"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR030838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5A7"
FT                   /protein_id="ABK13881.1"
FT                   /translation="MARRAQRKAERAKVKQWYKVLAPEMFGRTPVGETLANDPNKLLGR
FT                   VIETTLGDLTNNFSKQNTKLRFKIDAVAGDTAYTKFIGHEMTTDYIRSLVKRRTSRIDA
FT                   VVDVTTSDGYLVRVKPSCFTVKRARANQVKAIREISRQVIISRAGNIDLNGLIQEVVLG
FT                   KLSLDIYKDAKAVYPLRRVEIRKTEILAGPGEVPHPAAVPEPTVTAGS"
FT   gene            complement(68755..69627)
FT                   /locus_tag="Mthe_0080"
FT   CDS_pept        complement(68755..69627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0080"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: mhu:Mhun_2050 ATP phosphoribosyltransferase;
FT                   TIGRFAM: ATP phosphoribosyltransferase; PFAM: Histidine
FT                   biosynthesis HisG, C-terminal domain; ATP
FT                   phosphoribosyltransferase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13882"
FT                   /db_xref="GOA:A0B5A8"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A8"
FT                   /protein_id="ABK13882.1"
FT                   /translation="MIDIAIPKGSLLNQTLELFERAGLEVRRTEREYNARINDPRIGKV
FT                   KILRPQEIPTYVSRGYFDLGISGTDWIVESGADVVTVANLNYGKQGPGVVKIVVAVPES
FT                   MQITSSREIPPGSRVATEYPNITRSYFERLGIPVEVQFSYGATEAKVPELTDVVVDLTE
FT                   TGSTLIKNGLKIIDVILESTSELIANQQSWSDPSKREEIEAVETLLSAVIRARGKALLK
FT                   MNVSESNIEQVISILPSMKHPTISKLYNSGYYAIESVVDKKDINLLIPKLKKAGASDIL
FT                   EIDISKIVP"
FT   gene            70157..70969
FT                   /locus_tag="Mthe_0081"
FT   CDS_pept        70157..70969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13883"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5A9"
FT                   /protein_id="ABK13883.1"
FT                   /translation="MRLMIAITLLLALAADGLADYTLNDTLMFSMEQSINGHGYFSGYK
FT                   YAKLDGELGDDALEIRGRYHGSGSIDLEGTFEAMNCTDQSGVDVSFDPESTEIHRSISM
FT                   RDSGDLSYSPEVLTVGRGFYLSKPIRYSSMIAEADLLKNRASGTSMSHVTDYAHALSKD
FT                   IELFVMAEALEEDPSTCTMNVSEKISSGRVHIGALQLPTNRSGPGLAAPLMEIDEYYIG
FT                   DFQIQKGLSVSVEEEEEEEEEDWLQCCTWNQHRLIDEIFSCTSCTQNL"
FT   gene            complement(71407..73314)
FT                   /locus_tag="Mthe_0082"
FT   CDS_pept        complement(71407..73314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0082"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KH, type 1,
FT                   domain protein; RNA-metabolising metallo-beta-lactamase;
FT                   SMART: KH domain protein; KEGG: mma:MM0695 cleavage and
FT                   polyadenylation specificity factor 100 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13884"
FT                   /db_xref="GOA:A0B5B0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR033769"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5B0"
FT                   /protein_id="ABK13884.1"
FT                   /translation="MSVEEVLSELRRRIQSRLPPDINVTGLEFEGPELVIYTDDPRRLA
FT                   DDGEIIRSLAKDLRKRVVVRPDLKVLMDPEEAIKKIQEVVPKEAVLTNYHFDGETGEVI
FT                   IEAEKPGLVIGRHGATLREITKLIGWTPKVVRTPPVRSSTIANIKDYLRSVQTERKSIL
FT                   RSIGRKIHRDIASKDQWVRISTLGGCREVGRSCMLLSTPESKIIVDCGINVGSDDSATP
FT                   YLYVPEVYPLSQIDAVVLTHAHLDHSGLVPMLYKYGYEGPIYCTPPTRDLYVLLQLDYI
FT                   EVAGREGKRLPYDSSMIREALKHTITLNYGDVTDIAPDTKLTMHNAGHILGSAIAHFHI
FT                   GDGLYNVAFTGDFKYEKTRLFDPAVNSFPRLETLVIEATYGGANSIQPSRKEAENHLLR
FT                   VVRETIKRGGKVVIPAFAVGRSQEVMVVLEEAIRKGLIGEFPVYLDGMIYEATAIHTSY
FT                   PEYLNNELRDMIFHKGINPFLAECFVQVENSKQRDEIINGEPAVILATSGMLNGGPIME
FT                   YLKGLGPDEKNTLVIVGYQAEGTLGRRIQKGWKEIPLTVEGKTQTVKMNMEVVTVDGFS
FT                   GHSDRNQLMEYVRRVYPKPSRIITNHGDESNCLDLASSIYKKYRIPTSAPMNLETIRLI
FT                   "
FT   gene            complement(73335..73958)
FT                   /locus_tag="Mthe_0083"
FT   CDS_pept        complement(73335..73958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0083"
FT                   /product="proteasome endopeptidase complex, beta component,
FT                   Threonine peptidase, MEROPS family T01A"
FT                   /EC_number="3.4.25.1"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   mbu:Mbur_0374 proteasome endopeptidase complex"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13885"
FT                   /db_xref="GOA:A0B5B1"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5B1"
FT                   /protein_id="ABK13885.1"
FT                   /translation="MVEAFKGTTTVGIVCDGGVVLASESRATMGSFIASRTAKKIYQID
FT                   DLVGLTTAGVVGDAQALVRMIQAEARLYRMQRGEPLTIKAITSLLSNILSARRYFPFLV
FT                   QLVVGGVDKMGPKIFSLDALGGQIEEHDIVSTGSGSPIAYGVLESLYKPGLSIQDGSVL
FT                   CVRAVHTAMKRDSASGNGIALVRITKDRYEEVPTSEVEEIVRSL"
FT   gene            74262..75470
FT                   /locus_tag="Mthe_0084"
FT   CDS_pept        74262..75470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0084"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: mhu:Mhun_2504 ammonium
FT                   transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13886"
FT                   /db_xref="GOA:A0B5B2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5B2"
FT                   /protein_id="ABK13886.1"
FT                   /translation="MAIDTGDTAWIMISAALVMLMTPGVGLFYGGLVRSKSVISMISLS
FT                   ILAISLASIQWVLIGYSISFGHDMMGLIGGLDFIFMRNVGMNEAPLAESVPHLAYMMFQ
FT                   LVFAAVTLAILTSAVAERIKLSSFIVLSILWTTLVYDPLAHWVWAGGWLASLGALDFAG
FT                   GTVVHISSGFSALAIALVIGKRVGFDSYVLEPHNIPMAMIGAALLWFGWFGFNAGSALT
FT                   AGGLAASAFVVTNTSAAAGALAWLLGSWLRGKPSALGMVSGAIAGLVAITPAAGYVDAM
FT                   SALLIGAFAGLICYSALLFRVSIGLDESLDAWAVHGVGGLWGALATGIFANPAVNTYTG
FT                   LIYGNTGQFTAQVVAVLASVAYAFVISYVLARLVDATIGLRVTEDEEYVGLDIAVHGEK
FT                   AYA"
FT   gene            75480..75818
FT                   /locus_tag="Mthe_0085"
FT   CDS_pept        75480..75818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0085"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   afu:AF0978 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13887"
FT                   /db_xref="GOA:A0B5B3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5B3"
FT                   /protein_id="ABK13887.1"
FT                   /translation="MMKIEAIIREERLGHVKRALEEKGFVAMTVTRVLGRGEQKGIRLQ
FT                   YRGGSIEVDMLPKLKIEMFVRDEDVETVMRTVCDSARTGRFGDGRIFVMPVTISGKVRT
FT                   GEVEGKLP"
FT   gene            76187..78097
FT                   /locus_tag="Mthe_0086"
FT   CDS_pept        76187..78097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0086"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; acetyl-CoA
FT                   hydrolase/transferase; KEGG: syn:slr1888 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13888"
FT                   /db_xref="GOA:A0B5B4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5B4"
FT                   /protein_id="ABK13888.1"
FT                   /translation="MPSSFAEWGIPMMGLEEMRSRWPEKFAPERTIFRNIHPGDRIFIG
FT                   TGCAEPQHLVRSLVDYVSRYPTAFFDAEVIHVSTLGVAPYTDEKFKLNFRLDSFFIGES
FT                   TRDPINRADADYTPIFLSALPELFRNGSINIDLALIQATPPNESGDMSLGISVDIIKAV
FT                   IENASRVVVQVNPQMPYVYGDTLINIDSVDYVVYHEEPLLEYVESAPTELAQQIGKYVA
FT                   RIVEDGATIQVGYGSIPNAVLSNLHDKKHLGVHTELLTDGIVELMKSGAVDNSMKTLDA
FT                   GKTVATFCMASRETYRYLDGNPDVEFKQIDYTNNPLIIAKQRNMVAINSALEIDLTGQA
FT                   TAESLGGTLYSGIGGQADFMRGAAMAPGGKTVLALPSTARDGSVSRIVPCLRSCAGVTL
FT                   TRGDVRYVVTEYGIAYLHGRNLRERAMALIAVAHPKFRAWLIEEAKRMNILYRDQVVLP
FT                   GWQGIYPEHLEVQRTTKTGLEILMRPVRINDEPLLKDFFYSLSDESRYQRFISMRREIP
FT                   RDLLQKLTMIDYTNRMVILATLPGKERDVVIGIGQYEVNKDKYTADIALAVRDDYQNQG
FT                   VGSELLSYLTQLARKNGLLGFTAEVLAENNRVFRLFEKMGFEAEKVNDAGIYYMKLRFR
FT                   T"
FT   gene            complement(78173..79273)
FT                   /locus_tag="Mthe_0087"
FT   CDS_pept        complement(78173..79273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0087"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mba:Mbar_A2604 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13889"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5B5"
FT                   /protein_id="ABK13889.1"
FT                   /translation="MVSIAALLQKAEEKYLDGSYDEAIEYYDRVLDIDPMNTAAWCGRG
FT                   MACFCFSRYEDALECYSRAIEADPECVPAWECRAEVLFILGRCDEAISSYQEAIDRDPA
FT                   YALAWIERCIDSRPDDAESWRQKGLALLSMGRYEEAIEAYRMALDIDPSQARDWCILGE
FT                   SLQTIGRHSEALECFERALELSPSDSACWIRMGESMHSTGRYDEALECYEEALRLDPGS
FT                   VQAWHGKGITYRAMGIPSKAIDAIDSALTLDPEHAQSWYAKGITFRAMGLYEDALECFD
FT                   RVLRIDPGNASALKSRAWSLYNLGRYAEALSACEGAISVNPLDEDAWYNMGIVLKALGR
FT                   YTESDMAFIKAREIRVVKLSKNRMRG"
FT   gene            80258..80890
FT                   /locus_tag="Mthe_0088"
FT   CDS_pept        80258..80890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13890"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5B6"
FT                   /protein_id="ABK13890.1"
FT                   /translation="MDHRWKAWSAALCVMLVGAAWAADYVFNGALNLGTGYRDTELLGQ
FT                   TAAGAEGQKFAEKIMGSGRFRERSAFELDVIRNTINFTQDAEFEYFPVSYGGGAYNRKW
FT                   SNKICVINYDAGSALTEVYTASELIHRSTEIRTTGAAGNESLQAGMEATFIGNGRIAWT
FT                   TRQRNDKRTLELSRSVEELTGVFSVKKYVDLSNRSGRVSRVDWIPCA"
FT   sig_peptide     80258..80326
FT                   /locus_tag="Mthe_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(81214..81831)
FT                   /locus_tag="Mthe_0089"
FT   CDS_pept        complement(81214..81831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0089"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: mac:MA0919
FT                   orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13891"
FT                   /db_xref="GOA:A0B5B7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR022854"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5B7"
FT                   /protein_id="ABK13891.1"
FT                   /translation="MIMKSIEDLIKKATELKSEGLSEGQISEELNVSRETITWLLTHAE
FT                   RATVPGPKDISVDWSMIGRSAYRLSHIAQALTEMIFDILDEKELDIDIVVGVALSGVPL
FT                   ASMVADHMGVGLAVYMPTKQMASQDVKPHGNLSTNFSDVSGRECVIVDDVITSGRTLEE
FT                   AVAYLDDRGAKTNVIAVLIDKKGIDSIAGVPVCSLLKVIRVN"
FT   gene            complement(81828..82277)
FT                   /locus_tag="Mthe_0090"
FT   CDS_pept        complement(81828..82277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A3470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13892"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5B8"
FT                   /protein_id="ABK13892.1"
FT                   /translation="MYIVADASVFILGKPLKGEVITVPAVEQELKDIRSRIKLQISDVR
FT                   IEPPTKETLKRATEAARDTGDLCRLSQTDLEVLAKAIEYDAAIATDDYALQNVAVHLGL
FT                   RVEPVVQRGIRRFIKRTQRCPGCGRAFEGDLCPVCGTPPKRRKKV"
FT   gene            82941..83873
FT                   /locus_tag="Mthe_0091"
FT   CDS_pept        82941..83873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0091"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   mba:Mbar_A2563 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13893"
FT                   /db_xref="GOA:A0B5B9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5B9"
FT                   /protein_id="ABK13893.1"
FT                   /translation="MIPDWMKSVSLAHEKFAPPPPARKDFVKKTIDGIIAFFQEAMTTE
FT                   EISSRRGLLQSLDPRIKLISMLSLIFAISMTKNLEIIALFYLMTLIFAYLSSISIVFFV
FT                   KRVWLFIPIFTGVIAIPMTLNIFLPGDVLIPLVDLGQRAHIGPFAMPESIYITSQGTRA
FT                   AVLFTIRVAACVSAVVLLFLTTPQRALFKSLRSIGVPKVYVLTLEMANRYIFLFMEMVR
FT                   DLYIAKRSRTIKSRGTLAEQRWVGGRIGYMLIKALDMSEKVHMAMISRGFSGDVKLSYE
FT                   FAMRGRDYIALGVSMVICILLLTQGIVNA"
FT   gene            83870..84718
FT                   /locus_tag="Mthe_0092"
FT   CDS_pept        83870..84718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0092"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mba:Mbar_A2562 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13894"
FT                   /db_xref="GOA:A0B5C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5C0"
FT                   /protein_id="ABK13894.1"
FT                   /translation="MRWSEMNVIFDLRNVSYIYNGRLKALEDINLRISQGEQVALLGAN
FT                   GSGKSTLLAIIDALIYPTSGQYYAFGTHVNEEIFGTLKDNEFKRFFRSKVGFVFQNPDV
FT                   QLFSSTVFDEIAFGPHQLDMPMEEVGRRVEELMEMLGISKLRNRAPHTLSGGEKKKVCI
FT                   ASVLATNPDVLLLDEPTAGLDPRSQLWLIELLNELASCGKTIITATHDLDIIDKISRRA
FT                   IVIGENHRVVVDRGVDDVLNDIDLLLETNLIHEHMHRHGRLIHRHPHAHRDEHAHSHIH
FT                   E"
FT   gene            85407..86447
FT                   /locus_tag="Mthe_0093"
FT   CDS_pept        85407..86447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0093"
FT                   /product="TGS domain protein"
FT                   /note="PFAM: TGS domain protein; KEGG: mja:MJ1326
FT                   GTP-binding protein, member of GTP1/OBG-family"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13895"
FT                   /db_xref="GOA:A0B5C1"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5C1"
FT                   /protein_id="ABK13895.1"
FT                   /translation="MSIEEEIRALEEEILRTQKNKATEHHIGRLKAKIARLREEQEKRT
FT                   ASRAKKGKGVRKSGDATVTLVGPVGAGKSTLVSRLTGARTSEDPYSMEITPGILQHRGA
FT                   KIQILDVPDITVSGDALSAVRDSDLVLLVTEPYGGQLDPYLNRLYQSGVRLNQNPPSVL
FT                   IRKTSRGGISVTSTVDPGIDKGSIEAILREYKIHSADVLIRERLTQERFIDALEANRRY
FT                   IKAIHVMNKVDILDPDELEFDGDVIPTSAVDGTGLERLKDEIFERLDLIRIFMKPQGKP
FT                   PDLDEPMIMRRGANIGDLCDRIHKDFRQRFRYATVWGSSAKHNGQRAGLDHILSDGDIV
FT                   TIVLEK"
FT   gene            86633..87010
FT                   /locus_tag="Mthe_0094"
FT   CDS_pept        86633..87010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0094"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mac:MA3736 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13896"
FT                   /db_xref="GOA:A0B5C2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5C2"
FT                   /protein_id="ABK13896.1"
FT                   /translation="MCGCGDRHGEIMRSLGDKMGGYVPETLKAIYDHRPELMELIERLD
FT                   RVLLEDGALDKKTKRLIALACVITRMCEDCVYPQAKVAVNYGATKDEILETLEICMITG
FT                   GVPTFSIAKNGISRLFKEMEE"
FT   gene            complement(87152..87955)
FT                   /locus_tag="Mthe_0095"
FT   CDS_pept        complement(87152..87955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0095"
FT                   /product="Protein of unknown function DUF516"
FT                   /note="PFAM: Protein of unknown function DUF516; KEGG:
FT                   mbu:Mbur_1941 protein of unknown function DUF516"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13897"
FT                   /db_xref="GOA:A0B5C3"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5C3"
FT                   /protein_id="ABK13897.1"
FT                   /translation="MSEVVIICSSSDPASSNIASRLLELAEWDEEGTLRFHRSYCMLCI
FT                   EGELVGLRNLEDMLDRIGLSPRLIIFASRHISKEAVPWLGGHFTGVVREGSFELSRPAP
FT                   YALKKLLMALQRHAPSTFRLSAEATHHGPVDLRTPSLFAEIGSCEQHWIDPAAGAAVAR
FT                   AILELESYEAHADETVLLGIGGGHYVQRQTELILSRPVAFGHMFSKYQASMLNVEAIKK
FT                   AADLSGASGVYLDGKSFRSDERRRLEEIAASLDLNVMGIKEVRSL"
FT   gene            complement(87952..88998)
FT                   /locus_tag="Mthe_0096"
FT   CDS_pept        complement(87952..88998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0096"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13898"
FT                   /db_xref="GOA:A0B5C4"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5C4"
FT                   /protein_id="ABK13898.1"
FT                   /translation="MYFHQMEIKLTSKEKLVLYGLARYPGLSDIDLASLIDVDRSTIFK
FT                   SKRKFRDWQLIRLLNVPAGGALGAEILSVVFMRFSPGVGGRESISEWILSPSCVYCIAT
FT                   ATDAFSLVYSRNLTEFKKRAESILSGYRQNGVLEDFICVHLCVELASYQYNVPAAVSKI
FT                   FGLDRRDVAPAPLSLMPMDALKLSEKDRLTLYAFVKYPNLSDLELSKRTGISRPTISGK
FT                   RSRFFDANILLREAHVEWERICCELMCLYHIRMRQNVSYHDAGSLLSMMGSQLFCYMQP
FT                   GDVCGAILSSSFSDLKDGMDAFVNSAFERDLIDGRPYMVIMPLRSLKVLKLDYAPAVAE
FT                   MLGIEKEI"
FT   gene            complement(89794..90270)
FT                   /locus_tag="Mthe_0097"
FT   CDS_pept        complement(89794..90270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13899"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5C5"
FT                   /protein_id="ABK13899.1"
FT                   /translation="MMINLRVWLKIPDAEAATVKNTLLRRMGYQGIVRDVMRERLLSIE
FT                   VDEVSDPETLIKQLTRELVNENKESFAVSVNSLELSNGCVPVKVSLWIEDGEAISIRDR
FT                   LVKRLGLKMVRSVQRANIWKLYIDGDDPESVARRIAEELLVNPNKDRYEIIKLN"
FT   gene            complement(90267..91055)
FT                   /locus_tag="Mthe_0098"
FT   CDS_pept        complement(90267..91055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0098"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: lpp:lpp1648 phosphoribosylformylglycinamidine
FT                   synthase I (FGAM synthase I)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13900"
FT                   /db_xref="GOA:A0B5C6"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5C6"
FT                   /protein_id="ABK13900.1"
FT                   /translation="MRIAVIQFPGTNCEHETLVAVRECGMDGEIFRWNRPEQELCEFDG
FT                   YVIPGGFSYQDRVRAGVIASKEPVMATLREEAANGKPIIGICNGFQILVESGILPFGDG
FT                   VRLALAQNVMIRGGEIVRRGYYCAWTMLRHDAEEKRCSGSYILRRGEILSIPIAHAEGN
FT                   LVASDRKVIERLIEDDQIVFRYCSPQGEIINEFPVNVNGSTENIAGISNPEGNVLGMMP
FT                   HPERAFFAWQLPRKHPRIPGYGPGRKIFDSMKRYIEERRS"
FT   gene            complement(91052..93358)
FT                   /locus_tag="Mthe_0099"
FT   CDS_pept        complement(91052..93358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0099"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: lpf:lpl1643 phosphoribosylformylglycinamidine
FT                   synthase II (FGAM synthase II); TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13901"
FT                   /db_xref="GOA:A0B5C7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5C7"
FT                   /protein_id="ABK13901.1"
FT                   /translation="MKVIGLADSELESSLRKAGIGMSASEARSIASILGRDPTLAELFC
FT                   YDAMWSEHCSYKSSRAVLREFLPTEGPNVVLGPVEDAGIVSIDDEWCVVISHESHNHPS
FT                   QILPNEGAATGIGGIVRDVNCMGARVVATADPLRFGDPYGRESSRVRWVAEGVVDGIWQ
FT                   YGNALGVPVIAGDVVFSRCFDYNCLVNVVAIGVVRRDEIIRSRAPPGSGEKGYDVILIG
FT                   KPTDSSGLGGVIFASDTLREEEEEANRGAVQIPDPFLKNVLFKANEDLFRLVREKGVEI
FT                   GFKDLGGGGLTCASSEMGAAGGYGMEIDLDRLHVAGEFPPEVLCIAETQERFLIIAPRE
FT                   LRERILKIYNEDWDLPNVYEGARASVIGRVTTHDRYIVRHRGEEVVNVPIKHLTGGIRY
FT                   ERVWRPRIRNLVEPDVRMPEDLNRVMLDMLASPNIASREHIYRYYDTEVQGNTVIRPGE
FT                   ADAGLLAPIRERDFGIALSVDSNPFYGRISPYWGGATAVAEAMRNVAAIGATPSTLTDC
FT                   LNFGNPEKPEAFWEFRESVRGLADAARNLWLKGHPNQPVPIVSGNVSFYNESPEGAVDP
FT                   SPVIACVGIMRDISRAITMSLKEAGDGLYLLGPRFDELGGSEYYRLIWGVTGANVPVVR
FT                   FPLERSMIYTVIDAVDREILRAAHDISNGGMAITAAEMCMLSDHGISIDISDLGDMRSD
FT                   KLLFSESSGFVVEVADGAEQEFVSIARSYDLNPVRLGSVSTGDIEMARDGKMLVRLDPE
FT                   EAREAWSSGLREAMR"
FT   gene            complement(93645..94058)
FT                   /locus_tag="Mthe_0100"
FT   CDS_pept        complement(93645..94058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13902"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5C8"
FT                   /protein_id="ABK13902.1"
FT                   /translation="MRAIIALTVALLMLIPVMGVDVSYLSPESEIVTTESIAAFLNDSW
FT                   APSTFTPINDTAVWPDKNQTLANSTANIYSVLKGDWVPSSFVPPVDYATWPDKDGQLQA
FT                   SGYAIYDFLRNDWTPQDPVPIVQTGLYKLHQMN"
FT   gene            complement(94211..95236)
FT                   /locus_tag="Mthe_0101"
FT   CDS_pept        complement(94211..95236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0101"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   cysteine-rich small domain; KEGG: sth:STH2458
FT                   glycerophosphodiester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13903"
FT                   /db_xref="GOA:A0B5C9"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5C9"
FT                   /protein_id="ABK13903.1"
FT                   /translation="MEYTWLHHTRSMVSLIGHRGAPALAPENTLQGIRKAHSCGADMVE
FT                   MDVRLSSDGVLVLMHDETVDRTTNGSGRVEDLSIGELRGLDAGGEPVPTLKEALRLAEV
FT                   LGIQPIVEMKEEGLEELLLEELVGLNAVVTSFYHRSVLELSELLREKKGAEGIKTGIII
FT                   SSLPVNPVDLALDAHADAIFPKRVSPNIFKIAHKSGLKVYPWTVNTPERAAWLLRLGAD
FT                   GIVTDDPCAIRDVLKAPPRNTGQENCEYYPCHHFEGQDCTHCFCPLYPCKDPELGRFVR
FT                   TKRGKRFWSCIDCVLVHIPEVARYLEANPDAGTEELKNFLGTTGRGCFRRADRAGKGTG
FT                   S"
FT   gene            95322..96509
FT                   /locus_tag="Mthe_0102"
FT   CDS_pept        95322..96509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0102"
FT                   /product="Sep-tRNA:Cys-tRNA synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: Sep-tRNA; PFAM: aminotransferase, class V;
FT                   Soluble liver antigen/liver pancreas antigen; KEGG:
FT                   mba:Mbar_A1638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13904"
FT                   /db_xref="GOA:A0B5D0"
FT                   /db_xref="InterPro:IPR008829"
FT                   /db_xref="InterPro:IPR013375"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5D0"
FT                   /protein_id="ABK13904.1"
FT                   /translation="MQMSTILMPSSITSKLDKFRCMKRSISEINLDPLQRGGILTPEAR
FT                   AALVEWGDGYSVCDFCEGMLDRVRNPPVEEFVHEILPRFLDVDDVRITHGAREGMYAAM
FT                   HSLCDAGDYIVADGNAHYTTVLAAERAGLEISYVENSGEPEYTINPEGYREAIRDAADQ
FT                   GYRVSMAVLTYPDGNYGNLVDARRVAEICHEEGVPLLLNGAYSIGRMPVSARELDADIV
FT                   VGSGHKSMASSGPIGVLGAKQEYADIIFRRSKSKKNKEVELLGCTVRGAGLLTMMASFP
FT                   HVLERVGRWQEEVDKARWFSSELEELGIEQQGEKPHNHDLMFFKSERLYEISKSARKGR
FT                   YFLYHELKDRGICGIKPGLTRQFKLSTYLIPREDLERVVSAFHEIIEMGSRVEAE"
FT   gene            complement(96524..96790)
FT                   /locus_tag="Mthe_0103"
FT   CDS_pept        complement(96524..96790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13905"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D1"
FT                   /protein_id="ABK13905.1"
FT                   /translation="MGESGSRVAGRALMHLKAIECAHGLTITNKSEIVSEIASRVSDER
FT                   SVLTICTSLNTWVAMNRTGGSIFIPREVLEPLIELAEIRERCA"
FT   gene            96919..97308
FT                   /locus_tag="Mthe_0104"
FT   CDS_pept        96919..97308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0104"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: mac:MA3631 putative sirohydrochlorin
FT                   cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13906"
FT                   /db_xref="GOA:A0B5D2"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D2"
FT                   /protein_id="ABK13906.1"
FT                   /translation="MEDIGLLVLGHGSTLPYNKALVEELAGMIKRKHPGPVRTAYLNAN
FT                   DPKIPEGLMSFAGTNVRKIVAIPLFLAAGVHTLEDIPRELGIPKGKHVGVIKIDGRDVE
FT                   VTCAEPLGVDECIADLAYRRARESF"
FT   gene            97314..98522
FT                   /locus_tag="Mthe_0105"
FT   CDS_pept        97314..98522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0105"
FT                   /product="Mur ligase, middle domain protein"
FT                   /note="PFAM: Mur ligase, middle domain protein; KEGG:
FT                   mbu:Mbur_1036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13907"
FT                   /db_xref="GOA:A0B5D3"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D3"
FT                   /protein_id="ABK13907.1"
FT                   /translation="MAVLDSIHGAGIIASRLRELGIDAEALEVYHSNHSVERFSLVVAP
FT                   VHLSPQNSSLSEARRLRKRIISHHRAVGMILGERDFRAVEITGTRGKTTTALLLALMLS
FT                   HDMRVVSHTTSGIELWNRGRRSLIRSGLSITPGNLIAAHQIASEERADFLISEVSLGGT
FT                   GAFDVGIITSLAGDYLIAGGSMWASTAKLQMLSLSDPDARIVANTDAKLSADITFGHGG
FT                   DVRICRRSAEIRGRSLPLSLDEALDLPAYSDGIAGALAAAISIGVNVKDAADALEGFQG
FT                   FEGRMARYQLDGVSVTDNSNSGLKVSGIERALDLASGGRTCLVAGEDAESVCEGLDIDA
FT                   LLKMIKSRRNEIDELVLVGRRLEPYAQQLGGCTARNFQEGLEVARRLVSAGDHLVLCVK
FT                   CFR"
FT   gene            98528..99637
FT                   /locus_tag="Mthe_0106"
FT   CDS_pept        98528..99637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13908"
FT                   /db_xref="GOA:A0B5D4"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR017675"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D4"
FT                   /protein_id="ABK13908.1"
FT                   /translation="MSTEVQVIHPRPSSIVAALYTLRDLGVDVIILHGPSGCCFKHARL
FT                   LEEDGVRVLTTGLDEKGFVFGGQEQLVRLLRRAVELFHPKIIAVAGTCSSMIIGEDLHK
FT                   AVVEANIGVPVIEAEVHAGYRDNTKGVIITLEAARDAGIIDDQELNRQKKLLEKATEIE
FT                   RLYGAASSEYLPPERGDVKFVVASRLLDLLMEGKRGLNILNAKKETAYMFADINLSLIE
FT                   VARALGCEEKIRTLANLDSVVGLPKVRRDAGNIAGALMERGMNFEITGGLDEYPVSGER
FT                   IADMIEGEAYDFAVISGVPHAIPIDALGGMELFSITNGPRQVRPLRDMGHHHVVVEIDL
FT                   HPKTMGVSTIVESEFGATLREIARRRGVL"
FT   gene            complement(99818..100117)
FT                   /locus_tag="Mthe_0107"
FT   CDS_pept        complement(99818..100117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13909"
FT                   /db_xref="InterPro:IPR014931"
FT                   /db_xref="InterPro:IPR036493"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D5"
FT                   /protein_id="ABK13909.1"
FT                   /translation="MIHEIVQLSRKVADGYVISLGSLKLVCAVTDRGMVGCGAYDVSAL
FT                   DRHGYPAARVRSSTGGLIATVDDLLRGEVFEANSAARKLGIKEGMSGREALEHL"
FT   gene            complement(100270..101157)
FT                   /locus_tag="Mthe_0108"
FT   CDS_pept        complement(100270..101157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0108"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_2156 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13910"
FT                   /db_xref="GOA:A0B5D6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D6"
FT                   /protein_id="ABK13910.1"
FT                   /translation="MRYIFGPVLSRRLGLSMGVDLLPLKTCSMDCCYCEIGATTCLTMR
FT                   RDRYVPEEAVIREISRVSSVDFDYLTFAGSGEPTLHSGLGEIIRAARKQIDRPIAVITN
FT                   SSLLIYKHVRKEVAQADLVLPSLDAATQETFERINRPAAGLKIEDIIEGLRAFRSEFGG
FT                   EMWLEVMLVREINESDTPLIARAAAEIEPDRIQLNTVVRPPAEPVLPLRRDEMLRMLRL
FT                   FKGAELIPDWDWSVPEVEEERIADLLREPMTLEELRSKSGLIYEDTVKYLKILEDAGRI
FT                   SRSIRDGKIYFQTR"
FT   gene            101609..102991
FT                   /locus_tag="Mthe_0109"
FT   CDS_pept        101609..102991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0109"
FT                   /product="(R)-citramalate synthase"
FT                   /EC_number="2.3.3.-"
FT                   /note="TIGRFAM: isopropylmalate/citramalate/homocitrate
FT                   synthases; PFAM: pyruvate carboxyltransferase; LeuA
FT                   allosteric (dimerisation) domain; KEGG: mbu:Mbur_0711
FT                   isopropylmalate/citramalate/homocitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13911"
FT                   /db_xref="GOA:A0B5D7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024890"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D7"
FT                   /protein_id="ABK13911.1"
FT                   /translation="MDELGVDVIEAGSAITSDGERESIRAIASAGLNAEICSFARAHRK
FT                   DIDAALDCDVDSLHLVVPVSDLHIERKLRSDRESVLRKAVEATEYAKAHGLIVELSGED
FT                   ASRADLDYLESIYRATIEAGADRLCFCDTVGVLLPERTAEIFQRLRSLGKPVSIHCHDD
FT                   FGMATANTVAALRNGAMQAHVTINGLGERAGNTSLEEVVMCLENLYGIRTGIKCNLLYQ
FT                   ISRVVSKKTGIPVAPNKAIVGENAFTHEAGIHVHGLIADTSTYEPMRPEQVGRKRRIVL
FT                   GKMSGRAAVELALREFGITVNEEQLNEIVSRVKELGDKGKRVSDADLQSIADTVLSREL
FT                   KPRVLLEELTVVSGNRVTPTASVKLILDGRETLEAGAGVGPVDAAVNAVRRAISGVTDI
FT                   RLEEYHVDAITGGTNALVEVWVTMAIGDRSITARGAGADIIMASVEAVLEGINRLMLLE
FT                   DR"
FT   gene            102988..104661
FT                   /locus_tag="Mthe_0110"
FT   CDS_pept        102988..104661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0110"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="KEGG: mbu:Mbur_0710 acetolactate synthase, large
FT                   subunit, biosynthetic type; TIGRFAM: acetolactate synthase,
FT                   large subunit, biosynthetic type; PFAM: thiamine
FT                   pyrophosphate enzyme domain protein TPP-binding; thiamine
FT                   pyrophosphate enzyme, central region; thiamine
FT                   pyrophosphate enzyme TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13912"
FT                   /db_xref="GOA:A0B5D8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D8"
FT                   /protein_id="ABK13912.1"
FT                   /translation="MMVRMTGAEAIIECLRREGVEVIFGLPGGVLLPLYDALYSSDMRH
FT                   ILVRHEQAAAHAADGYARATGRVGVCLATSGPGATNLVTGIATAYMDSVPIVAMTGQVN
FT                   TGLIGKDAFQEADITGITMPITKHNYLIKSSRDIPRVFREAFYIARTGRPGPVLIDLPR
FT                   DITVDELEFDYPEINLPGYNPSTKVHQLQIRRAAEALMAAERPVIYAGGGVRYANAHEE
FT                   LFQLATRLNAPVTTTLMGMGCFPTDHPLSLGMLGMHGTKYANLAVQEADVLLAVGARFD
FT                   DRVTGKIASFAPKARIIHIDVDAAEIGKNVRVDIPVVGDAKIALTELLKHVQQRPWTEW
FT                   NEKILSWKREYPLRYTRDENVIKPQFVVEKICELCPDAIIVTEVGQNQMWAAQFFKHKD
FT                   PRKFITSGGLGTMGYGFPAAIGAKVGRPECEVIDIAGDGSFQMNIQELATAVVNDIPVK
FT                   IAILNNGVLGMVRQWQTLFFGKRYSHTTLGDVPDFVKVAEAYGAVGLRATKPSEVEDVL
FT                   REGLASDRPTVMDFIVHRDEKVSPMVPAGASLSEILELES"
FT   gene            104658..105155
FT                   /locus_tag="Mthe_0111"
FT   CDS_pept        104658..105155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0111"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: mma:MM0669
FT                   acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13913"
FT                   /db_xref="GOA:A0B5D9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5D9"
FT                   /protein_id="ABK13913.1"
FT                   /translation="MKHTIAVIVENKPGVLTRISGLFSRRGFNIESLSVGATDNPAYSR
FT                   MTISVEGDDVVLEQVVKQLSKLINVIRVSRLDPQESVERELAIIKVSANKDTRSEIMQI
FT                   VSVFRARIIDVSPRSLIIEVTGDEKKVDALQQMLRQFGIKEMARTGKVSMVRGSKVVQA
FT                   GP"
FT   gene            105167..106165
FT                   /locus_tag="Mthe_0112"
FT   CDS_pept        105167..106165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0112"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: afu:AF1985 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase,
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13914"
FT                   /db_xref="GOA:A0B5E0"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5E0"
FT                   /protein_id="ABK13914.1"
FT                   /translation="MATIYRDKDADLRVLKDKTIAIIGYGNQGHAQGANLKDSGLDVIA
FT                   ADLKDSPAWKRAEKDGLRVMTVPEASKEADFIQILLPDELQPRIYREQIAPYLEEGNIL
FT                   GFSHGFNIHFNQIIPPEYVDVVMVAPKGPGDLVRRQFLEGKGVPCLVAVKQDYSKSAKR
FT                   IALAYAKGIGGTRAGVLETTFAEETETDLFGEQVDLCGGVTAMIKAAFETMVQAGYQPE
FT                   IAYFEACHELKLITDLIHEGGLMKMWNSVSNTAEYGGLTRGDRIINEQSREAMWEILEE
FT                   IQSGKFAREWILESQAGLPVKKALEQQESEHLIEKVGAELRAMMPWLGEKK"
FT   gene            complement(106258..107280)
FT                   /pseudo
FT                   /locus_tag="Mthe_0113"
FT                   /note="cobalamin biosynthesis protein"
FT   gene            complement(107386..107835)
FT                   /locus_tag="Mthe_0115"
FT   CDS_pept        complement(107386..107835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM2527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13915"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5E1"
FT                   /protein_id="ABK13915.1"
FT                   /translation="MDETERILLKEKPCQALLAILELDHAYASLISKKIDSTFAHTLRI
FT                   LSQLEQAGLVYTRTEGRVKYVELTGPGRRAAEALRMLRDAIEDAAEVKKRIKRIHELVD
FT                   AAERAQGDRELLAGPLRRDLALLRSITDSREIEHLESRIRGMISR"
FT   gene            complement(107828..108751)
FT                   /locus_tag="Mthe_0116"
FT   CDS_pept        complement(107828..108751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: det:DET0225 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13916"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5E2"
FT                   /protein_id="ABK13916.1"
FT                   /translation="MNITTKILLAFMLVALSGCIGPSGGPGAAPNSTALMEDLLKTSGN
FT                   VTSYRFESSKMTTAEFLNLTEGYSLEDRLSYNLSENGEISIARNVSQSMLRVSQESSMS
FT                   SEKYRNLSMSSSREYYIINSTRYENIDGNWTRLFMPYPEYELLRENRLYLQLDILNRST
FT                   LDVIGSETVDGTDCWKLKVSPENTTIHAAVIALEVSDVLGLPAQILLAMFNTTELERNS
FT                   SIDWTAWISKEDKRLVKREGTVTASITPEVLGISSPGVRFLINVNVNESMRFFDYDRPI
FT                   EIELPDEARSAVMLIPVINTSGVSNG"
FT   sig_peptide     complement(108665..108751)
FT                   /locus_tag="Mthe_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.677 at
FT                   residue 29"
FT   gene            109040..109198
FT                   /locus_tag="Mthe_0117"
FT   CDS_pept        109040..109198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0117"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   tte:TTE2154 rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13917"
FT                   /db_xref="GOA:A0B5E3"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5E3"
FT                   /protein_id="ABK13917.1"
FT                   /translation="MDRYKCTICGYIYDPEKGDPDNGVEPGTPFEKLPDDWVCPECGAA
FT                   KDAFEKV"
FT   gene            109201..109719
FT                   /locus_tag="Mthe_0118"
FT   CDS_pept        109201..109719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0118"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   dde:Dde_1791 ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13918"
FT                   /db_xref="GOA:A0B5E4"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5E4"
FT                   /protein_id="ABK13918.1"
FT                   /translation="MINERLLDALNKQVNWELYSSYFYLSMSGYFESTGLKGFASWMRA
FT                   QAQEELFHAMKFYDYIISRGGRVKLMRIEEPPGEWESPLNVFEDVHVHEQKVTGLIHAL
FT                   LDLAIEVKDYPTQSMLQWFVNEQVEEEANAEEIVQKLRLIQGERGVGLLYMLDKELGQR
FT                   VFTPPAEKE"
FT   gene            complement(109832..110578)
FT                   /locus_tag="Mthe_0119"
FT   CDS_pept        complement(109832..110578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13919"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5E5"
FT                   /protein_id="ABK13919.1"
FT                   /translation="MRKKLVSMLLLLVIFTGLCSAANYMYEKSVVKGVGYRNLEIVIST
FT                   QYGYSGAKLVEKQSGSGNVNSRIELEAERQLSSGYDPLYTSCDYPTGSDYPMDYINFTS
FT                   EQDLEYMPVSYQTGTYDQKWIDKLCVQNYRIGAVVTEMYTHAEHLQKSTEIKTRAYGFG
FT                   NGYADNVNSCCTGVLEANINSNVIGVAHIGWMSREPEAQDIVKGRHVEYGRSIEDLTGV
FT                   FSIEKFIQLWGNSTCGAISVDWLPCI"
FT   sig_peptide     complement(110510..110578)
FT                   /locus_tag="Mthe_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.738 at
FT                   residue 23"
FT   gene            111084..111168
FT                   /locus_tag="Mthe_R0005"
FT                   /note="tRNA-Leu1"
FT   tRNA            111084..111168
FT                   /locus_tag="Mthe_R0005"
FT                   /product="tRNA-Leu"
FT   gene            111438..111950
FT                   /locus_tag="Mthe_0120"
FT   CDS_pept        111438..111950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0120"
FT                   /product="SSU ribosomal protein S15P"
FT                   /note="PFAM: ribosomal protein S15; Ribosomal S13S15-like;
FT                   KEGG: mba:Mbar_A1873 ribosomal protein S15p"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13920"
FT                   /db_xref="GOA:A0B5E6"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5E6"
FT                   /protein_id="ABK13920.1"
FT                   /translation="MARMHSRKKGSSGSRPPVVDKLPEWCDVSKEELEKTIMTLHERGM
FT                   SNAMIGLTLRDQYGVPNLKLILGKSLSSFLRDRNALPEIPEDLSNLMRKALRLRRHLLR
FT                   AQPRGTVSDTSISRLPRTKDIHNKRALQLVESKIRRLVRYYKQVGRLPATWEYRPETAE
FT                   IQISSKQ"
FT   gene            111953..113236
FT                   /locus_tag="Mthe_0121"
FT   CDS_pept        111953..113236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0121"
FT                   /product="phosphoesterase, RecJ domain protein"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein;
FT                   phosphoesterase, DHHA1; KEGG: mma:MM0213 putative
FT                   single-stranded-DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13921"
FT                   /db_xref="GOA:A0B5E7"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5E7"
FT                   /protein_id="ABK13921.1"
FT                   /translation="MNAFEKAAETIARAILQCDRVVVVSHDDADGISSAGLICNALARA
FT                   GIPFQARLTQRLTADTIEGLKPPIVFCDMGSGQPDVISGIKGEVFVLDHHKPVGSLNCI
FT                   SLNPHNFGIDGAFEISASGVVYSVVRKMGDNRDLAGLALVGAIGDRQAMIGANRHILEE
FT                   GIAAGAVEVRPGLKMAEDGDISKVFERSIEPLLDFTGDPERVRAFLGEIGVDGRVEDLR
FT                   GEPLTRISTALVLKLLMQGSFAADSVIGEAIRLKREVVENAFELVLLLNACGRLERPGI
FT                   GLTLCLRDRSALPEARRIADDYRKEILAGIDLLRRNSTEMENIRYLIAENLHGGGVIAG
FT                   LGIRYLYTDKPLIVLNNKDGTVRVSARGNRPLIRRGLDLSIALRAAAESVGGKGGGHSI
FT                   ASGASIPPGTEKQFLLKLNEIIGGQLKR"
FT   gene            113233..113451
FT                   /locus_tag="Mthe_0122"
FT   CDS_pept        113233..113451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13922"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5E8"
FT                   /protein_id="ABK13922.1"
FT                   /translation="MIYVKLIFSGSDVQEISKALEPDNLPSMNVSVQDDELIIELRAER
FT                   IGTVLSTVDDLLMNIKVAEEAIGSSEV"
FT   gene            113453..114955
FT                   /locus_tag="Mthe_0123"
FT   CDS_pept        113453..114955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0123"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="PFAM: tRNA synthetase, class II (G, H, P and S);
FT                   KEGG: mbu:Mbur_2337 tRNA synthetase, class II (G, H, P and
FT                   S)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13923"
FT                   /db_xref="GOA:A0B5E9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004503"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041293"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5E9"
FT                   /protein_id="ABK13923.1"
FT                   /translation="MKFHLEVSLKLSGDAANAEGDLAEFFEKQAVDLLKKGAPEGMGAK
FT                   VAGWRITGDQLEIKIESDRYVRAHDALLRLRKPLANLLGRKHRLGIRGINVSRFEIQIE
FT                   SNRQITHRIPYVRESRYEDGLLTLILGVEDPKRGWTWMLENRIPDRIVNLLEEKLQSYG
FT                   GKAEHWELLWESPPREFKFSGDPTQEMVKRGWIKHGSARGQWIHGPQSTHLFRTFERIV
FT                   LEEILVPLGYREMIFPKLDTWDVWKRSGHAQGVYPEIYYVCPPKSRDPAFWEEVIDYYK
FT                   VTHEIPLDLIKEKIDYPIGGMCYAQCPTFWVFLQGATLPNDELPIKVFDRSGTSHRYES
FT                   GGIHGIERVDEFHRIEIVWLGTKQQVMEEAERLKERYKHIFEEILELRWRMAWVTPWFM
FT                   AQEGRTGLAEMEGAGTIDYEALLPYSGNWIEFQNLSVNGEKYPKGFSVKAQSGESLWSG
FT                   CSGVGLERWTSVFLGQKGLDPDNWPDEFRKRFGEMPRGIRFL"
FT   gene            115264..115890
FT                   /locus_tag="Mthe_0124"
FT   CDS_pept        115264..115890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0124"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; KEGG: mba:Mbar_A1807
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13924"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F0"
FT                   /protein_id="ABK13924.1"
FT                   /translation="MHQFLFMLTLEEGRRAVRLARDALTAYVHRKEIINPHDLPGVFNE
FT                   RRGVFVTLEKDGELRGCIGYPRAVLPLGKAIVDSAINAGTRDPRFPRVRPEELDEITIE
FT                   VTVLTEPQVMDGDKKTLPERVQIGRHGLIVTRGMCSGLLLPQVAPEYGFDSVDFLCQTC
FT                   LKAGLPVDAWLDDDTVIECFEAQIFSETSPNGDVIEKKLPACETR"
FT   gene            115905..116663
FT                   /locus_tag="Mthe_0125"
FT   CDS_pept        115905..116663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0125"
FT                   /product="protein of unknown function DUF1614"
FT                   /note="PFAM: protein of unknown function DUF1614; KEGG:
FT                   tte:TTE2341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13925"
FT                   /db_xref="GOA:A0B5F1"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F1"
FT                   /protein_id="ABK13925.1"
FT                   /translation="MLELMIPFFLLLVILLLALPLIFIYLFIRITEEAFEQIGFGHWHA
FT                   SLMVFGSIIGSMIDIPLHSGVITTYPAFMVDLMGTMDVPVSFHPVRLLVNVGGCIVPVL
FT                   VSIDLLRRHRAPVSTALLGAVVVAILTYTMAEPVPNVGITLPVYIPPVSAALVAVVLCR
FT                   GYRTAPAIAYISGSIGTLLGADVMNLLTPGVLPALAPPSAYPRPLALSIGGAGIFDGIF
FT                   LTGVMAVLLASLVVCLLGGGSCRSRRISVS"
FT   gene            117098..117631
FT                   /locus_tag="Mthe_0126"
FT   CDS_pept        117098..117631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0126"
FT                   /product="protein of unknown function DUF116"
FT                   /note="PFAM: protein of unknown function DUF116; KEGG:
FT                   mhu:Mhun_0624 protein of unknown function DUF116"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13926"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F2"
FT                   /protein_id="ABK13926.1"
FT                   /translation="MLIGISLLESFVKAIFWLARADDKIVDDVGISLMNYINRGKFYAT
FT                   PVGDRFVFMPQCLRSVECPAKLTPEGIKCVGCGRCGIGEAKKIAESRGYRFFVVPGSSF
FT                   IKRIIQRYHPKGIVGVGCEMEIKEGLILCHSHGIPAIGVPLSTAGCVSTTLEWERLYDV
FT                   LLQRSSREPERHQT"
FT   gene            complement(117710..118834)
FT                   /locus_tag="Mthe_0127"
FT   CDS_pept        complement(117710..118834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0127"
FT                   /product="Protein of unknown function DUF373"
FT                   /note="PFAM: Protein of unknown function DUF373; KEGG:
FT                   mma:MM2378 conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13927"
FT                   /db_xref="GOA:A0B5F3"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F3"
FT                   /protein_id="ABK13927.1"
FT                   /translation="MDVLVLCIDRDDDLGRKAGIKSPVVGREENLNAALTLGLADPEES
FT                   DTNTIFGGLKIYDELAAERSVEIATITGDEKVGLSADRKLAEQLEQLIERLDPKSVIVV
FT                   SDGAEDEAILPIIQSRIKVDGVRRILVKQNPSIESTYYLLKQVFTDPKISHTIFIPPGL
FT                   ALLMFSIFYLLNYPNGAIIAITGSVGLYLLFRGLGLDDFLDETKKTLRGSLYAGKISFV
FT                   TYILAGMLIIIATIQGIANVWYSYKGPIWYGYLTLLMLFINASVWWYVAAGICANVGKL
FT                   IDMHLEGIKDPRTYSYPFFLFATGLIFWGASIVILANFTQDFSMSPLSSIQYFAVCAMG
FT                   AMATALLGIKLKSYIAKRNGAGRELLKEGVQTKC"
FT   gene            complement(118923..119732)
FT                   /locus_tag="Mthe_0128"
FT   CDS_pept        complement(118923..119732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0128"
FT                   /product="protein of unknown function DUF165"
FT                   /note="PFAM: protein of unknown function DUF165; KEGG:
FT                   tma:TM0792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13928"
FT                   /db_xref="GOA:A0B5F4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F4"
FT                   /protein_id="ABK13928.1"
FT                   /translation="MSRLQDERTDGDQADSRSAYGRSPHYSQGGGAARRRFRIDKTQAA
FT                   IILCGLYIFFSLAGNIAATKVTYFGRLVMDAGFIYSMTFTWRDLIHKQLGMRAAITTIW
FT                   LSALINLLAALYFQIVVLMPAEPDWAANGGQAAWQFLFGIFETSGGPWWQSIFSLQLRI
FT                   VLGSVITMVIAELTDTEIYHLWVTGWGRNRPQWARVAISNAISIPVDSILFPLIAFTGI
FT                   IGFDAMIQMFQTNIAVKTIVTLLSFWTIYLVPERPIFEQHEYDAEQI"
FT   gene            complement(119713..120927)
FT                   /locus_tag="Mthe_0129"
FT   CDS_pept        complement(119713..120927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0129"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: afu:AF1485 queuine tRNA-ribosyltransferase
FT                   (TgtB); TIGRFAM: tRNA-guanine transglycosylases, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13929"
FT                   /db_xref="GOA:A0B5F5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F5"
FT                   /protein_id="ABK13929.1"
FT                   /translation="MAEHFSFEVLKRSRTTLARLGVIRTRRGIIETPQFIPVATVASVR
FT                   ALGSDDLRALGVQAIFANTYHLHLRTGEDLIRRMGGLHRFMSFDGPIFTDSGGFQAFSL
FT                   GLGREHNISKIGSIFPHGRRSAERRENLTRITDEGVAFKSLVDGGWHFIDPRSAMRIQS
FT                   RLGSDIVMAFDECTSPLSDYDYTREAMERTHRWAVQSLRYHDRRQAIYGIIQGGWFEDL
FT                   RRESADFIKSLPFDGIAIGGSLGNCKADMHQVLEWVVPRLDARPRHLLGIGEIPDIFEC
FT                   VERGIDTFDCVHPTRIARRGNLYISPASGGCLENKFRISIKSSVFKDDKRPVDPRCGCP
FT                   TCRMYSRAYLRHLYISNELSYFRAATVHNVYFMLRLMESIRKSIRSGKFSALKRRWMKG
FT                   EQAPG"
FT   gene            complement(121349..122023)
FT                   /locus_tag="Mthe_0130"
FT   CDS_pept        complement(121349..122023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0130"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: mac:MA1902 iron-sulfur
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13930"
FT                   /db_xref="GOA:A0B5F6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F6"
FT                   /protein_id="ABK13930.1"
FT                   /translation="MKVLAINGSPKMDDGNTARILNPFLDGMREAGADVELFHTRKLKI
FT                   GPCNGDMSCWFRNSGKCGQNDDMQMLYPKFEDADVIVWATPVYFSGVTGPLKNLMDRQL
FT                   PLHVPGTTPKKKQKVVLVSSCGAWEIEAFDPIIVQMRAIYSRDDAEFIAALLRPGAEAM
FT                   RYMPEGAMDDVINAAREAGRELVKTGRIPESLLKTVSRPLMSEDEYMKAGEKFLEEARK
FT                   NA"
FT   gene            complement(122034..122597)
FT                   /locus_tag="Mthe_0131"
FT   CDS_pept        complement(122034..122597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13931"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F7"
FT                   /protein_id="ABK13931.1"
FT                   /translation="MTVRVHTHDSSSISKIERVRLLARKAFIPAIRVHIMRYVLFLLAC
FT                   LLVLGTADALFQNTSPQMYIDRYNSNIDQAPQALRELLGSERVEINILLNNGTLYMLGL
FT                   ETSKGRIVASYPGGIDDPTITIETSESTIQRVASSSDPVAAFKDAKDRGEVKIEATKLT
FT                   TRLKLALVLASADVFKYFLGVFFT"
FT   gene            122897..123367
FT                   /locus_tag="Mthe_0132"
FT   CDS_pept        122897..123367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13932"
FT                   /db_xref="InterPro:IPR018716"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F8"
FT                   /protein_id="ABK13932.1"
FT                   /translation="MFHLDQEKRYLVALPFKKRGKSSLKISDFIFALSLDMKWGPPEKV
FT                   RALLMEAENEGLVRIDGDVVYSNADIEIPVGFKPAPVEGIFERAVRMISSKTGMSRKEI
FT                   IAMINERQDSLQRLVELDVVALLVARELEIDVSDMAREAYQSLISSASRKAA"
FT   gene            123377..124483
FT                   /locus_tag="Mthe_0133"
FT   CDS_pept        123377..124483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0133"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase, FAD-binding; FAD dependent oxidoreductase;
FT                   Lycopene beta and epsilon cyclase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: mba:Mbar_A1603
FT                   geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13933"
FT                   /db_xref="GOA:A0B5F9"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5F9"
FT                   /protein_id="ABK13933.1"
FT                   /translation="MYDLIVIGGGPAGASAALEGAGLGLSVLLIEKEKFPRYKPCGGAL
FT                   SEKARSYLRFRIPDEVIDAEVSRIRIFFRDRCAEISRPERLSTLVTRSVFDDILVRRAA
FT                   DAGAEVLFGKKATGISEEDGCVRIMAGESYKGRLLVLADGHTGMLSRKICPGDGMRGVC
FT                   LVSEVAAEETNDCMEIHFGEVDRGYAWVFPHGSYLSVGAGGLGSSNIRVIMDRLMRARG
FT                   FRGRIHGHTIPLSGPSRYLGGRRTMLCGDSAGMVDPFTGEGIAYAVRSGQIAAQVASEH
FT                   LSDGCDLVEYQHRCKREIGDDLRASFLLARIMHRFPDQLFNMFMDDRSLLERYIDIHSH
FT                   GLSYRSFLKWLAPRAPAKLMASKISKMV"
FT   gene            124550..124852
FT                   /locus_tag="Mthe_0134"
FT   CDS_pept        124550..124852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13934"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G0"
FT                   /protein_id="ABK13934.1"
FT                   /translation="MKCLRCGCCCIHLDVAIPNPDAIRPDGTLDKTHRMPVMFKRAGEP
FT                   CPHLTFADGIAVCRIHEMECYRGSPCELFEQVGSQDDVCVLNAYFRCMRLSEDEN"
FT   gene            complement(124991..126169)
FT                   /locus_tag="Mthe_0135"
FT   CDS_pept        complement(124991..126169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0135"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein; KEGG: tma:TM0121
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13935"
FT                   /db_xref="GOA:A0B5G1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G1"
FT                   /protein_id="ABK13935.1"
FT                   /translation="MRYVTDIMDVMQLKEDERKDLSSVTENFAFRASSYYLSLIDWNDP
FT                   QDPLRKIVIPDANEMYNWGTKDPSRERSYTVLPGLQHKYRQTALMLVSNACGSLCRFCF
FT                   RKRIFIDSHHETAIDLPRALDYIREHREITNVLLSGGDPLMLSTERLEEIVRRLRDIDH
FT                   VQIIRIGTKLPVYNPFRITEDPSLLEIVKRYSHENRRIYFVIQFNHPKEISSETLKAVS
FT                   QLQEAGAITVSQTPLLRGVNDNPETLAQLFKKLSFIGVSPYYVFQCRPSIGNYHFQVPV
FT                   ETSYAIVEKAKSMCSGLAKRAKFVMSHATGKIEVVGLTDRYVYMKYAQAADPENIGMFM
FT                   VFERNPAAFWFDDYSDPVDHHRLDAEETRAAGDVYISQSDDGGELHAATTMD"
FT   gene            126609..127541
FT                   /locus_tag="Mthe_0136"
FT   CDS_pept        126609..127541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0136"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain; KEGG:
FT                   chy:CHY_1057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13936"
FT                   /db_xref="GOA:A0B5G2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G2"
FT                   /protein_id="ABK13936.1"
FT                   /translation="MRNKKIAVTGGAGFIGSNIVRALCDENDVTVIDNMSTGRRENLRG
FT                   LEGRIRFVECDINDIKMLKREFESVDYVLHQAALPSVQRSIMDPMATNRSNIDGTLSVL
FT                   VAAMDCGVKRVVFASSSAVYGDSPELPKRESLIPRPMSPYAVTKLVGEHYCRVFYEIYG
FT                   IECVSLRYFNVFGPGQDPASEYAAVIPKFIDAVLSGSQPVVYGDGEQTRDFVYVDDVVR
FT                   ANILACLSPGAPGLAINIGTGYATSLNRLLDAIGRVLKRYIHPIYTEPRPGDVRDSVAD
FT                   ITLAREVLGYAPEYGLEDGLNEMLKCRPA"
FT   gene            complement(127691..128059)
FT                   /locus_tag="Mthe_0137"
FT   CDS_pept        complement(127691..128059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM2384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13937"
FT                   /db_xref="GOA:A0B5G3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G3"
FT                   /protein_id="ABK13937.1"
FT                   /translation="MIEEALEYIRSNPDGVLQSDLWKALGIDSRKCSRIVAKLLKDGLI
FT                   TREEELADGVRTYRLRAVERPECTDRFTPLMASDIFDPCAGCTDECVPERCPKLSEWLF
FT                   ALAFSKSSGEKPHAAASL"
FT   gene            complement(128079..128303)
FT                   /locus_tag="Mthe_0138"
FT   CDS_pept        complement(128079..128303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0138"
FT                   /product="Small nuclear ribonucleoprotein, LSM family"
FT                   /note="PFAM: Like-Sm ribonucleoprotein, core; SMART:
FT                   Like-Sm ribonucleoprotein, eukaryotic and archaea-type,
FT                   core; KEGG: mma:MM2383 small nuclear riboprotein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13938"
FT                   /db_xref="GOA:A0B5G4"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G4"
FT                   /protein_id="ABK13938.1"
FT                   /translation="MYPNKKVQSLIGTKIQVEMKGSQRHVLEGILNSVDEYLNLHLLET
FT                   VEIVNGERTRSLGSVILRGNNIILISPAE"
FT   gene            complement(128370..128597)
FT                   /locus_tag="Mthe_0139"
FT   CDS_pept        complement(128370..128597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0139"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   deh:cbdb_A1730 NifU protein, homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13939"
FT                   /db_xref="GOA:A0B5G5"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G5"
FT                   /protein_id="ABK13939.1"
FT                   /translation="MQSMKEEVESTLESIRNVLRIEGGDVELVDINDGVVYVKLTGSCA
FT                   GCPFSQMTLRNFVERELKKNVSGVKAVESV"
FT   gene            complement(128603..129028)
FT                   /locus_tag="Mthe_0140"
FT   CDS_pept        complement(128603..129028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mka:MK1106 nitrogen regulatory protein PII
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13940"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019296"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G6"
FT                   /protein_id="ABK13940.1"
FT                   /translation="MYEFSLCYRILKHCSTQQHKRQPIYAIVSNNLNMKSMVKVFIDHE
FT                   HLLKVMNILTEVGITGFYIYEYKGMSPGVWKDFRLREDPEMTLDAIRNFSEPGVMVNTV
FT                   VSSNRCERLVQSLEQGLKGKRFTVIIQPVTSIKVRGD"
FT   gene            complement(129390..129932)
FT                   /locus_tag="Mthe_0141"
FT   CDS_pept        complement(129390..129932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0141"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number="2.1.1.132"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   mhu:Mhun_3216 precorrin-6y C5,15-methyltransferase, subunit
FT                   CbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13941"
FT                   /db_xref="GOA:A0B5G7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G7"
FT                   /protein_id="ABK13941.1"
FT                   /translation="MITLEAIEAIRAAKLIYGSERAVALAADHIPPGCDVRVIRDYRSL
FT                   RSLPDDAVVLSTGDPMLSGLGYLGGDVIPGISSMQVACARLGLSLLRVVPITFHGRKMD
FT                   PEAVAFELEHGRCVFLLADDSTDLDELCRYLENRGIQRDVVVLRDLGYPEERINVGTTR
FT                   DPPEARGLFSVVIGELR"
FT   gene            complement(130070..131104)
FT                   /locus_tag="Mthe_0142"
FT   CDS_pept        complement(130070..131104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0142"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein; KEGG: mma:MM1681 cbiD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13942"
FT                   /db_xref="GOA:A0B5G8"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G8"
FT                   /protein_id="ABK13942.1"
FT                   /translation="MLERSPLRMDGVMIDPVTGFRIPDEWLRRSSLDDIEEKIKSGLWV
FT                   LLSNGQVLRRGLTTGTTASAACKGAVLSLAGDVEEVDVWTPSGITVRVKVEASCGRCAA
FT                   RKDAGDHGSDITHGMMIVASASPSERSELIAGDGIGRIGRSGLSTDIGKPAISRSARAQ
FT                   IMRAIEEGVRETGLGGARVHLSVPDGRRIALKTLNPSVGVDGGISILGSTGFVEPWNEH
FT                   LEDCISESLNVLDRVVATTGRTGLRYSRMLFPEHTAVLIGSKLDLLRMRTGETVLCGLP
FT                   GLILRWAEPEMLNGTGYATVAEMIEQEPDHPAIDRALEHLEKMFPGTRIVLIKRDGSIY
FT                   RDTG"
FT   gene            complement(131192..131821)
FT                   /locus_tag="Mthe_0143"
FT   CDS_pept        complement(131192..131821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0143"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   mhu:Mhun_3214 precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13943"
FT                   /db_xref="GOA:A0B5G9"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5G9"
FT                   /protein_id="ABK13943.1"
FT                   /translation="MERYSDLGAMTPEAFEISRASRELIARIVGDETLEDKIKQRCVMA
FT                   TGDPSIAESLRFVMDPVRAGFRALDDAADIFVDIRMVEAGIVKKGHRSRIRTLIDMGEE
FT                   IASRLGVTRASAGVIAAKDELDGAVVVIGNAPTALLALCDIMERREAMPSLVIGIPVGF
FT                   VRAAESKERLRRIEVPSISNVGTRGGTPIAVAAMNEIINMYHRGIR"
FT   gene            complement(131844..133238)
FT                   /locus_tag="Mthe_0144"
FT   CDS_pept        complement(131844..133238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0144"
FT                   /product="precorrin-3 methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: afu:AF0724
FT                   cobalamin biosynthesis precorrin-3 methylase / precorrin-8X
FT                   methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13944"
FT                   /db_xref="GOA:A0B5H0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H0"
FT                   /protein_id="ABK13944.1"
FT                   /translation="MPSESRLSIVGIGPGNPGSMTLRARRMIKDADFVVGYRRYLDLIQ
FT                   PLLKDKRVYPGRMGGEVERARLAVELLDDGSVALISSGDPNVYGMASLALEIALTSVDP
FT                   SRIEVVPGVTAFSAAACRAGVVFRDSLAVVSLSDLLTPWEDIWRRVRLAASMGMPLALY
FT                   NPRSSRRDWQLSEALEILKNAGRGGRTVVVARNVSRKGESIRRSTVDEMLHDAGEIDML
FT                   TLLIIGGEQGHVSDGGISIAGVGPGSIENLTHEVVEKVRSATLVLGAEMHLECIKEIIA
FT                   GEVFTGAGSREDRQVQRLERAVCELENGGLPVITVGGDPSIFSAAGRYIGMGRSLGMLP
FT                   GVSAFSAAAARAGAPISNDFALLSGSVPPEKLSALADAGFSMFLYNASAYTIKSISDWL
FT                   PGSRPCAVARDVTRRDEILEVCRASELGDLRLDGSRYTLVVSGPGSRIRDGMIVASRGY
FT                   EKKYCV"
FT   gene            complement(133222..133986)
FT                   /locus_tag="Mthe_0145"
FT   CDS_pept        complement(133222..133986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0145"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: mhu:Mhun_3212 cobalamin (vitamin B12)
FT                   biosynthesis CbiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13945"
FT                   /db_xref="GOA:A0B5H1"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H1"
FT                   /protein_id="ABK13945.1"
FT                   /translation="MEELFREYDMILALMAVGIVVRQVCPLLRDKWTDKPVVAVDSALK
FT                   TAVPVIGGHHGANDLALYLFKHLGIYPAITTATDSSGRPNLEGIASAFGSEIVNRDASK
FT                   HINASFLYQDVPIVRLRGPRIVIVDKDVAVLKSSGLIAGLGARKGATADEILSAVRSAT
FT                   AEAGRDVSEVRVIATSEIKSCDPEISRAAAKLGVSVVYLPDDALNAQKPLTPSRASMLG
FT                   LSGVAEPAVLALAQRMILPKKVYGRVTVALGE"
FT   gene            complement(134088..134825)
FT                   /locus_tag="Mthe_0146"
FT   CDS_pept        complement(134088..134825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0146"
FT                   /product="cobalt-factor II C20-methyltransferase /
FT                   precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.151"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: mbu:Mbur_2358 precorrin-4
FT                   C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13946"
FT                   /db_xref="GOA:A0B5H2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H2"
FT                   /protein_id="ABK13946.1"
FT                   /translation="MAEKNDWPPMKVYFVGAGPGDPDLITLKGYRLLKEADLVIYTGSL
FT                   VNRDLLRGLRSELVDSSNLSLEEITDRILSSVRASKKVVRLHSGDPSLYGAILEQMRPL
FT                   EENGVEVEVVPGVSSLFAAAAALKTQLTLKGVSESLIITRPSGATLERDEIRELSQHGS
FT                   TMAVFLGAERIREIVSSVKLPADTPVAVVYHASWPDQQVLTGTLGDIAEKVEEAGINKS
FT                   ALILIGGVVRRAGFRRSHLYRSR"
FT   gene            complement(134971..135579)
FT                   /locus_tag="Mthe_0147"
FT   CDS_pept        complement(134971..135579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0147"
FT                   /product="cobalt-factor II C20-methyltransferase"
FT                   /EC_number="2.1.1.151"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: mba:Mbar_A0626
FT                   precorrin-2 C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13947"
FT                   /db_xref="GOA:A0B5H3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H3"
FT                   /protein_id="ABK13947.1"
FT                   /translation="MLVGVSLGPGDPGLLTLRAIEVLRASEKVFAPGELAAELARPYCE
FT                   PEILDFPMTDDLERLEEIWERNADTVASYAEKCLTSFACLGDVNTFSTFSHLRRVLMRR
FT                   HPGIEIDTVPGVGIIPAAAARFGIGFERSFLVSDGSEPDAVLRLKATRPASIAAELHEE
FT                   GYTEFILGSRLYTPDEIILRGKMPERSSYFSVLYARRVR"
FT   gene            complement(135580..136095)
FT                   /locus_tag="Mthe_0148"
FT   CDS_pept        complement(135580..136095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0148"
FT                   /product="precorrin-8W decarboxylase"
FT                   /note="KEGG: mbu:Mbur_2360 precorrin-8W decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13948"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H4"
FT                   /protein_id="ABK13948.1"
FT                   /translation="MKLPGTATQPENIQIAMGKLDIGKGMLFLDIGCGSGAVSLAASRY
FT                   TDRIYGIDRRHEAVEASRSLVPGGNFICGEAVDVIPGLPDVDRCFIGGTRDIERFLPSL
FT                   RERAAPGFRLVVDVARIGMTSKIVRLVEDHFTLEEVIQINIFRGYRLAGDIALKPVNPI
FT                   FMIVGRGD"
FT   gene            136744..140085
FT                   /locus_tag="Mthe_0149"
FT   CDS_pept        136744..140085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0149"
FT                   /product="S-layer-related duplication domain"
FT                   /note="PFAM: S-layer-related duplication domain; KEGG:
FT                   mba:Mbar_A1034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13949"
FT                   /db_xref="GOA:A0B5H5"
FT                   /db_xref="InterPro:IPR006457"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H5"
FT                   /protein_id="ABK13949.1"
FT                   /translation="MYCKSLIVIALIVISAGFLSGGVAENADNRSAEQSVTSAAALQDD
FT                   FFSTDTSSSGITVTFKRLGNNTAKTPVSLGSRNTTVSTVDRDAEKNATSGANATTEGRP
FT                   AGASENVSSAVEQNRTAQSAAPSMAIASGAAPASNVSAVATEGLTEGNLTSNATSESGA
FT                   SNATAAPGISTNLTAVVTPEGLAPEGNLTSNVTSAVAENASLAGNQSSNLTAVLVPANI
FT                   SAENLTAENVTEEENVTAAENVTEEVTEEAPEEVGEEVAEEEFTDRIWREGMPETYTWT
FT                   PQTFSGFFYDLDDMVGTEKLTVSLSRSGGGYNRAIDTGNIRYTSDVQDISFEFDDWGKY
FT                   QVLGFMAEKYFAGYSGTEVVDDVSLINENQLRRVLIDSDDEKTITSGSVLPLEEGYELR
FT                   IKEIDINGNKVHLALAKDGDEIDSKVISPDDLKSATYMYEEEIGGKDVPLIMAHVSNVF
FT                   AGAESSLVTIDGLFQISDTYASVEEGDKYDKMEVVSVSDSGIELENEDSVTLRKGRTIQ
FT                   LMGGVGLQVADSDVLRFAPVVERTGSYEVRGTVVNPNKVDSFTWTPYNFEGFYYDIDED
FT                   IGTEKLVARFSGSKIDDGDLKYETSPQPVEFEFNGWGKYDVIGFMADKYFAGYNNETLF
FT                   TDEFSIINDGELRKVLIDSDEESTISSGSVLPLEDGYELQIKEVDLDGNKVWLSLTKDG
FT                   DEVDSKVVTPVSGDLEASTYTYKVRIGSEDVPIIAAHISNVFRGREADLATVDGIFQVS
FT                   DTPESVEEGDKHGKMEVESLSDDGITMKNDGSISLGRGKDVEIMGNLRLRVADNPERNL
FT                   CPIALRVGKTEPLRLNLTEAIVGKPIMIQVTSGGQAVSGAKVLVDGREIGTTDAGGMIR
FT                   YTPERAGSVQVQAKLSGYEDASGTLLVRTEAELRRIVITAPPEVMRGETFVVTVRGGAN
FT                   ATQAIAGANVSIDNMPAGVTDSKGSVSVSINDTGDHTISVEAAGYDRATKSVKVLSPIS
FT                   IVGINVTGDAIAGKPLKIVAEVQNTGKAPDSRQLQLLVNKNVTGNKSITVAPGETEKVT
FT                   FEYRPKEPGVYTFEVDGIQKTVSVEEAKGGWLVWAVALLIILLAGIGVYLYRTGELKEL
FT                   KKRLKM"
FT   sig_peptide     136744..136842
FT                   /locus_tag="Mthe_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.578 at
FT                   residue 33"
FT   gene            complement(140297..141184)
FT                   /locus_tag="Mthe_0150"
FT   CDS_pept        complement(140297..141184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0150"
FT                   /product="leucine rich repeat variant"
FT                   /note="PFAM: leucine rich repeat variant; KEGG: dra:DR1773
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13950"
FT                   /db_xref="InterPro:IPR004830"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H6"
FT                   /protein_id="ABK13950.1"
FT                   /translation="MHTLTIMEEIELERRASSHDTEPEVLEELSRSISWRVRRAVGWNP
FT                   STPVAVLKVLSRDRVQWVREAVAGNPKTPLDVLEALARDPDGYVRSAVALNTATPDSLL
FT                   SELSEDEMVEFDATNERLRYIVMEAVAKNPRTPEHDIIRLSASQSDDVRAAVASNPKVP
FT                   VYITEKLSRDQSWLVRFRVARNPVTPPEVLGRLADDRITDVRVAVAANVKSPPDSLISL
FT                   SKDRMIEVRCAVAENPSTPVEALEALAGHWSFLVREAVAKNRSTPISIMKMLSSDPDPS
FT                   VQKAAKERLRDRTA"
FT   gene            complement(141337..142254)
FT                   /locus_tag="Mthe_0151"
FT   CDS_pept        complement(141337..142254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA1281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13951"
FT                   /db_xref="InterPro:IPR040783"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H7"
FT                   /protein_id="ABK13951.1"
FT                   /translation="MDLFGKKRHQERISELEGMLQDLTREKEELKHTLEKREERLKKIT
FT                   SAYQETRRALKEAELRLRGTPERSSDETPEAPGVQKLAPRIMKRLLRRLDNIESPEEDI
FT                   LSEYRTPGGNLEGAPEAILPRSLKTLASERGISLLSLPDVFTLIIVPPLPFVSEGVTMG
FT                   RRFDLSPIQEIVDTPVLLISAHAGDSMIMVSLGADQIESFEIVRTPVKEKHSKGGWSQR
FT                   RFERLREEDIRRHGEHLRERVECAVERYAPLVKYVAVSGEPDLIRYVNQCFSLPVIRAR
FT                   LGKHDERNPEKTLEELYTYTLFRM"
FT   gene            complement(142359..142910)
FT                   /locus_tag="Mthe_0152"
FT   CDS_pept        complement(142359..142910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0152"
FT                   /product="TATA binding protein of transcription factor
FT                   TFIID"
FT                   /note="PFAM: TATA-box binding; KEGG: mac:MA4331
FT                   TATA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13952"
FT                   /db_xref="GOA:A0B5H8"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5H8"
FT                   /protein_id="ABK13952.1"
FT                   /translation="MESTINIENVVASTKLADEFDLVKIESELEGAEYNKEKFPGLVYR
FT                   VKSPKAAFLIFTSGKVVCTGAKNVEDVRTVITNMARTLKSIGFDNINLEPEIHVQNIVA
FT                   SADLKTDLNLNAIALGLGLENIEYEPEQFPGLVYRIKQPKVVVLIFSSGKLVVTGGKSP
FT                   EECEEGVRIVRQQLENLGLL"
FT   gene            complement(143133..143220)
FT                   /pseudo
FT                   /locus_tag="Mthe_R0006"
FT                   /note="tRNA-OTHER9"
FT   tRNA            complement(143133..143220)
FT                   /pseudo
FT                   /locus_tag="Mthe_R0006"
FT                   /product="tRNA-OTHER"
FT   gene            143466..145883
FT                   /locus_tag="Mthe_0153"
FT   CDS_pept        143466..145883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0153"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: mhu:Mhun_1028 peptidase
FT                   U32"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13953"
FT                   /db_xref="GOA:A0B5H9"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5H9"
FT                   /protein_id="ABK13953.1"
FT                   /translation="MRRKDEIPELLAPAGSWDALVAAVAAGADAVYLGGKRFSARMFAE
FT                   NFPSLEEAVDYAHARNVRVYVTVNTLVRDCEIDELEDYLVEICEIGADAILVQDTGVVR
FT                   LARDIVPELELHASTQMTIHSADGVRWAARNGLKRVVLSRELSVDDIKNIKNVSDDLGV
FT                   GLEVFVHGALCYSYSGQCLLSSSMGGRSGNRGMCAQPCRKPYTLLRGTSDEYGRLKDLR
FT                   RRGGECYLLSTRDLCTYPSLDKIVSAGVDALKIEGRMKSAEYVAIVTRVYRDALDAIAR
FT                   GDWAQDDGEIQRLALAFNRGFTEGYILGADDIMGREMPDNRGVLVGKILNCSGGFAVVS
FT                   PTGEILPEPGDGAVLRSGAEEIGFVVRERVDLQNGTFGLRVPDGARTGMYLYITRSARM
FT                   RDDAERIIRRGRDRIPIDLRISFDNGVPVADVYLAGPSGRIELSVKGDFVMEAARTLPL
FT                   SPSQIESQMRRTGGTQFVFREVVIDYPGGLYTTPAKLNQLRRDILRAAENALVHSYKRV
FT                   CTRGRSPALDRTERKADRLRVSVYADTLDVIDGALEGGAERVYFEPTTYEHDLASALEK
FT                   ARDLCEGRAELVWKWPRITRDRFLYMAGDVLRDFRLNKIMVENLGALEAAERYECEIFG
FT                   GQGLNIWNSLSVCMLSGARALTLSPELSASQISSIASLRDRPDLEVIAQGNIVIAVTED
FT                   RLISEGDVCAIRDRRHIFPVRRDAAGVTNILNSVETCLLDYLPQISLMGVDSVAIDARW
FT                   RTKKYAREMAGIYSRAVGELSELPKLKSMVRRMAMGGITAGHFLRGVAEASD"
FT   gene            146083..146631
FT                   /locus_tag="Mthe_0154"
FT   CDS_pept        146083..146631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0154"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: mth:MTH700
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13954"
FT                   /db_xref="GOA:A0B5I0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5I0"
FT                   /protein_id="ABK13954.1"
FT                   /translation="MNEKLEEIGSRIRELRELSKISPEEMAGYLKVPLETYCGYESGHL
FT                   DIPASLLFKIAQRLDVDMSLLLTGQEPKMSIFTVTRKGEGVEVERRKQYRYQSLAGRFA
FT                   HKKAEPFIVTVEPRSEKPAVYSHPGQEFDYILEGTIKIYIHNNEIVLNEGDSIFFDSSY
FT                   DHAMEALNNRPARMLVIVM"
FT   gene            146646..148529
FT                   /locus_tag="Mthe_0155"
FT   CDS_pept        146646..148529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0155"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein; KEGG:
FT                   mba:Mbar_A2172 AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13955"
FT                   /db_xref="GOA:A0B5I1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5I1"
FT                   /protein_id="ABK13955.1"
FT                   /translation="MASLLHKFVSRVEFDSYEDFRNNFRIIVPENFNFAYDVVDVYAQE
FT                   QPDKIALVWCNDHGEERIFTFKDMKHWSDRAANLFSSYGIRKGDTVMLTLKSRYDFWIC
FT                   MIGLNKIGAVAIPSTHMLKAKDIVYRIKKANLKMVVCIIEDGVPEEVDLAHKELGDVNL
FT                   IKAFVGREDQEREGWINFRRALAEASPDFTRPVGEEATRNEDVLIAYFTSGTTGYPKMV
FT                   KHDQTYPLGHILTAKYWQNVADDGLHYTVADTGWAKCAWGKIYGQWIAGSAVFVYDYDR
FT                   FDAGRMMEKLSKYKVTTFCAPPTIYRFMIKGDMSKYDFSTLKYAVTAGEPLNPSVYERF
FT                   LEVTGLKLMEGYGQTETVVTIANFPWMEPKPGSMGKPAPGFDIVLLKDSRQCEVGEEGE
FT                   IVIRTDKGKPVGLFIDYHLDPDRVRNTWHDGYYHTGDTAWVDEDGYIWFVGRTDDMIKT
FT                   SGYRVGPFEVESALMTHPAVLECAITGVPDPIRGQVIKATVVLTKGYTPSEELKRELQE
FT                   HVKRVTAPYKYPRIVEFVEELPKTISGKIRRVEIREKDKPYPIINAMECKGCERCILAC
FT                   PVNVLRMSEELNSRGYRYSVYAGDGCIGCGACYYTCPEPNALAVHIPSKGE"
FT   gene            148534..149577
FT                   /locus_tag="Mthe_0156"
FT   CDS_pept        148534..149577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0156"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: mth:MTH704 2-oxoisovalerate
FT                   ferredoxin oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13956"
FT                   /db_xref="GOA:A0B5I2"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5I2"
FT                   /protein_id="ABK13956.1"
FT                   /translation="MPSKLVAGNTAVVIGAMYAGCDCFFGYPITPASEILQEASRYFPM
FT                   VGRKFVQAESEEAAINMVYGAAAAGHRVLAASSGPGMSLKQEGISYLAGAELPCVIVDI
FT                   NRAGPGLGNIGPEQSDYNQTVKGGGHGCYRNIVLAPNSVQEMCDHTIKAFELAFKYRNP
FT                   AVVLADGVLGHMVEPLRFPESAITPVIDTSWAVCGTKGTRGNVITSIFLNFDELERHNI
FT                   RLQEKYRRIRENEAAYETYRVDDAEVVLVSYGISSRIARSAVDAARRDGINAGLFRPIT
FT                   LFPFPDKALKEIAERGCRLISVEMSDGQMREDIILATGADVELVSRYGGNLITREEIMR
FT                   KIREVSR"
FT   gene            149574..150986
FT                   /locus_tag="Mthe_0157"
FT   CDS_pept        149574..150986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0157"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   thiamine pyrophosphate enzyme domain protein TPP-binding;
FT                   KEGG: mth:MTH705 2-oxoisovalerate ferredoxin
FT                   oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13957"
FT                   /db_xref="GOA:A0B5I3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5I3"
FT                   /protein_id="ABK13957.1"
FT                   /translation="MRKDLGGHPGLYSEYPRKGGSAPGATHYCPGCGHGILHKLIGEAM
FT                   ADLGIQDRCVLLSPVGCAVFAYYYLDCGHVQAAHGRAPAIGTGISRAEDDAIVISYQGD
FT                   GDLASIGLNETIQAANRGEKMAVFFINNTVYGMTGGQMAPTTLVGEVTSTTPTGRDPRE
FT                   AGYPLHVCEILDTLKAPVYIERVSLSDIEHIRKARRAVRKALEIQRDKKGYAFVEFLSP
FT                   CPTILRMDAKGVERFINEEMEKEFPLKRFRDRSGEVEPIVRMKSDFSKESLDRIFGVAG
FT                   EESIEPVHDPEFGTMSIRISGFGGQGVLSMGLALAQAAYLSRRFVSWYPDYGPEQRGGT
FT                   SNCTVVISGEPISSPVVDEIDILVAFNRPSLEKFSSSVRELILYDMLAGEFQGSVRSIP
FT                   VAATEIATQKGAQQAANTAMLGALMATGRLGLPEDSYVGAIKDAFSKKPKLVPLNLEIF
FT                   RAGADWVRKMDR"
FT   gene            150983..151717
FT                   /locus_tag="Mthe_0158"
FT   CDS_pept        150983..151717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0158"
FT                   /product="coenzyme F420-0 gamma-glutamyl ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="TIGRFAM: F420-dependent oxidoreductase, putative;
FT                   PFAM: protein of unknown function DUF129; KEGG: nph:NP1054A
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13958"
FT                   /db_xref="GOA:A0B5I4"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="InterPro:IPR023659"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5I4"
FT                   /protein_id="ABK13958.1"
FT                   /translation="MIESVSLHLVRGLPVINKGDSLADLIQSRFELLDGDLICIASTVV
FT                   SKSEGRVRELSSYTPCERALAIAKNLGKDPRFVQAVLEESSEILLDRPFLLVVTRFGHV
FT                   CVNAGIDQSNVPPGKILLLPENPSLSAEMIRRELNRDCPVIITDTCGRPFRFGVTGVAI
FT                   GWSGLSPIRDWREATDIHGRKLEITLEAVADEIAGMANLLMGEAGDSTPAVVVRGLPRF
FT                   DGGGSMFMPEEQDVIRAILSSK"
FT   gene            151945..152610
FT                   /locus_tag="Mthe_0159"
FT   CDS_pept        151945..152610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0159"
FT                   /product="phospholactate guanylyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="PFAM: protein of unknown function DUF121; KEGG:
FT                   mhu:Mhun_1254 protein of unknown function DUF121"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13959"
FT                   /db_xref="GOA:A0B5I5"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5I5"
FT                   /protein_id="ABK13959.1"
FT                   /translation="MLRPVHCVVPFKSSGCKTRLSSALSGEQRWQLAVAMLRDVLRTLR
FT                   SIGMVTVLARPGMREDIIADLDATLRFSELELGDALNGFIDENTAAGWPADILIVMADL
FT                   PLIREEDVLEMIRTPGGVVLAPGRGGGTNMILIRDSRFRTRYKGLSFAKHKREAEELGI
FT                   EAGYCYSYRAGCDIDEPGDLIEILLHTNGESRALLERFGLRILESDGRGRLDQTQSNE"
FT   gene            complement(152759..154519)
FT                   /locus_tag="Mthe_0160"
FT   CDS_pept        complement(152759..154519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0160"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG:
FT                   mba:Mbar_A0575 molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13960"
FT                   /db_xref="GOA:A0B5I6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5I6"
FT                   /protein_id="ABK13960.1"
FT                   /translation="MHKEFHRLISLDKAIELALGDAPRPRVRIVNLESALGRVLAENVI
FT                   AEIDVPHFDRAAMDGYAVRSEDCIIASESSPVRLRIVGSVSAGSIPDASAGPGEAVEVS
FT                   TGSAMPEGADAVVMVEYADAADGYVMIRRPVHPYENVQRRGADLSLGERVLSAGTHLGP
FT                   REIGMLAALGMSRVKIRSLRVGVASTGNEIQSPDEHLMPCKIYDVNTYTISSALSQIGA
FT                   EPVVYGVFPDSYDALSESIATALIDCDMMILSGSTSAGRGDMLYRVVSDLGELVFHGIN
FT                   LKPGKPTLFGRVGGKHVIGLPGYPTSALTVFWQLVSPLVHRSLGLRSHHFSLKATLARP
FT                   FRSESRRQMLPVIIHRGKAYPFDRGSGAVTTLGASDGIIDVPADREYLHAGEVFDVHPL
FT                   SGDDLDLIISGESCPVLEAALDRMNLRFRYLVRGSMRALTDLQDGLADIACITATQELP
FT                   EDLRVVASYRRELGLISRNPDLLLNSDGAAFAAWGRDSGVGCIMDSMLPGVRRSVEVRT
FT                   HTGAALAVLQGKADLALGAREAAGMWGLHFRYLADDGISIVARMDDTRDIIKDIADALK
FT                   ERSQDAAVST"
FT   gene            complement(154524..155645)
FT                   /locus_tag="Mthe_0161"
FT   CDS_pept        complement(154524..155645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0161"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: mac:MA0550
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13961"
FT                   /db_xref="GOA:A0B5I7"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5I7"
FT                   /protein_id="ABK13961.1"
FT                   /translation="MMSGSTFGTLFRVTTWGESHGRAIGVVVDGCPAGIELSEMDVQRE
FT                   LDRRRPGQSTATTERHEADSVEILSGIFEGITTGTPISMLVWNRDARSSHYDSIRHTPR
FT                   PGHADYTYHVKYGIRDHRGGGRASARETVGRVAAGAVARKLLSEFGVEIAGYVSELGGI
FT                   SASLPRWTSRGSIEREELLDIRERAESSPIRCPDAAASSRMLSLLDSVRSDGDSIGGVV
FT                   EVIAIGVPPGLGEPVFDKLDADLAKALMSIGAVKAVEIGAGFESARLRGSEMNDPLFYE
FT                   NGRISFERNNAGGILGGISTGAPILCRMAVKPTPSIARSQRTVDMVSGESVDISVRGRH
FT                   DPSIPPRIVPVAEAMVALVLADHILRQRSARLR"
FT   gene            complement(155642..156070)
FT                   /locus_tag="Mthe_0162"
FT   CDS_pept        complement(155642..156070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0162"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: sto:ST0753 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13962"
FT                   /db_xref="GOA:A0B5I8"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5I8"
FT                   /protein_id="ABK13962.1"
FT                   /translation="MITVFFDGLCSPKNPGGVAAYGYLVYRNGELLHRGWGVVGEGSGM
FT                   TNNVAEYEALLAAIRWIQKNAPGERVVFKGDSNLVIKQMSGEWRVRSHTSKRYVPIIKS
FT                   MLEGIEHEFVWVPREENAEADALSKHAYEIYRRGQRSG"
FT   gene            complement(156067..156654)
FT                   /locus_tag="Mthe_0163"
FT   CDS_pept        complement(156067..156654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0163"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mba:Mbar_A1822 iron-sulfur flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13963"
FT                   /db_xref="GOA:A0B5I9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5I9"
FT                   /protein_id="ABK13963.1"
FT                   /translation="MAMVLGISGSPKSGRNTEYLLQRALRVASERGYRTESVLCSRLRV
FT                   GFCTDCGECSKGKPCPIDDDMVKIYELLQNADGIVVASPVYFGSVTAQLKAIFDRTLPL
FT                   RRQGFRLRDKAGCAIAVGGSRNGGQEKTIEAIHAWMHIHGMIVVGDNSHFGGIAVRPAE
FT                   NDDVGISTVEATASKLCDLLDLKKKGGCWSSE"
FT   gene            complement(156672..157068)
FT                   /pseudo
FT                   /locus_tag="Mthe_0164"
FT   gene            complement(157499..158101)
FT                   /locus_tag="Mthe_0165"
FT   CDS_pept        complement(157499..158101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0165"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   mma:MM2374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13964"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J0"
FT                   /protein_id="ABK13964.1"
FT                   /translation="MIDLEGARDISVEALAERIKAIGFRCRRCGDCCRGPDAEVLVFPS
FT                   EVRRIISYTNLTWLEVVEPPKTGVWDVDGDFHTLEWMLRRSENGCAYYDATSGSCRIYP
FT                   VRPDICRTYPFYLDGDVLRVSECRGLGLEMDYDEALRIAEDLKRRLISEIMEEREARSR
FT                   FSKFVVADRPEKPTGVCVVHDGEGAHRVPLGISEPDG"
FT   gene            complement(158098..158643)
FT                   /locus_tag="Mthe_0166"
FT   CDS_pept        complement(158098..158643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0166"
FT                   /product="GMP synthase, small subunit"
FT                   /note="TIGRFAM: GMP synthase, small subunit; PFAM:
FT                   glutamine amidotransferase class-I; KEGG: mba:Mbar_A0919
FT                   GMP synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13965"
FT                   /db_xref="GOA:A0B5J1"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5J1"
FT                   /protein_id="ABK13965.1"
FT                   /translation="MKILVVNNYGQFNHLIYRSIKDRVEARMISNETPVEDIVADGLIL
FT                   GGGPSMDRSGRCSEYLRTLDIPVLGICLGLQIMAVTFGGKVEPGKVGGYASVEIEVLEE
FT                   DGILRGVPHRFMAWASHADQVTICPPEFRVIARSSICDIEAICHESRPLYGVQWHPEVA
FT                   HTEYGEEVFDNFLEICRR"
FT   gene            158849..160366
FT                   /locus_tag="Mthe_0167"
FT   CDS_pept        158849..160366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0167"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: chy:CHY_0283 phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13966"
FT                   /db_xref="GOA:A0B5J2"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J2"
FT                   /protein_id="ABK13966.1"
FT                   /translation="MRPVVLIIMDGYGLSEETEGNAVAGAHKPNLDRLKSQYPHTSLGA
FT                   SGLDVGLPRGQMGNSEVGHLNLGAGRIVYQDYTRISLAIEQDRLKDAKQLVDAMVKARD
FT                   SGRNLHLMGLLSDGGVHSHITHLFALLDMAKELGAKKVYVHPILDGRDVPPRSALTYVT
FT                   QLEEKLTRIGIGRIATISGRYYAMDRDKRWDRTEAAYRAMTEGLGIHAATAVEAVRLGY
FT                   DRGETDEFLTPTVIDPNGLVREGDSIIFFNFRPDRARQITRAFVQPDFNEFERRYLRPF
FT                   FVCMTQYDESIDAPVAFPPEYLKETLGEILSKAGLTQLRIAETEKYAHVTYFFNGGREE
FT                   PFPGEDRILIPSPKIPTYDLKPEMSAPEVTSTVVERIKSGKYDVVIMNYANPDMVGHTG
FT                   IYEAAVRAVEAVDRGVGMVVDEVLSRRGIALITADHGNAEKMVDRSTGEPHTAHTTNRV
FT                   PFILVGCDRGIVLRDDGILADVAPTILALLGIEKPESMSGRSLIKKD"
FT   gene            complement(160370..161011)
FT                   /locus_tag="Mthe_0168"
FT   CDS_pept        complement(160370..161011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13967"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J3"
FT                   /protein_id="ABK13967.1"
FT                   /translation="MRITVILALLLLFALAGAAHAGCPTGTGGVNWLGGYEIGSDTGTP
FT                   VGFERPNMGMPNPVTKPDMSMPEPGPIKTTSAAGNASATNESNTTAESIDAVEQRAQIN
FT                   LSGSWSMNLSDGRHVELLLYPVGTVFYGTGALIEGNSTIPLKARGSVGEDVRLDLIQVF
FT                   DGERYREDVLYKLTLVQENNTISGSYSRFGTNGDAAIVTDTGTVTDVVHL"
FT   sig_peptide     complement(160946..161011)
FT                   /locus_tag="Mthe_0168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.694 at
FT                   residue 22"
FT   gene            161545..161817
FT                   /locus_tag="Mthe_0169"
FT   CDS_pept        161545..161817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0169"
FT                   /product="translation initiation factor 1A (aeIF-1A)"
FT                   /note="KEGG: mac:MA0895 translation initiation factor 1A;
FT                   TIGRFAM: translation initiation factor eIF-1A; PFAM: S1,
FT                   IF1 family protein; SMART: Eukaryotic initiation factor 1A
FT                   (eIF-1A)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13968"
FT                   /db_xref="GOA:A0B5J4"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J4"
FT                   /protein_id="ABK13968.1"
FT                   /translation="MRVPRKQNREVFGYVESLLGSNRIKVRCMDGQTRIARIPGKMKKR
FT                   IWIREGDVVIVVPWEFQDDKADVIWRYTGPQVDWLERKGYLKSTL"
FT   gene            161814..162611
FT                   /locus_tag="Mthe_0170"
FT   CDS_pept        161814..162611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0170"
FT                   /product="protein of unknown function RIO1"
FT                   /note="PFAM: protein of unknown function RIO1; KEGG:
FT                   mma:MM2013 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13969"
FT                   /db_xref="GOA:A0B5J5"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J5"
FT                   /protein_id="ABK13969.1"
FT                   /translation="MKRRKEEELDARIDLFRRRIKDANDLKVRDDVFDTRTLMNLYYLS
FT                   KKGYVEALGGSISRGKEANVFHALGRGGKHLALKIYRVATSDFKAMQDYILGDPRFRSV
FT                   KGNKRSLVNAWTRKEYRNLLRAEEVGVRVPHPYAVRENILVMDFVGTDGAAAPLLREVA
FT                   LEGEEAERAYRRIADYIVLLHNRAGLVHADLSEFNILYDGEPVLIDMGQAVTLDHPNAM
FT                   EFLKRDISNLVRFFRERYGIGSEDDIWSRIASEEKDAQMERGS"
FT   gene            162612..163136
FT                   /locus_tag="Mthe_0171"
FT   CDS_pept        162612..163136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0171"
FT                   /product="KH, type 1, domain protein"
FT                   /note="PFAM: KH, type 1, domain protein; SMART: KH domain
FT                   protein; KEGG: mbu:Mbur_0948 KH type RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13970"
FT                   /db_xref="GOA:A0B5J6"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J6"
FT                   /protein_id="ABK13970.1"
FT                   /translation="MNIKIPSDRIGAVIGPNGETKRYLEERCSVSLDIDSESGAVTVTS
FT                   QGDALDAMRAIDVLRAIARGFSPERAFALLDDDMLMLDILDLSSLAATKNDLIRIKGRI
FT                   IGKDGKTRELMESLTGARISVYGKTVSIIGYPEQIKVVRSALEMLIDGAPHGNVYSFLE
FT                   KKRRDLLEMEL"
FT   gene            163138..164694
FT                   /locus_tag="Mthe_0172"
FT   CDS_pept        163138..164694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0172"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mbu:Mbur_0248 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13971"
FT                   /db_xref="GOA:A0B5J7"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J7"
FT                   /protein_id="ABK13971.1"
FT                   /translation="MDFSSEQWIILIVLALGLLSLLGTALGGGRGISSWGPVIFVRTTR
FT                   GLGLLDRLAGARSLWRLTTTIFMPIVMAGMIYFLLLLLLMVYVMWRAPPEPGSYSAPRN
FT                   VLLIPGVNQYIPLVWGWIALCVTIVVHELSHGILCRVEGIRVKSMGLIFLLFPIGAFVE
FT                   PDDSELFGDEKNPPKATCQARIRILSAGVIANFLVAALALSLFFGPVISALSPVDRVVV
FT                   VDVDPESRFAGDVRAGMVVSGASSLEELYRIASEGRSLELFDDTSRAIISGEPVLGVQV
FT                   VDTFDGSPAKDAGMPERFVITDINDTRVDSLESFRDYMNSTYPGQILKINTTKGSYSVK
FT                   LAPKGDGTGMIGVAISGTALYLDGVTFQELQPERFLALMRSIPSSGLKGFNTLMGLPFT
FT                   GVVGFTSDGFQGFSGSMLYLFEPAGWAEPLGGKIFWIANLLLWIGWINMYAGLFNCLPT
FT                   IPLDGGHIARDMIRMLLDKVMSERSAERFTRGIVAALSWLVISSLIFTVLGPYLAHGIP
FT                   L"
FT   sig_peptide     163138..163242
FT                   /locus_tag="Mthe_0172"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.701) with cleavage site probability 0.451 at
FT                   residue 35"
FT   gene            complement(164641..165648)
FT                   /locus_tag="Mthe_0173"
FT   CDS_pept        complement(164641..165648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0173"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase; KEGG: mma:MM2511
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13972"
FT                   /db_xref="GOA:A0B5J8"
FT                   /db_xref="InterPro:IPR002756"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J8"
FT                   /protein_id="ABK13972.1"
FT                   /translation="MILGVDIGGANTKAASSDGRFSEIRYLPLWKKAPLSEHLEELSTR
FT                   LEPDAVGVVMTGELADCFECRRDGVLFIASEVERAFECPVHFWGLSGFHRSVSREMALD
FT                   LAAANWSASAALLLKDVGSCILADMGSTTTDIIPVMDRPLSGCTDLERLLRGELLYTGL
FT                   LRTNLAALLPGVELFGGSVPLSSELFSITADVYLALGDIEPDAYTCETPDGGPKSLKGA
FT                   LRRLARTVCSDLDELGEDGALSIAAQAKSRQISIVSTGISRIAERHKIRRVVAAGVGEF
FT                   IVEDACERAGLECIRLSEIYTERLSDVFPAFAVARLLSERYPMSQVRAENCEYE"
FT   gene            165718..166806
FT                   /locus_tag="Mthe_0174"
FT   CDS_pept        165718..166806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0174"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: mhu:Mhun_2329 coenzyme F420
FT                   hydrogenase/dehydrogenase beta subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13973"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5J9"
FT                   /protein_id="ABK13973.1"
FT                   /translation="MAAKEMYPEPTFLECGFADLDYKVVQRGICCLCGTCIALCPRIGQ
FT                   QNRKPTLMEYDPLCGLCYAYCPRSFFDMPFFEKKLFGRSRASEEVLGIYRSAMAARATP
FT                   VRGKVQDGGVVTALLVHALETGVIDCAVVTDRNSRWQTTPKVATTPEEIIAAAGTKYTI
FT                   APSIAGVQMAINSGFTKIGFTGTPCQIQALRKAQLLDEPYQFGQERIALMIGLFCMENF
FT                   DYQRLMTGLVKEKMNLQPTDVERFEIQRGMFRVISKEGTKEVPLQETDEFTWPGCGPCF
FT                   DFTAELADVSVGSVGSPGGWSTVLVRTDPGESIYRSALSAGVIEEKALTDKGMALVKRL
FT                   ASEKVSRFEDYASRCKLDIRRI"
FT   gene            166860..168032
FT                   /locus_tag="Mthe_0175"
FT   CDS_pept        166860..168032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0175"
FT                   /product="GTP-binding conserved hypothetical protein
FT                   TIGR00650"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; TGS domain
FT                   protein; GTPase of unknown function-like; KEGG:
FT                   mba:Mbar_A1073 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13974"
FT                   /db_xref="GOA:A0B5K0"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5K0"
FT                   /protein_id="ABK13974.1"
FT                   /translation="MLSIGLAGKPNAGKSTFFKAATLADVEIANYPFTTIDANHGVSYV
FT                   RVKCPCVELGIEGGCGRCINGSRFVPVELIDVAGLVPDAHLGRGLGNEFLDSLRLAEVV
FT                   IHVLDASGSTDAEGNPVGIGNYDPLKDVEFLKREISMWLFGILERNWTKLMRQYTSEKA
FT                   KPEQIIYEQLGGAGVSDKDVRWALSRMDSDPATWSEDDLRRFAELLRQSSKPMIIAANK
FT                   IDLAPRENIRRLMELDEIVVPVSGAAEIALRMADKAGVIRYLPGDPDFEIVGELNRAQK
FT                   AGLDKIRVLLKEYGSTGVQECINRAVFDLLDYITVYPVEDENKFTDRDGVVLPDAFLMK
FT                   RGSTARDLAYRVHTELGESFLFAIDARRKLRVGEKYELKDGDVIKIVATK"
FT   gene            complement(168241..169659)
FT                   /locus_tag="Mthe_0176"
FT   CDS_pept        complement(168241..169659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0176"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein; KEGG: mbu:Mbur_1654
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13975"
FT                   /db_xref="GOA:A0B5K1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5K1"
FT                   /protein_id="ABK13975.1"
FT                   /translation="MDDVIIGLEIHVQLNKLRSKMFCGCSTGYHDAPPNTHTCPVCLGL
FT                   PGSLPVINRRAVEFGIKVALALNCSIAEETMFYRKNYYYPDLPKGFQISQYDYPLATGG
FT                   YVLIKGDDGQERRIRITRVHMEEDPGRLVHAGTIDRARYTLVDYNRCGMPLLEVVTEPD
FT                   LRSPKEARQFLDKLRTILEYLDVFDGNLEGSLRVDSNISLAGGDRVEVKNISSHKGVEK
FT                   ALSYEITRQRNLKRRGIEVVQETRHYDELRGVTVSIRTKEEAHDYRYFPEMDLVPLRIA
FT                   DWVPRVRAELPELPDAKRERFREQYGISDDHAKSLTSEIKVADFYEWVAARSDPRLAAV
FT                   WIADVLKGELNYRNLTIDSFKRESMLEIVRMLSDREITDEVAVTVIRTILDRGGSPREL
FT                   VESMGLKRADDDYVVQAVREAIADSQEAVRDYLSGNTRAINYIVGQVMKRTKGRADPSV
FT                   AHRLVREEIERQMC"
FT   gene            complement(169659..171074)
FT                   /locus_tag="Mthe_0177"
FT   CDS_pept        complement(169659..171074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0177"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: mma:MM1227 glutamyl-tRNA(Gln)
FT                   amidotransferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13976"
FT                   /db_xref="GOA:A0B5K2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5K2"
FT                   /protein_id="ABK13976.1"
FT                   /translation="MLLQLKDEIRSGSAEEYLHRLFERIERSRLNAFTTLAKESALEAA
FT                   REFDARPWGGALAGIPVAIKDNICTRGIETTCSSRILKGFIPPYDAHVIERLRAEGAII
FT                   IGKTNMDEFAMGTSTETSCFGPTRNPWDLERVPGGSSGGSAAAVAAGEAPCALGSDTGG
FT                   SVRCPASFCGTVGMKPTYGLVSRYGLIAYANSLEQIGPITKTVEDAALLLDVIAGHDPR
FT                   DSTSIASEGNYLSSIGRDIRGICIGVPEEYFGEGVDPGVERAVWDAVSVLEGLGASWRK
FT                   ISLPHTKYALPAYYIIAMSEASSNLARFDGLRYGLRVGEDKDWHTTFSEIRAMGFGKET
FT                   KRRILLGTYALSAGYYGRYYLKALKVRTLIKRDFEHALNKVDIIASPTMPFPAFKIGER
FT                   ITDPLSLYMSDVFTVPINLAGIPAISVPCGFSDGLPVGLQLMARPFDEALLLRVANAYE
FT                   QATPYHLRSPEVV"
FT   gene            complement(171077..171358)
FT                   /locus_tag="Mthe_0178"
FT   CDS_pept        complement(171077..171358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0178"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase, C subunit;
FT                   KEGG: mbu:Mbur_1656 glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13977"
FT                   /db_xref="GOA:A0B5K3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5K3"
FT                   /protein_id="ABK13977.1"
FT                   /translation="MITIKDVEHISWLASIRVSEEEREELVAQFNTILDYFQQLDEVDT
FT                   EGVEPTYRVVDLANVFREDVPRDSLTQDEALRNAPRREEGYFRSPRIV"
FT   gene            complement(171576..171809)
FT                   /locus_tag="Mthe_0179"
FT   CDS_pept        complement(171576..171809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13978"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5K4"
FT                   /protein_id="ABK13978.1"
FT                   /translation="MSDKRIHLSFTDRHKYRMEFEPAEFWKPLADVYEGVEWSIGDEYI
FT                   SVIAENYSYLLDLLVHARQFYLRSMPFEERFR"
FT   gene            complement(171806..172432)
FT                   /locus_tag="Mthe_0180"
FT   CDS_pept        complement(171806..172432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0180"
FT                   /product="translation initiation factor 2 subunit beta
FT                   (aeIF-2b)"
FT                   /note="TIGRFAM: putative translation initiation factor
FT                   aIF-2, beta subunit; PFAM: Translation initiation factor
FT                   IF5; deoxyribonuclease/rho motif-related TRAM; KEGG:
FT                   mba:Mbar_A1372 translation initiation factor 5"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13979"
FT                   /db_xref="GOA:A0B5K5"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5K5"
FT                   /protein_id="ABK13979.1"
FT                   /translation="MEDYLEGLERAMRSMPAAKGTKERFQIPVPRIFYEGKTTVLDNFA
FT                   AIADALNRDPDHLMKFLLQELGTAGKIEGHRGVFQGKFTEQAIQNQIAAYVDEYVICSE
FT                   CKLPDTHLIKSDRVLMLKCDACGAHRPVKKRKAKAVVARDVIEEGETYELRIESVGSKG
FT                   DGIAKVDKYLIFVPNTSKGEIVKAKVKKISGTLAFAEIVERKGKA"
FT   gene            complement(172446..172958)
FT                   /locus_tag="Mthe_0181"
FT   CDS_pept        complement(172446..172958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0181"
FT                   /product="LSU ribosomal protein L10AE"
FT                   /note="TIGRFAM: ribosomal protein L10.e; PFAM: Ribosomal
FT                   protein L10E; KEGG: mhu:Mhun_0088 ribosomal protein L10.e"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13980"
FT                   /db_xref="GOA:A0B5K6"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5K6"
FT                   /protein_id="ABK13980.1"
FT                   /translation="MEEYYLARKPGSMYRRIERPYTRREYIGGVPGSKVVHYDMGNLTE
FT                   EFPVKLSLVVREPCQIRHTALEAARVAANRYLLKTLGRNDFHLKLRVYPHHVIRENKQA
FT                   TGAGADRVSSGMRRAFGKPVGTAAQVYTGQRIFTLGVHPEHIEEAKTALRRAGHKLPSP
FT                   VQIIVGS"
FT   gene            complement(173252..177574)
FT                   /locus_tag="Mthe_0182"
FT   CDS_pept        complement(173252..177574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13981"
FT                   /db_xref="GOA:A0B5K7"
FT                   /db_xref="InterPro:IPR001769"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5K7"
FT                   /protein_id="ABK13981.1"
FT                   /translation="MRAIFIATLLLLLISQAGAVFERGVKSDTDEMILVGEQDWHAVVA
FT                   SVPLSTWSEENTTVVRPMLILPREVNAGRRLGWVEGTDLERYGMDAILQTMTSGNVSAL
FT                   IIHGSGEDVKTLVKTAQKQGMKTYMTVSLEPESDEERWTSTTLVNANDSTLAGMIRDAF
FT                   RGVELRKRLEEGNDTEIDGYSLDANGNRGSLLCPVNPNVREDLYARIEEIIDEYKVDGI
FT                   VLYRFGFDGEDYCFCDVCKEEFYRDTGLDLTRIRSSGYNYQKWLSWREQKVLEIAREAR
FT                   NITRNLGPVELGVAIDEPFDKSKGYNLYDLSSVSDFVVVSSVPVQDAELAARVTDTPIY
FT                   VRLSDDYVEYMLSTQNVEGALNYIESLIKSECDGMVFEYNVVYTPLWSELEPPSKAAQW
FT                   LIKELGMRTLGIGDVSWACNDTIRYNSSEELAVLLSSRWSSSPGVVLVGDNYTAGIQAA
FT                   TIASYLNWPVLFFSSNISNTTLSEIERLGCRDAIIAGDAPSDVVKMLEEMNVTVHRGDL
FT                   DLLLGEMRARNDSVRSIVLTNSHDISLIPPKPESRIKRAFVKDLWISVETIPASIPSEE
FT                   AGEVVRMNITLRNTGTEPLEGVSLVDMFANGRYVRMPIYYKGKLAITDPISKEPSDPAG
FT                   AFFNGSILTWDLEKLDPDESVSLNLEVVVLHPMDAGWVQPLDRGMTVRYTGLAENVTVE
FT                   TESDGPVSEITYPGEMPVGTAIVTWNVSEPHSYTALRLFSPHGLIGYVRFGAGSDGYRA
FT                   VLPMPEPGRWLFNIEVGGGTEYRTKNMSIEVRSTLPPNNVTAFSHTKVPKLSLASMQVA
FT                   AAKRAIVMDVAKDPQYVDPGEVEEWLRESVGEKKLRPEYLLVVGDPGSLPFPTTGVKQE
FT                   LEGDPISYDVYRDYRIEMDDDNYTEVATGRFIGLSVYDVSQMVARTLSYERLHGDWKNT
FT                   SLVVATPVEWPWSPVPIRIKEYLADAGLNSRDLRWEEATFQRVSAFMNNGVGIVHFDHH
FT                   GSEKGWALSSWSMTDSFLDETQVKQFVLAPQLTTSNSCLSSRLKGFSINVSGTEMYIPM
FT                   RLDDSIALAFVRAGAVGYVGSSALVWIYVSEDYNKRFYQALVFENATAGEALSQAENLY
FT                   IMKMKGAEKISFERIEEMLPPWEYSMKEMMNQTASSFMLFGDPEFRPYLPETPELPYRV
FT                   DEVSGNDTVAVSVAPITEQATDWLYWLGVDSTDGEVSLNAPPAIIAEVLLPRDAEEVVV
FT                   KEGSRVVWHAEDVAGENRRVMWPVINPRLGETRSFSVEYRVIPEELQIINITVGWNAVS
FT                   IYVNPKDARVEKYLKGKPYRGIFTVTDDEWSYSLKDSTITNITAFEPGMGYIIDSYDDF
FT                   TIKIPGKPVERPYRLKLTAGWNLIGLPVNESLAPMNITVNTEHRRYSFSEAVEKGLISA
FT                   FMWKYEDGEWKPLKMDEPMEPGRAYLMEVTKECRLEFS"
FT   sig_peptide     complement(177491..177574)
FT                   /locus_tag="Mthe_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.936) with cleavage site probability 0.845 at
FT                   residue 28"
FT   gene            complement(177574..179133)
FT                   /locus_tag="Mthe_0183"
FT   CDS_pept        complement(177574..179133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA1537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13982"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5K8"
FT                   /protein_id="ABK13982.1"
FT                   /translation="MKPIYLILIMLLLSGIASAQLEPDRERFDIEIHPGEVIHKVLTLT
FT                   NTGEEPVSRIRTTAVGGDAKDMIMIDIPKKAIDPGDDMDVDIFFMAPPETKPGLYTGFF
FT                   YIFDETAPPALPIAISFNLNVIEKDSYNVGLYINDAKEVSGEVTPDEPVEFDLEVRNTG
FT                   RFRDLIEVYIPEVPAGWQPRLYDGDEEIDLPYSLALPSGSSHHLTLKVEVNENARSGSM
FT                   RIVGESQGNRSKNASVTVNLDVGVVVKGYDVRIDIPKQVIVNRSYEGRITLFLENNVRV
FT                   MVDAISDPSLLIVPSSMVLDIDGKFGSANFTLIATEPSGYAIVFRMVDTNGVPFPPEVV
FT                   YLEAVEPSGLAVITSADPRYMAVASLLSGNNTTVPVIQVEDRVSKDIMDMLLPYSDVII
FT                   LGSESEVSSKIESELSGFNVSRIAGSDLAETSWILADKMWSNQTAVVVSGPSEIDVFRS
FT                   YQIAKRSGLPLVVCGDELTDSITTSIKSMMAKGLEKAIIASGVSDSVVTSLKVMGLSVE
FT                   VS"
FT   sig_peptide     complement(179074..179133)
FT                   /locus_tag="Mthe_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.915) with cleavage site probability 0.906 at
FT                   residue 20"
FT   gene            179435..180505
FT                   /locus_tag="Mthe_0184"
FT   CDS_pept        179435..180505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0184"
FT                   /product="Protein of unknown function DUF1297"
FT                   /note="PFAM: Protein of unknown function DUF1297; Protein
FT                   of unknown function DUF1246; KEGG: mba:Mbar_A1334
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13983"
FT                   /db_xref="GOA:A0B5K9"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5K9"
FT                   /protein_id="ABK13983.1"
FT                   /translation="MISKEEILEILNGYDLKNITIATVCSHSSLQIFHGAKQEGFRTLG
FT                   ICIGPPPRFYDAFPLAKPDAFISLDSYKAMLDESDRLIDENAIIIPHGSMVEYLGIQNF
FT                   EALPVPTFGNRRCLAWESDREMEREWLLRAGVNVPMRFENAELIDRPVIVKYHGAKGGK
FT                   GFFIAKNKEEFQSKIQQGQKYTIQEFILGTRYYIHFFYSPIREKGYRLRKGTLDMLGID
FT                   RRVESNADEIFRIGSVNELEAAGIYPSFVVTGNLPLVLRESLLPKVFDLGERVVETSIE
FT                   LFGGMVGPFSLETIVTDDLDFKVFEISARIVAGTNLFISGSPYSDLIEKGLSTGRRIAQ
FT                   EIALARSMGALGEVIS"
FT   gene            180788..181981
FT                   /locus_tag="Mthe_0185"
FT   CDS_pept        180788..181981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0185"
FT                   /product="sugar phosphate isomerase involved in capsule
FT                   formation-like protein"
FT                   /note="KEGG: pab:PAB1222 D-arabino 3-hexulose 6-phosphate
FT                   formaldehyde lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13984"
FT                   /db_xref="GOA:A0B5L0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L0"
FT                   /protein_id="ABK13984.1"
FT                   /translation="MSGLFEIFREATLLQCGFLEKLLRLDMSEVASFSESLASFLSDTE
FT                   RNKFVYGLAAGRSALSLYSFLQLLQNHFDNIFPCTLEDPVQRHFNPRKMNLGIAVSGSG
FT                   ETPSVNKYIEDVMGQGGEIKLITANRNGTAYRLVEDYKNGTILVIEGRTKYSTDKERRS
FT                   RLSPLGTEFELEVLAFLNALFKDIQARLDGHHDDRCPEYCSTIQDFEENGRLIADMDQE
FT                   HLERWFGRLFPRSGRYVIGGVGRSGLVARAFEMRFTHLNKISYWERDFNTPSFQIGDVY
FT                   IPITGGGNTYEALEGARNAFRNGADVMPITANSGSNLMALVREKGRLDDVVFIPVKKDY
FT                   EGLFKGNRSTTSWLVSEFTKYRYPIFEINTSIFTNSVVAVGAEFLGIVEAGMRRLHV"
FT   gene            182023..182562
FT                   /locus_tag="Mthe_0186"
FT   CDS_pept        182023..182562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0186"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: mma:MM0290 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13985"
FT                   /db_xref="GOA:A0B5L1"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L1"
FT                   /protein_id="ABK13985.1"
FT                   /translation="MKILLISDTHLDRISEELLKTLSGYDMILHAGDLVSMEVYTDLKT
FT                   LGETHAVAGNSDHPDVRRSLPERLKLDIEGLRVGIIHRPSHSPDSPGISLMAREMDVDL
FT                   LVFGHFHKPVFERDGSRMMVCPGSPTCPRLSPPSVAELLVEGGRASIRIVPVGRPMCGY
FT                   LRFAETLYLNGSSGQC"
FT   gene            182974..183240
FT                   /locus_tag="Mthe_0187"
FT   CDS_pept        182974..183240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afu:AF1663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13986"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L2"
FT                   /protein_id="ABK13986.1"
FT                   /translation="MTLKRDKLSIISEILQKCIGGATKTAIVYQVNLNFKTVNPYLDLL
FT                   IARGLIEISQGSTVTYTTTEKGIKLLEDLKRVHDVLKETSEQD"
FT   gene            complement(183448..184128)
FT                   /locus_tag="Mthe_0188"
FT   CDS_pept        complement(183448..184128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0188"
FT                   /product="Suppressor Mra1"
FT                   /note="PFAM: Suppressor Mra1; KEGG: tko:TK0876 ribosome
FT                   biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13987"
FT                   /db_xref="GOA:A0B5L3"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5L3"
FT                   /protein_id="ABK13987.1"
FT                   /translation="MISMLLADSELELVPREIVGYPAVRLNARKRNKSPAKSILDASLH
FT                   HSAMRALPMGDRRGRPDIVHVFLLVALESVLNRVGQLRVYIHTRNNEMITIDPTTRIPK
FT                   NYPRFVGLMESLFEKGSVPEREPLIVMQRDRDIGACIGEIPHEKVILLSPKGRRVRLSD
FT                   YVKECDNALFILGGFPKGEFISDVLSEADDTISIYEESLSVWTVASEILVNYENHVLEA
FT                   SAPS"
FT   gene            complement(184368..185105)
FT                   /locus_tag="Mthe_0189"
FT   CDS_pept        complement(184368..185105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0189"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mbu:Mbur_1954 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13988"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L4"
FT                   /protein_id="ABK13988.1"
FT                   /translation="MRVVMLGTGDAIGTPKIGCRCPTCVDALNGGRSRRLRFSILLEND
FT                   EGRVLIDTSPDLRWQLIKMGISKVDAVIWTHAHYDHYAGFGDFHRVQNHVPVYATRSTL
FT                   DYVISYLYFLRPQRHDVEPLEPFEIAGMEFTLFEVNHPPVETMGVLVSAGGKRVVITSD
FT                   TNDALSEESLDIMRDADLFIADAIMPPGYKLNKHMNADEAISLAHRLNARQTVLTHLSH
FT                   LYPPHDEAVKRWPLAHDMMSIVL"
FT   gene            complement(185102..186379)
FT                   /locus_tag="Mthe_0190"
FT   CDS_pept        complement(185102..186379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0190"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mma:MM0854 cell division cycle protein 48
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13989"
FT                   /db_xref="GOA:A0B5L5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L5"
FT                   /protein_id="ABK13989.1"
FT                   /translation="MGSEIPGSVEVTELLLTAEIYNRFESLTEDDLPSRIRKHYFDPEH
FT                   RGVKRPIYVTISDVEKIYSINDVRSIAKRLPFIDIEEFGSQLRLTVFDLGARWFAREGI
FT                   ERVRSNPVLAYYYENYDHLDVSYAEARRANKPRFADREWIEARIKELQESVQDSEDMLK
FT                   LVQIKSPEDIRERIGDLVLTDEQRAEISKIEKAIEHREYLRRVGLREIGKSLFVGSPGT
FT                   GKTTTARAIAEWLGLPLIEVRLSMITSQYLGETSKNIDKVFDLAKRLSPCVLFVDEFDF
FT                   VAKTRTSDEHGAIKRAVNTLLKAIDEISLVEDGVLFIAATNHPQLLDYAAWRRFDKVLD
FT                   FPLPDELMRRRILEKILSKIDAEVDIDEIASLTDGYSGSDLRLVVREAMLNALLEDRKT
FT                   LKHIDLLRAIEDFEHRIREHRGRVAL"
FT   gene            complement(186515..187120)
FT                   /locus_tag="Mthe_0191"
FT   CDS_pept        complement(186515..187120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0191"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family; KEGG:
FT                   bca:BCE3427 lipase/acylhydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13990"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L6"
FT                   /protein_id="ABK13990.1"
FT                   /translation="MSQFTRRTVNALRSGCDVVIVAFGDSITAGYAVRHGFPYFWKQAL
FT                   QEKYPDARIEMHNEGVSGDTTRDGLARLEHSVLYHRPDLVTINFGINDAAYGIGLDEFR
FT                   ANLSRMVEIILSECCSEIILLSSQPLLTPYYDKLVLDYYSAIGEVAAAMGVGFVDVYAA
FT                   WMVRVRSGMPLESLVLPGLDHPNEDGYRIIAEELMKLF"
FT   gene            complement(187117..187920)
FT                   /locus_tag="Mthe_0192"
FT   CDS_pept        complement(187117..187920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0192"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: mbu:Mbur_0109 tryptophan synthase, alpha
FT                   subunit; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13991"
FT                   /db_xref="GOA:A0B5L7"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L7"
FT                   /protein_id="ABK13991.1"
FT                   /translation="MTPSDMSLYEVFRRCRPLIVYICAGDPSPDETVDIADRIVRAGAD
FT                   VLELGLPHSDPIADGPVIQAASQRAIAAGMNTDLYFDVASKIDGVPKVFMGYYNMVYRR
FT                   GLERFVSDCRASGICGMIVPDLPMEESRPLREVTSRHGVDLINMIAPNTPDKRIRDIVS
FT                   TSSGFVYLVARSGVTGARADLQESTKHLVERVPPVIPRAVGFGVSRPEHAAELVRAGAD
FT                   GVIVGSACVDLIGKKELDQLEDLIRSMKKAISEVSVKSAASIHQS"
FT   gene            complement(187907..189091)
FT                   /locus_tag="Mthe_0193"
FT   CDS_pept        complement(187907..189091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0193"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: mbu:Mbur_0108 tryptophan synthase, beta
FT                   subunit; TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13992"
FT                   /db_xref="GOA:A0B5L8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L8"
FT                   /protein_id="ABK13992.1"
FT                   /translation="MDEISCEVRFGRYGGRFVPETLVQPLLELAEAFERLRADPGFSEE
FT                   LSRLMRDFAGRPTPLYRAENLSRALGRTVYLKREDLLHGGAHKINNTLGQGLLAKYMKK
FT                   RRLIAETGAGQHGVATAIVGALLGFETEIYMGELDIERQRMNVFRMELLGARVIPVKSG
FT                   SRTLKDAINEALRDWAASYESTHYLLGTVAGPHPYPSMVREFQRVIGDETRSQILAEEK
FT                   RLPDSIVACVGGGSNAMGIFTSFLEDAVRLIAVEAGGRGSGRGARSAEHGASLALGEPG
FT                   VLHGAMTKILQDPYGQILESYSIAAGLDYPGVGPELAHLAETGRVETAMASDETAIMGF
FT                   KALSRLEGIIPALESAHAVGFAIEHPEVLGELSVINISGRGDKDLHTVMAHDSV"
FT   gene            complement(189364..189600)
FT                   /locus_tag="Mthe_0194"
FT   CDS_pept        complement(189364..189600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13993"
FT                   /db_xref="GOA:A0B5L9"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5L9"
FT                   /protein_id="ABK13993.1"
FT                   /translation="MFGFYPQIIKMYRTKLVGDLSLPMLLQYTTGIFLWLLYGIYLENT
FT                   ILIVSNAVSLASFLCGIILYLKYNAGHRVLSNR"
FT   gene            complement(189663..190013)
FT                   /locus_tag="Mthe_0195"
FT   CDS_pept        complement(189663..190013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13994"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M0"
FT                   /protein_id="ABK13994.1"
FT                   /translation="MNACRRVTAALLLLFSLQSAIAEIQGNASYGERFQSVSGDFGRAW
FT                   LMSNINTTSNVNTSSDLWSWGGVPRGWKLVNGVLVRDTNSTQTQIGSDWLGSTTDSLYT
FT                   MAYNESSWIPPF"
FT   sig_peptide     complement(189945..190013)
FT                   /locus_tag="Mthe_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.544 at
FT                   residue 23"
FT   gene            190185..191054
FT                   /locus_tag="Mthe_0196"
FT   CDS_pept        190185..191054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0196"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sso:SSO3220 transposase ISC1058"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13995"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M1"
FT                   /protein_id="ABK13995.1"
FT                   /translation="MAYEDNRNWREYNEKLVRRGWFYLSTDFVNNWDEELLKMNKNKNG
FT                   RPYRYPETFIQFCGLAYAFLHLPYRQLEGFIQALSGFVPGLLAADYSTLWQRITNLELN
FT                   IPIPDNDLVVAVDSTGMKVTNRGDWMRESHGVERRGWIKVHIAVDVETRKPVTFEITDE
FT                   TVTDHEMVKPLLEDVKLEDSLMDGAYDKEGVFDFMKEKGVDMPGIKIRKNAIVKAGSSR
FT                   AEPVLEFMKYGYHSWKIVHGYGRRWAAESVFSAIKRIFGETVRATSKEGMIREVRRMFT
FT                   FYTIILSV"
FT   gene            191132..193519
FT                   /locus_tag="Mthe_0197"
FT   CDS_pept        191132..193519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0197"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; KEGG:
FT                   mac:MA0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13996"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M2"
FT                   /protein_id="ABK13996.1"
FT                   /translation="MIVGGKTIRLEAILVILFFVLTGGACASAVTADQHLSRDVISPSE
FT                   ISTVTITLRGGEIPCASPVDVVLSIDSSGSMTTSDPGDLRKSAAKEFVTGLDLSMDRVG
FT                   VVSWNTSAISWPLTNNTKDIESAIDSTGADGNTCLDTGLKSAIDLLSECSGSKVIVLLT
FT                   DGISTDGGHYTPPGVPGSPVDEARSKGILVFTIGLGPDADARNLTEIAHSTGGEFYSAP
FT                   DANALAGIYKRIRSSITGIVAKDVTVTYVLPSSMNVNLSPYSGSQPVATVRNEGDSTVL
FT                   TWRMGTIQANQSRMLSFDVSSPDPGTFILGSAPDTAVSYTGCDNLRSAVAIPPATLKVS
FT                   PPGAFGLEGSGIGGSNRSVVQNISVLSVSKEVLPNGNAPCPDCPMLKITLDAPEKSCSA
FT                   DILFVIDKSGSMRDLDKSGLKNYEIMQAALYEMLNMASNTPELRNARIAIVSWDDLDGT
FT                   DEDRITTLDPQWLAVGDPRIKATIQQYNEETCKETDLTFYETGLQKAMQIMHSRILSQA
FT                   NDPLSCDTRRFIIFITCRSEFKGITPSSVLYTIPRNNTLIRGGFEGIFPFYIGKDLSEY
FT                   PLEQQNLTLIAQYGDPMQRGAVRPESLTAENLISRVLERMNGCGQGAWVINVTLTETLY
FT                   PYLKYTGADPLPSAVTYNRDGSTTLRWNIGTLNSGERWSATIDTSVQLKLPVDVTESRS
FT                   GFGGNISSSTPYSRVDFDWPALSCAAPLRRHYELPLAEGRMWITCGAPCQASAATEQST
FT                   QVRKEASEAEVPLESPPRAQPGFEGVLGVLSLITGYLCIRRS"
FT   sig_peptide     191132..191221
FT                   /locus_tag="Mthe_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.430 at
FT                   residue 30"
FT   gene            194168..196756
FT                   /locus_tag="Mthe_0198"
FT   CDS_pept        194168..196756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0198"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: tel:tll0709
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13997"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M3"
FT                   /protein_id="ABK13997.1"
FT                   /translation="MRLHLLFAVLLILLITAGGAPAKEVLLLNSYNPGMSWTDDVIGGV
FT                   RLRLAIDAPNANLTVEYMDTKKVLLNESRMEFLKRLYSERYGERKFDVIISSDDDAFRF
FT                   LLTNRDELFPGVPVVFCGVKDFRPEMLSNVSGFTGVLLNVSIEDTIDLMLRLHPDTNKI
FT                   VVVNDNTTTGMANRRILEGVIPKFNITFDVLDNVTVDELRENVSRLGPGVLVLLLTFNR
FT                   DRAGEVFTYEESAEILRQVSRVPVYGVWEMCLGHGIVGGYLSSGDAQGMKAAEIAARIL
FT                   HGADPESIPIVSHSPNVYMFDMLELRRFNISRGSLPAESEIINRPYHDRADLSHMNLSW
FT                   HDLSGASLNQTYLNGSDLSNANLTGAYLRYSMIYDANLSLADLSGADIEGADIHNTDLR
FT                   EARLRGAKLIGVDLTRSDLSRADLTGAHMEIARLSGALLTGTMMDGADLNGTKMDGCNL
FT                   SGAYVRSAFVYRANLRDANLSGANMSGSDLSGVDLTRAALIYSDLRNASMQDSVIRDAN
FT                   LTGSQLTGAIMMQSNISGANLSFTDLSNTDMRRCCMLFTDLVGARLNNARLDSSMLFRA
FT                   NLSRASLVSASLQGVDLSGSDLSEADLRGADMTNAKLTETVLEGADMSGARLLGADLTQ
FT                   ARMHDLILTRANMLGARANWVDLSGARLSRALLTRAELFGADLSGTDLSGADLVKAYAL
FT                   RANLSGADLTDAKLDDADFSGAILRGAKMPELVIRSVNFGQADLSDADMSGCRFEALYV
FT                   SNAVMRSANMRNAIFRGVMFENCDLSMADLKRIKATGVYLTNTSLSGADLRDSELYSVG
FT                   FTNVDLRGARLDGIRYDRPTLESLAQQNLDGVSMSDDLRRDIERVRNEAS"
FT   sig_peptide     194168..194236
FT                   /locus_tag="Mthe_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.668 at
FT                   residue 23"
FT   gene            196843..198039
FT                   /locus_tag="Mthe_0199"
FT   CDS_pept        196843..198039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0199"
FT                   /product="Protein of unknown function DUF650"
FT                   /note="PFAM: Protein of unknown function DUF650,
FT                   archaea-like; Protein of unknown function DUF651,
FT                   archaea-like; KEGG: mbu:Mbur_2047 protein of unknown
FT                   function DUF651"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13998"
FT                   /db_xref="GOA:A0B5M4"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M4"
FT                   /protein_id="ABK13998.1"
FT                   /translation="MSVRCITCKGRGLCGRPVCPLLIKLEELAGLPRIGNRLAGESPPE
FT                   IFVGRHGYPLVRAGPLLPIGSSPEQPALDIVKIISHRTRMIRSELEIHVHDAKDPGRLL
FT                   ESAQQIAMSSRPVETEVSFVKPPEGRMLFDGVLSPMGPGGRIEDMDITGNPFVPRKVDQ
FT                   IVGDTDVKAASAVYELYSSSICIDHISRLLSIGLLGRDRRLVPTRWAITASDDIIGNAL
FT                   RSRVLDMPELGGYELYSGGILGNHFQIILMPGAYSFELIEIWHPGSAWSPERLWIGSDR
FT                   EGTTERRSYSPLAGGYYAARLPVLEHLLRMKRQAGVLALREITEEYWAPLGVWVVRDTA
FT                   RAALASRPLRFETLEEAIRSAESRMRTKSSAWKHHSKSFSRQTTLSSFFAAQSAEDLR"
FT   gene            complement(198329..198556)
FT                   /pseudo
FT                   /locus_tag="Mthe_0200"
FT   gene            complement(198736..200190)
FT                   /locus_tag="Mthe_0201"
FT   CDS_pept        complement(198736..200190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0201"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: aba:Acid345_2166 Fe-S protein, radical SAM family"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK13999"
FT                   /db_xref="GOA:A0B5M5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M5"
FT                   /protein_id="ABK13999.1"
FT                   /translation="MRVLLLASPVVQPDFDRIARIPDLGLVSLAAAIDDLCDVHVADLH
FT                   GIKDPDEFVRRHANRYDLIGLTAMSFQYARALELARIAKDAGAEVVIGGYHPTLFYREI
FT                   GSSSDLMLIDYIVRGEGERTFRELVQALIRGSQLDDVPGLSYRFGSEMKHNPPRALLNP
FT                   EEIEMPNRDARLIRDGFYAFDVPVDSVETSRGCTQGCKFCSINSMYGRSFRKFEIKRVI
FT                   EDIQDAEEHGAGSIFFPDDNITLDVKRLEAICDAIIDAGLTHLRYKTQASASGIASSER
FT                   LVKKMGEAGFDGVFLGVESASKRNLQFFGKGRMSDHAERAVRYLHDNDIIVSTGLIGGN
FT                   PDDTAEDMWANFHLARQLKVDFPIFYINTPYPKTPMREELERMGLITNNDFRFYDGLHA
FT                   NVRTKHLSAEEVQYITWEMNARYYNWEWFKYNKVKRLYPRWFAREALRLAPIYAKRKLE
FT                   LLLRIKSRRDMFREDLARGELCKGVA"
FT   gene            complement(200204..201568)
FT                   /locus_tag="Mthe_0202"
FT   CDS_pept        complement(200204..201568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0202"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: tma:TM1537 Mg-protoporphyrin IX
FT                   monomethyl ester oxidative cyclase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14000"
FT                   /db_xref="GOA:A0B5M6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M6"
FT                   /protein_id="ABK14000.1"
FT                   /translation="MAPRVLFTTVYKNDDEPYDYIGSNSRSRWFRFYWPRIQSFGLRFL
FT                   KQNIPELEILEYPTWEEYLRKLDEGWDVVGFSFYLNETHEILEMVEAARARGINELWAG
FT                   NYGALTPEIQDRFDRVFVGYAEHQVAPYFGRRIEKVVHPPLIEYLSTPFGLKLNIYGIL
FT                   FTTRGCGVGCKFCQTPCFAPKPTPIPLESIERVVNYYKKNNINVVIIEDENFGANRRHA
FT                   DRVVEILDEYDMVWGCMARADYLREKIDEWVTMRRRVARRDGSARRMVSGFAGAAIGIE
FT                   NLHQERLDDIKKREGVEDIVETIKLLQSHGMGTVGYYMIGFEDDTVRSIDEDVKRVADL
FT                   KLDITQICVLTPLPQTQLWNEIQERYGIFDHDYHHFDGKHLVWNHPNITPKEMEEVLDR
FT                   SLKRVYPWTAPLRTSARVWRNAYRYAGLQGIREVFSYITRANSFDFETKVPRLLV"
FT   gene            202121..202738
FT                   /locus_tag="Mthe_0203"
FT   CDS_pept        202121..202738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0203"
FT                   /product="metal-binding protein-like protein"
FT                   /note="KEGG: pca:Pcar_2464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14001"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M7"
FT                   /protein_id="ABK14001.1"
FT                   /translation="MTDRQSLRIDLDEVLSKLKDIHQDIRLISTGIVVVGEWVRWKCRY
FT                   GCRAYGKHLCCPPYAPSPEETKRMLEDYDFAVLARFLPTPTPGYEPRRLHHYLWNSLTS
FT                   LHKTIFELERQAFLMGCYKAFGMGAMPCTFCETCVAEEKIAKGESPAPADAVLCRHKEM
FT                   MRPSLEACGIDVFATLRNAGYDLKVLRSYQERFSLFGMVLLD"
FT   gene            202836..203588
FT                   /locus_tag="Mthe_0204"
FT   CDS_pept        202836..203588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0204"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; KEGG:
FT                   mba:Mbar_A0603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14002"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M8"
FT                   /protein_id="ABK14002.1"
FT                   /translation="MGRVITFLTDFGSFYLSQMKGVILQRTKDVVFVEISTDIPPQDVR
FT                   SGAFALMVASRYFPRGTIHIAVVDPGVGTERAAICVESGGHVFIGPDNGILMPAAYALG
FT                   SPVAWVLDVPEGASPTFHGRDVFAPAAAEIACGTHPEDMGIPFEPKDLDLGSPRVVANG
FT                   VETTVIHIDNFGNVVLNMKSVPDSDMRLMGRRLKRVRTYGEAGWNESLITLGSHGFAEI
FT                   AVNGGSAAKLFGLSTGDKIVLEDVSCSE"
FT   gene            203576..204532
FT                   /locus_tag="Mthe_0205"
FT   CDS_pept        203576..204532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0205"
FT                   /product="methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.99.11"
FT                   /note="PFAM: luciferase family protein; KEGG: mbu:Mbur_2372
FT                   coenzyme F420-dependent
FT                   N(5),N(10)-methenyltetrahydromethanopterin"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14003"
FT                   /db_xref="GOA:A0B5M9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019946"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M9"
FT                   /protein_id="ABK14003.1"
FT                   /translation="MFGIEFVPSDPALKIGYLSKLAEDVGFETVWITDHYNNRDVYSTL
FT                   AVLSMLTNRIRLGTGVTNPYTRSPIITASSIASINELSGGRAILGIGPGDKATFDAMGI
FT                   AWEKPLTRVRESVSVIRALLRKERVTQGGMNAQLSFSAGNIPIYMGAQGPKMLELAGEI
FT                   ADGVLINASHPEDFRAAIPLIRNGVQRAGRDPEDVKVCAYTSFSVDRDRSKAASEARKV
FT                   VAFIAAGSPDAVLERHGIGVQERDAISKAISKGDFASAMSSVTDKMLDVFSVTGTPDDC
FT                   RARVDELLATGVNQIVVGSPIGPDKERSIRLIGKNIL"
FT   gene            204529..205041
FT                   /locus_tag="Mthe_0206"
FT   CDS_pept        204529..205041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0206"
FT                   /product="nicotinamide-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.1"
FT                   /note="KEGG: nph:NP0908A nicotinamide-nucleotide
FT                   adenylyltransferase 1; TIGRFAM: cytidyltransferase-related
FT                   domain; nicotinamide-nucleotide adenylyltransferase; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14004"
FT                   /db_xref="GOA:A0B5N0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006418"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5N0"
FT                   /protein_id="ABK14004.1"
FT                   /translation="MRRGFYIGRFQPYHMGHHLVLEQISREVDEIIVGIGTAQISHTVT
FT                   DPFTAGERIAMIYGALRELGRWFYIIPLPDINRNAVWVSHVKSMTPPFEVVYSNNPLVV
FT                   ELFMEAGMEVRRPPMYRREVYSGTVIRRLMIEGGDWRQLVPDAVAKVIDEIKGVERLRN
FT                   ISKKDFA"
FT   gene            205138..206298
FT                   /locus_tag="Mthe_0207"
FT   CDS_pept        205138..206298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0207"
FT                   /product="predicted aconitase subunit 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: protein of unknown function DUF521; KEGG:
FT                   mbu:Mbur_1472 protein of unknown function DUF521"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14005"
FT                   /db_xref="GOA:A0B5N1"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5N1"
FT                   /protein_id="ABK14005.1"
FT                   /translation="MHLTKDEELLLQGERGDTLRRAMEILVALGDIYGAEQLIEIKSAQ
FT                   IAGVSYKTIGDAGLEWISDLDGKVAVPSILNPAGMDLLRWREMSIDEDFARKQLEIINA
FT                   YRRLGVTIECTCTPYLLYESIASRGDHLAWSESSAVSYANSVIGAMTNREGGPSALAAA
FT                   LVGKTPLYGYHLEENRVPTHVIRVDADLKEYGALGFLVGKIVGDGVPLFVMRSRPDRDD
FT                   LKALGAAMAASGSVALYYVKDVTQEPPEHDEDACEFVEIEEEEIRSVYDSTIDVDIVAL
FT                   GCPHCSMQELERIADLLEGRKVSSELWICTARRIAESAPELVRRIESTGARVICDTCMV
FT                   VSPASERFKHMMVNSGKALAYIPGMCGISASFGSLEECIDAATGGS"
FT   gene            206299..206712
FT                   /locus_tag="Mthe_0208"
FT   CDS_pept        206299..206712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0208"
FT                   /product="predicted aconitase subunit 2"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   mbu:Mbur_1471 protein of unknown function DUF126"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14006"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR012016"
FT                   /db_xref="InterPro:IPR020794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5N2"
FT                   /protein_id="ABK14006.1"
FT                   /translation="MEIKCHRVSGGCAEGPALVTRERISFLGNVDPETGVVVDPAHELY
FT                   GRSIAGVVLIFPGGKGSTVGSYVIYQLRKRGMAPAAMINLKSEPIVAVGAIISDIPLVD
FT                   RVPEWILDVKDGTRVVVDARREVVVLPDGSVKV"
FT   gene            complement(206854..207150)
FT                   /locus_tag="Mthe_0209"
FT   CDS_pept        complement(206854..207150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14007"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5N3"
FT                   /protein_id="ABK14007.1"
FT                   /translation="MELAYYYDMAGNAAMKKILDQDFFKRLGPIVRDARSVGFDKEGFL
FT                   LYIKARDDLVEEARKLLADTPARLLEGDEAESVINAFREEQESAEAGMGTLFG"
FT   gene            complement(207160..207351)
FT                   /locus_tag="Mthe_0210"
FT   CDS_pept        complement(207160..207351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14008"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5N4"
FT                   /protein_id="ABK14008.1"
FT                   /translation="MERHEAEHLLKHWIEHNESHSRSFRDRAKQINDISPEAAKAIEEA
FT                   ASLMDRCTECLKRAMDAL"
FT   gene            complement(207518..208312)
FT                   /locus_tag="Mthe_0211"
FT   CDS_pept        complement(207518..208312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0211"
FT                   /product="glutamate synthase (NADPH) GltB3 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: glutamate synthase, alpha subunit domain
FT                   protein; KEGG: afu:AF0954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14009"
FT                   /db_xref="GOA:A0B5N5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5N5"
FT                   /protein_id="ABK14009.1"
FT                   /translation="MDELQMEIPCIRTFNESMIEIDASHMETRELNNLLREIMLCGYEK
FT                   VVLRNVCGQRYIGTRLYSPQRRVMTIEIYGTPGNDLGAFLFGHRILVHGNAQDGVGNTM
FT                   ESGEIVINGRAGDVTGMSMRGGRIFVKGDVSYRAALHMKEHGLKKPVIVVGGTSQDFLG
FT                   EYMAGGIVILLGLYRAHTARFIGSGMHGGAIYIRGEVGEEQVDSSVLISRPDESDMEIL
FT                   GDCISDFIERFPDLSLDMDYVLEGDWTKLSPRSSRPYGKLYA"
FT   gene            complement(208320..209813)
FT                   /locus_tag="Mthe_0212"
FT   CDS_pept        complement(208320..209813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0212"
FT                   /product="glutamate synthase (NADPH) GltB2 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; ferredoxin-dependent glutamate synthase; KEGG:
FT                   afu:AF0953 glutamate synthase (NADPH) alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14010"
FT                   /db_xref="GOA:A0B5N6"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5N6"
FT                   /protein_id="ABK14010.1"
FT                   /translation="MRSLLLPEFTISRSDSCDRCRACEHQCSFGVHTYDASQDMMISDN
FT                   YRCAGCQRCAVFCPKGAIEIRPTPSFYRPNASWSRERIEDIKRQAETGGVILTGCGSDK
FT                   PFRIYWDHILLNASQVTNPSIDPLREPMELRTFLGSKPESLSLSDMEAGTDPVLTLETP
FT                   MLFSAMSYGAISYNAFQALAIAASRSGTFFNTGEGGMPAEMRSQFKEHTIVQVASGRFG
FT                   IDAEYLNSGAAVEIKIGQGAKPGIGGHLPGEKVSQHVAATRMIPEGTDAISPAPHHDIY
FT                   SIEDLEMLISAIKEVTNYEKPVIVKVAAVHNISAIASGIVRAGADIIAIDGMRGGTGAA
FT                   PKAIRDNVGIPIELAVSSVDRRLRDEGIRERCSIIAGGGIRCSADVVKAIALGADAVYI
FT                   GTAALIAMGCTLCQRCYTGRCSWGICTQDPGLMRRLNVEEAAQRLVNLLSAWSHEIKEM
FT                   LGGMGINAIESLRGNRDQLRGIGLHEWELDVLGIKGAGE"
FT   gene            complement(209791..210927)
FT                   /locus_tag="Mthe_0213"
FT   CDS_pept        complement(209791..210927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0213"
FT                   /product="glutamate synthase (NADPH) GltB1 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   afu:AF0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14011"
FT                   /db_xref="GOA:A0B5N7"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5N7"
FT                   /protein_id="ABK14011.1"
FT                   /translation="MSVRRQKLYSKEICACSIFGAMSRTGERFTGERVIRAMANMHHRG
FT                   NGLGGGFAAYGIYPEFREYYAFHLMFTGDARAQREAKRAAEEFLFRNFDVVHDEEIPHS
FT                   DDVYVRDPPLLWRYFLSPSKHGEDIHLPDDEYVVRKVVHVNSAIDNAYIFSSGKNMGCF
FT                   KGVGYPEEIGRYFMLDRLYRGYLWTAHGRFPTNSQAWWGGAHPFGLLDTTVVHNGEISS
FT                   YGTNRWYLEMLGYKCTLHTDTEVVAYAVDLLMRRQDLPMEVVAKILAPPTWETIDRMDV
FT                   RERELLTTLRRIYGPLLMNGPFAVIIAQSGRMIGLTDRIRLRPLTVATRGEMFYISSEE
FT                   ASVRLISPSLDSVWSPRGGEPVICELDGRLKHEIAAPA"
FT   gene            complement(212264..212572)
FT                   /locus_tag="Mthe_0214"
FT   CDS_pept        complement(212264..212572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA4190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14012"
FT                   /db_xref="InterPro:IPR016800"
FT                   /db_xref="InterPro:IPR040713"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5N8"
FT                   /protein_id="ABK14012.1"
FT                   /translation="MEYTFKRGYAPDMDRIEGILKEVFSSGFTRNGDRITLSYGALKSC
FT                   QIWIEKKKLNVITESLLGAPDDVIMDTNRRFRKFLEKATGYTAKQRVQMAKKEVQGE"
FT   gene            complement(212613..213119)
FT                   /locus_tag="Mthe_0215"
FT   CDS_pept        complement(212613..213119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14013"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5N9"
FT                   /protein_id="ABK14013.1"
FT                   /translation="MRFCVSKTHSGIGCSIRFCILIVLVAFVLVASLLTACVHAHPLYF
FT                   PLSEHTMTTEVSSSGVPQSRTYTFTQDDAEAVCWLKVWRDQRAHTVEWRWYSPNMRVYK
FT                   RSFGVIPAIDGPAGMWGSCIWSGLRIKGEDVANLPGTWKVDVIVDFRKVLTEYFTIGGN
FT                   QAPCC"
FT   sig_peptide     complement(212997..213119)
FT                   /locus_tag="Mthe_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.796 at
FT                   residue 41"
FT   gene            complement(213381..215057)
FT                   /locus_tag="Mthe_0216"
FT   CDS_pept        complement(213381..215057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0216"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: mbu:Mbur_1739 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14014"
FT                   /db_xref="GOA:A0B5P0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5P0"
FT                   /protein_id="ABK14014.1"
FT                   /translation="MFLDFMSEVEGILKEGLDRCGLSVPLENSLDLSPHADLSTTIAFR
FT                   LSPVLRKDPKDVAAEIYNSMGSPSRWVDRAELVGPYINFYMSRNFLDNVVTKAQGEDAW
FT                   WGRRSGSVVVEHTSANPDGPLHVGHIRNSVIGDTIVRILRRAGYNVEAQYYVNDMGRQT
FT                   AMVVWGCDHLDLDDSKPDHAIARVYIAAHKIMNEKPELSAEVDELMRRYESRDPEIVKK
FT                   FQRAARYAISGIERTLHRMNIHHDSYKWESEFVWDGSVDEILEMLERTGRTVLKDGALQ
FT                   LDLSEEGFEKSLVLRRADGTTLYTTRDLAYHKWKAENYERVVEVLGADHKLISAQLRTA
FT                   LRMLGIGEPEVVIFEFVSLPDGSMSTRRGKFISADELLDEVEKQAYLEVTKRRPEMDEE
FT                   FRRDVAGKVAVGAVRYDIVRVSADKATTFDWKTALDFEKLSAPFIQYSHARACSIINKA
FT                   GELDEFDPGLLRDDYEIALIKKIAEFDLVIERAARELKPHQLATYARELAERFNLFYRY
FT                   DPVLDAKPVELRNARLGLVRASRNALSATLDTLGIDAPESM"
FT   gene            215433..216626
FT                   /locus_tag="Mthe_0217"
FT   CDS_pept        215433..216626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_1339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14015"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5P1"
FT                   /protein_id="ABK14015.1"
FT                   /translation="MRSWTLLAILLLTVISCANAGDGAKEVVATTTINLPVDSVTIYQD
FT                   GLVFIKRMGSMDLTEGTHKFVIDIPENADTSSLLFLVTNSSLERIVYDKMPVYTINVTS
FT                   TARQSFLLSYLVRNGGYWAPNYYMHLLNDSMLLTANALINVDLKEDLKNVQIRLVAMPE
FT                   REIPIMMRAPAPTAAKAEELSVYDIAAGAPTGELETLFVFVLENRTDLVAGKSIGLPLF
FT                   EDLAPAWRVYTWDAYYNPDGPANEEIRANNTADHPWPNGNVQVFRDGEYVTTLSMPYTA
FT                   KGANASLSLGPSADLKLSKKLMDYNITENVVSFGNGTAKVTTENWTYQLEIKSNTDKEI
FT                   DLEVKDTIPMEAKVIDVSPEPSEMTATLLKWNLSVAPREEMKIRYAYRVVTVETIDR"
FT   sig_peptide     215433..215495
FT                   /locus_tag="Mthe_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.681 at
FT                   residue 21"
FT   gene            216924..217679
FT                   /locus_tag="Mthe_0218"
FT   CDS_pept        216924..217679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0218"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mja:MJ0412 putative taurine transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14016"
FT                   /db_xref="GOA:A0B5P2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5P2"
FT                   /protein_id="ABK14016.1"
FT                   /translation="MSLLEVRSVSKVFDVDGKTIEVLREISMSVDEGEFICFIGPSGCG
FT                   KTTLLRIIAGLEFPSSGSVLLDGTPIKGPGPERGMVFQEYSLFPWRTVLDNVAFGPEIQ
FT                   GVPKEERYRIAREYLKMVGLERFESRYPHELSGGMKQRVAIARALVNNPKALLMDEPFG
FT                   ALDAQTRNVMQSELLRIWERERKTIIFVTHSVDEAIYLGDKIIVFSARPGRVKEVIGID
FT                   LPRPRKRTSLEVNMIRDKILQDLKTEIKI"
FT   gene            217689..218753
FT                   /locus_tag="Mthe_0219"
FT   CDS_pept        217689..218753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0219"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   3-dehydroquinate synthase; KEGG: mma:MM0590 putative
FT                   glycerol 1-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14017"
FT                   /db_xref="GOA:A0B5P3"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5P3"
FT                   /protein_id="ABK14017.1"
FT                   /translation="MLRMRTRSASWMELPRRVVAGAGALANIGDVCVDLRLSGRALVIT
FT                   GPQTRSVAGDNLAASLTDCGFEADVVITRDPRPAEVDRVKSFALDYKADFLIGAGGGRS
FT                   IDIAKLAAYHLDIPYLSVPTAASHDGIASAMASLNMDGETKSIPTRAPLAIIADTGIIS
FT                   KAPPRLMSAGCGDIISNYTAILDWRLAKRLKCEDYSEYAAALSSMTAKMVVDMAPSIKP
FT                   GHEPSAKVVVQALISSGVAMSIAGSSRPASGSEHMFAHALNRIAPGRGLHGELCGIGTI
FT                   IMMYLHGGDWRMIREALKVLGAPASAHELNIPEDVVVEALTQAHKIRPERYTILGNGLT
FT                   EAAARAAAETTKVI"
FT   gene            218783..219232
FT                   /locus_tag="Mthe_0220"
FT   CDS_pept        218783..219232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0220"
FT                   /product="Protein of unknown function UPF0179"
FT                   /note="PFAM: Protein of unknown function UPF0179; KEGG:
FT                   mba:Mbar_A0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14018"
FT                   /db_xref="InterPro:IPR005369"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5P4"
FT                   /protein_id="ABK14018.1"
FT                   /translation="MAEPATQITLIGTKLATIGMEFIFNGPTPECESCKLRNTCMNLEP
FT                   GRRYRILGIKGELVHECPLHEEGVRAVEVTESPTIAAMDARKSFAGSKIIYEPINCDVT
FT                   DCRMYDICHPAGLKRGDRCTIVEVVGEAPEECARGYKLKLVELRR"
FT   gene            219187..220167
FT                   /locus_tag="Mthe_0221"
FT   CDS_pept        219187..220167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0221"
FT                   /product="FO synthase subunit 1"
FT                   /EC_number="2.5.1.-"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mma:MM2494 biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14019"
FT                   /db_xref="GOA:A0B5P5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5P5"
FT                   /protein_id="ABK14019.1"
FT                   /translation="MCAGIQAEARGAEALRATFSRNVFIPVTDLCRNACGYCSFRRDPD
FT                   RARVISRSEAQRLMERAQSAGCSEALFSMGDRPWEVRGDRLELLEYLVELCELALEMGL
FT                   LPHTNAGILTREELELLAPYNASMGLMLESTAHLKIHERSPGKRPEVRIRTISDAGALR
FT                   IPFTTGILVGIGESSEDRIRSLEVIAELHRRYGHIQEVIIQPLDPKPGTESEGMHPPAM
FT                   TDMVKLVSIARRILPLEISIQVPPNLMDPVPLLRAGADDLGGISPVTPDWINPERRWPE
FT                   IDELRGVVLVERLPVYPRYVKLGWYGSRTKDLIKRLADERGLRRT"
FT   gene            complement(220649..221134)
FT                   /locus_tag="Mthe_0222"
FT   CDS_pept        complement(220649..221134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14020"
FT                   /db_xref="GOA:A0B5P6"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5P6"
FT                   /protein_id="ABK14020.1"
FT                   /translation="MNARIYRLFFRLLNSLFILPAFRTGLGRIVSNPVTGRVMVLILKG
FT                   RRTGRTRYTPVGYATMNGRIYCYRGGRSRGAWYLNLLAEPRLEIMLPEGRIRGCAEVVT
FT                   DEEEKFTALRKILKNGGLSGLVYGFNPWTVEEGVLRERMRGVKVVRITPSSPIPRDR"
FT   gene            complement(221144..222952)
FT                   /locus_tag="Mthe_0223"
FT   CDS_pept        complement(221144..222952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0223"
FT                   /product="ATPase, PilT family"
FT                   /note="PFAM: PilT protein domain protein; KH, type 2 domain
FT                   protein; KH, type 1, domain protein; SMART: AAA ATPase; KH
FT                   domain protein; Nucleotide binding protein, PINc; KEGG:
FT                   mba:Mbar_A3490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14021"
FT                   /db_xref="GOA:A0B5P7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5P7"
FT                   /protein_id="ABK14021.1"
FT                   /translation="MKDCVVPDTSVVIDGRVSARVKSGALAGRRIVIPEAVVAELEAQA
FT                   NHGREIGIKGLEELRRLSELAKAGKIELEYVGVRPDLDQIKLAGGGEIDAMIRDVALEL
FT                   GASFLTSDTIQYKVAQAMGLDVEYIRPERDEIKKLSIERFFTDDTLSVHLKEDAIPMAK
FT                   RGAVGAFKLVKLDDKPIREKDLREMAREIIERAKLDPEGYIEIEKNGATVVQLGPMRIA
FT                   ITRPPFSDGLEITAVRPVAKVDLDSYKHADELKARLSEGQRGILIAGPPGSGKSTLAAG
FT                   IAEYLLKCNYVVKTMESPRDLQVPPEVTQYGPLEGSMEASSEILLLVRPDYTIYDEVRK
FT                   TQDFVVFADMRLAGVGMIGVVHANKPIDALQRLLGRVELGMIPQVVDTVVFIERGEVTK
FT                   LLDVEFVVKVPTGMVEADLARPVVVVKDFETGAVEYEMYSYGDQIVVMPVTKPGKKPVW
FT                   RLASKEIEKELAHHVKGPFEVEMISDSSMVVTVPESQIPRVIGKAGRNIEQIERALGMH
FT                   IDIRGKREEPDVITPRVEESNRHLILWVGAGAGASAEVFVGSEPVFTATIGRRGDIRIA
FT                   KSSEIARHVLNRLRRGERVEVRLLEG"
FT   gene            223319..223855
FT                   /locus_tag="Mthe_0224"
FT   CDS_pept        223319..223855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14022"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5P8"
FT                   /protein_id="ABK14022.1"
FT                   /translation="MISRSVTIISILLIAFGLAHAVSVPTENLPAGFKLLGVIDTNTTG
FT                   VNVSEEINDFYGARDIGIVKDVSIGKYIWGEMGVDYDAKITILSLENDGYARAAYENYR
FT                   SRDEFRNPPIKGIDRFANVTINDHDALEIRDKVMDLRGTSIRFLYLWTNSSRVVLVEGN
FT                   DSRESSMALASATGM"
FT   sig_peptide     223319..223384
FT                   /locus_tag="Mthe_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.974 at
FT                   residue 22"
FT   gene            223981..224622
FT                   /locus_tag="Mthe_0225"
FT   CDS_pept        223981..224622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0225"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase fold
FT                   family"
FT                   /note="KEGG: tte:TTE2532 predicted Zn-dependent hydrolase
FT                   of the beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14023"
FT                   /db_xref="GOA:A0B5P9"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5P9"
FT                   /protein_id="ABK14023.1"
FT                   /translation="MDIKWFGHSCFQITDSIGRTVVTDPPDESVGYTLPPIRADIVLIS
FT                   HDHFDHNNADAVLGSPIVIKHPGIYKAAGIEVKGVGTYHDDAGGKLRGTNTVFCFTMDD
FT                   IRVCHLGDLGHVLNDNDARAIGDVDILLIPVGGTFTIDARGALAVIDKLKPNLVIPMHY
FT                   RTPALAFDLDPVDKFIKAARGRKVLGPEKLLHISREDLDQQKIVLLEYVS"
FT   gene            complement(224720..225628)
FT                   /locus_tag="Mthe_0226"
FT   CDS_pept        complement(224720..225628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0226"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="KEGG: mbu:Mbur_0058 GMP synthase, large subunit;
FT                   TIGRFAM: GMP synthase, large subunit; PFAM: GMP synthase
FT                   domain protein; PP-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14024"
FT                   /db_xref="GOA:A0B5Q0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR026598"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q0"
FT                   /protein_id="ABK14024.1"
FT                   /translation="MDVQRFIDNAIDEIRREVKGKAIIALSGGVDSSVCAVLAHRALGE
FT                   NLVPVYVDSGLMRRFESERIVELFSHLNLMKVDASERFLNALRGVTDPEQKRKIIGETF
FT                   IRVFEEVASEVGAEYLIQGTIYPDRIESEGGIKSHHNVGGLPLHIEFKGIIEPMRDLYK
FT                   DEVREVARALGLPMEISERMPYPGPGLAVRIVGEITREKLEVVRTANAIVEEEISSFKP
FT                   WQAFAAVIGKATGVKGDNRVYGWVVAVRAVTSRDAMTADVLELPWGALRRISSRITGEI
FT                   PGVSRVVYDITPKPPGTIEFE"
FT   gene            226111..226917
FT                   /locus_tag="Mthe_0227"
FT   CDS_pept        226111..226917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0227"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mba:Mbar_A2985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14025"
FT                   /db_xref="GOA:A0B5Q1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q1"
FT                   /protein_id="ABK14025.1"
FT                   /translation="MDPIALITDLVIICVILIGTQIAAKIADRMLQKYFLSFAERMLKN
FT                   NILQAEHVEEERTRTFHIIIRRIVVASIYVAGIALVVLQIPQLYRIAIALLAGASLAGL
FT                   AIGFAAKDALSNLISGVFIAVFQPIRVGDYVTFRNDYGYVEDITLRHTVICIWDKRRIV
FT                   VPNSVISTEVIVNWSMRDPVSVWTVDFLIQDASNIDRAKSIILEIARSQPHVLKEMEIK
FT                   VLLVESTKDGNKLRLYFNSLNRDLAFDTGCHILEEAKKAFMRERIS"
FT   gene            227266..229515
FT                   /locus_tag="Mthe_0228"
FT   CDS_pept        227266..229515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0228"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helix-hairpin-helix motif; helicase domain
FT                   protein; ERCC4 domain protein; type III restriction enzyme,
FT                   res subunit; DEAD/DEAH box helicase domain protein; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1; DEAD-like
FT                   helicases-like; KEGG: afu:AF1458 ATP-dependent RNA
FT                   helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14026"
FT                   /db_xref="GOA:A0B5Q2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="InterPro:IPR041755"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q2"
FT                   /protein_id="ABK14026.1"
FT                   /translation="MSYLVHPLLKPEAVEKRLFQIDLAARALRGSTLVVMPTGLGKTIV
FT                   ALMVMLARLEKGRVLFLAPTRPLVEQHAAFLRRVLTSPDLVASVTGETDPESRAEIWRS
FT                   CRIAVSTPQVVENDLLSGRMDLRDVSLVIFDEAHRAAGNYAYVYIAERYRREARDPLVL
FT                   GMTASPGSEAERIAEICANLGIESIEMKSESDPDVAPFVHHREIEWIKVEVPEQLQKIR
FT                   GVIDGLVSERMEEINSLGMCRIDPRTSKGELLDLQKRFSSALARGPNQNIFRGISLLAE
FT                   IMKLKHAVELAETQGVSALRQYLERLAQEARSRGGSKASRRLIEDPRIQHVLSVLKDID
FT                   LEHPKLSRALEIIEDQLETSPESRIIVFTNYRDTATALLRFLQANASDAVKPVRFVGQA
FT                   SRENDEGLSQRKQSEILEKFRAGEYNVLIATSVGEEGIDIPSTDMVLFYEPVPSEIRSI
FT                   QRKGRTGRARTGRVVVLIAKGTRDEAYYWISDRKERTMRRQLQGMAEPLPVDSAVPDTA
FT                   PISSRASRQISITEICEPDELPLIIVDSRERDMARLLEKTGLRIVLRSLEVGDYVLSER
FT                   LGIERKTADDLIDSIIDPERDLFRQIGDLARTYDRPLLIIEGQNLYARQVHPNSVRGIL
FT                   ATIAVDFGVPIVPTGSIEETAALIALMARREHEAGYRDVKLHGRKTSRTLKEQQEYLIS
FT                   ALPGVGPSVARNLLRHFGSVERIMTASEGELMSVDKVGPKTAARIREIVSGEYKG"
FT   gene            complement(229517..229642)
FT                   /locus_tag="Mthe_0229"
FT   CDS_pept        complement(229517..229642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14027"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q3"
FT                   /protein_id="ABK14027.1"
FT                   /translation="MNILIAGMEQPVVPIESKPLHHISVMQVLAMKWEALPFRVG"
FT   gene            complement(230007..231398)
FT                   /locus_tag="Mthe_0230"
FT   CDS_pept        complement(230007..231398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0230"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase; KEGG: mba:Mbar_A3498
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14028"
FT                   /db_xref="GOA:A0B5Q4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q4"
FT                   /protein_id="ABK14028.1"
FT                   /translation="MGDTNKNVARMIYYALHALQHRGQEAAGICVHDGKSIHSYRGIGL
FT                   VAEVFTETQIALLPGAVGIGHVRYPTSGAHTLENSQPILVKYRDKTIAVAHNGNLVNSG
FT                   ELRSELEGAGDIFSTTSDTEVIAHLLVKEIQRYDLADAVRAVMRRLVGSYSLAIMCNDT
FT                   VIGLRDPLGIKPLCIGAIDDGIVVASESVAIDALNGRLIRDVAPGEMVVLRDGEMNCIR
FT                   LVNSPRPAHCIFEYVYFARPDSIMDTKLIYDVRVNIGSILADEHPADADIVSPIPDSGI
FT                   TMAVGYHQRSGIRYKECLMKNRYVGRTFIMPDQSMREAAVRMKMNTIRPNIEGQRIVLV
FT                   DDSIVRGTTSRRIVKMVKDAGAQKVHVRIGSPPIIAPCYLGIDMASRDELIAAHKTVAG
FT                   VETVIDADSLGYVSLEGLIRAIGLPEDHFCTGCLTGIYPLDIPGERSMSSQRRLTDFPP
FT                   NDGGG"
FT   gene            complement(231435..231605)
FT                   /locus_tag="Mthe_0231"
FT   CDS_pept        complement(231435..231605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0231"
FT                   /product="LSU ribosomal protein L37E"
FT                   /note="PFAM: Ribosomal protein L37e; KEGG: mbu:Mbur_2180
FT                   ribosomal protein L37e"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14029"
FT                   /db_xref="GOA:A0B5Q5"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5Q5"
FT                   /protein_id="ABK14029.1"
FT                   /translation="MSKGTPSMGKCHKRTHVRCRRCGRLSYNFNRKTCVACGFGRSKRL
FT                   RSYKWMRKAGY"
FT   gene            complement(231617..231832)
FT                   /locus_tag="Mthe_0232"
FT   CDS_pept        complement(231617..231832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0232"
FT                   /product="Small nuclear ribonucleoprotein, LSM family"
FT                   /note="PFAM: Like-Sm ribonucleoprotein, core; SMART:
FT                   Like-Sm ribonucleoprotein, eukaryotic and archaea-type,
FT                   core; KEGG: mba:Mbar_A3500 putative snRNP Sm-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14030"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q6"
FT                   /protein_id="ABK14030.1"
FT                   /translation="MAQRPLDILNESLNSPVIVRLKDGRAFRGELQGYDIHMNLVLENT
FT                   EEIAEGTARKIGAVIVRGDNVVYISP"
FT   gene            231920..232405
FT                   /locus_tag="Mthe_0233"
FT   CDS_pept        231920..232405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0233"
FT                   /product="RNA-binding protein, containing PUA domain"
FT                   /note="PFAM: PUA domain containing protein; KEGG:
FT                   mth:MTH650 PUA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14031"
FT                   /db_xref="GOA:A0B5Q7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q7"
FT                   /protein_id="ABK14031.1"
FT                   /translation="MAMRIKSRHHLKGSEVKRILSAIEERIEDPDGLRKASMELAETDE
FT                   GFEIIIVNGRPLLMIIDGEPFFTVLGAIELSPRGRTVVVDSGAVRFIANGADVMGPGIV
FT                   QADPEIQTGDLVVVVEERHRKPLAVGRALRAGPEMKGEGKAVESIHHVGDRIWKSIC"
FT   gene            232811..233110
FT                   /locus_tag="Mthe_0234"
FT   CDS_pept        232811..233110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14032"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q8"
FT                   /protein_id="ABK14032.1"
FT                   /translation="MFGKRYICGCCGAEIDVKRTKKVDLGKGWVECLPPAGRDWRAPTA
FT                   KKELSDGNVYYIDVLNNLHKREEFIELFGVDPERAIKYMREHIMLSSRRNDGNK"
FT   gene            233230..233616
FT                   /locus_tag="Mthe_0235"
FT   CDS_pept        233230..233616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14033"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Q9"
FT                   /protein_id="ABK14033.1"
FT                   /translation="MIKKLICHHCGSVNLLDTQQLEQDVTDSEDWLECSEPDDFQWRLP
FT                   AGKITPVIGDPIYITGGGMRLTRGQYIEQYGIDPEIALTMMRGMGRAVRATINTAAEIG
FT                   KTDSRVPGSIRKLMEKLSKTKGDL"
FT   gene            complement(233867..234802)
FT                   /locus_tag="Mthe_0236"
FT   CDS_pept        complement(233867..234802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0236"
FT                   /product="DHHA2 domain protein"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein; DHHA2
FT                   domain protein; KEGG: cac:CAC2138 exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14034"
FT                   /db_xref="GOA:A0B5R0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5R0"
FT                   /protein_id="ABK14034.1"
FT                   /translation="MADNIYVVGHKSPDTDSVTSAITYANLKNQLGMKDVVPAAAGEIN
FT                   NETKYVLEYFKIAPPVVLNDATDKKVILVDHNEVGQAVDNIMKADILEIIDHHKIGDIQ
FT                   TGKPIFFHNEPVGATGTIIASMYELNGVAISKEMAGLMMAAILSDTVLFKSPTCTDKDK
FT                   ATVEKLSKICGEDPQKFGMEMLKAKSDIKSKTAKDILFGDFKKFDFSGVKAGVGQIEVM
FT                   DLADLAPKREEILAEMRKALESEKLDMIVLMLTDVIKEASDLLFVGTAAAKEGFEKAFG
FT                   GKVTNNSIYKEKVLSRKKQVIPPLESAFKK"
FT   gene            235124..235468
FT                   /locus_tag="Mthe_0237"
FT   CDS_pept        235124..235468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0237"
FT                   /product="Deoxyribodipyrimidine photolyase-like protein"
FT                   /note="KEGG: mac:MA4066 deoxyribodipyrimidine photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14035"
FT                   /db_xref="GOA:A0B5R1"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5R1"
FT                   /protein_id="ABK14035.1"
FT                   /translation="MAWRLNASLAVVFCLAPQFPGAGDRSYRFMLDGLRELEQRLSSLG
FT                   IAFIFTHGDPGNVIPEIIDDSGAGMLIADFSPLRIANLEVDGRRSYRNTVSRGERAQHS
FT                   PFSPLLDRVA"
FT   gene            235679..236286
FT                   /pseudo
FT                   /locus_tag="Mthe_0238"
FT   gene            complement(236318..237421)
FT                   /locus_tag="Mthe_0239"
FT   CDS_pept        complement(236318..237421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0239"
FT                   /product="Tubulin/FtsZ, GTPase"
FT                   /note="PFAM: Tubulin/FtsZ, GTPase; KEGG: mac:MA0953 cell
FT                   division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14036"
FT                   /db_xref="GOA:A0B5R2"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR032907"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="PDB:3ZID"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5R2"
FT                   /protein_id="ABK14036.1"
FT                   /translation="MLNVLMLGVGQCGNRILDAVNRQAFGGSRLAKYYSKQRFPSRVET
FT                   IAINTAINDLKELKFTAAKDRLHVPNLHGVGANRSKGKQGFWENQEMILEEIEKRGDFD
FT                   LIFVMTSVSGGTGSSFSPLMIHELKKRYKNATIVPIAVLPFREEGTIYLQNAAFCLREM
FT                   IEVEADGMILVDNQYLKRFSGDIASAYDRINTMVAQRLLFLIEALDSEMLSVTDLGDFK
FT                   TVMNGGLRMGTLGYYQADKKSPSIRAAIKNSLREVGLLYPANVDAGEAGRAMIVIQGSR
FT                   EYLNVDEITKEIESLTETIGHVFKGIVIKKGEPRVLSVLSLERAPGLVELYEKAKWAIQ
FT                   EERERKDRARSELYEAFEQINDLEEIY"
FT   gene            complement(237500..238648)
FT                   /locus_tag="Mthe_0240"
FT   CDS_pept        complement(237500..238648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0240"
FT                   /product="conserved repeat domain"
FT                   /note="TIGRFAM: conserved repeat domain; PFAM: protein of
FT                   unknown function DUF11; KEGG: mac:MA0954 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14037"
FT                   /db_xref="GOA:A0B5R3"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5R3"
FT                   /protein_id="ABK14037.1"
FT                   /translation="MRYIFLLLLLAAYVSLAIGDNEDQGVRFQEFTMSIGDRVEIGDYR
FT                   AELVDIQSLKDGLVVLRVTQGSKFEEQRVVIEGSPNSFNGGAEEGGLTLTITDIFDEES
FT                   AKLRVEYRESLGTPRKRVAERREPRAAPNLVVEKSFDKTTVNYGDEVKVTVTVKNIGTE
FT                   AARNIEVYDIPPLAEFAYIAGYPPKIKSELGPGETDSAVYVMRAVKEGLVKVPQIEVRY
FT                   RDAKDRIKTNTTEPLEIIVAPPKRPNLVARINVTNVTSGETAPIEVRIENTGQATATMV
FT                   EVSSEVKPPEGLRCTGLDQLIPEIPPGSAKIYTGEMRGERSGNYTISLTVSYRSGDAMS
FT                   ITKTAANVRVIEQEYKYLYYLLVLPLMIVGLWVYKRYKEYKY"
FT   gene            complement(238666..239484)
FT                   /locus_tag="Mthe_0241"
FT   CDS_pept        complement(238666..239484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0241"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: mac:MA0955 nicotinate-nucleotide
FT                   pyrophosphorylase (carboxylating); TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14038"
FT                   /db_xref="GOA:A0B5R4"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5R4"
FT                   /protein_id="ABK14038.1"
FT                   /translation="MLRSHIERFLEEDLGEWDDSTSIVPDLNVDAAIISKEDCILAGLE
FT                   EVSELFEYLDVNSEPLFDDGEYATAGAEVMSIQGSARNILRGERVALNILGRMSGIATL
FT                   TRECVLRAQKVRVACTRKTTPGFRYFEKKAVLIGGGDTHRFNLSGAVMIKDNHIAIMGL
FT                   EDAIKEARKRASFTKMIEVEVEDLDTMIRAAELGADIIMFDNMNPEEIKRGVAMLEEMG
FT                   VRSGVILEASGGINPGNLEAYASTGVDVISMGALTRGARWMDFSMEVRNR"
FT   gene            239525..240334
FT                   /locus_tag="Mthe_0242"
FT   CDS_pept        239525..240334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0242"
FT                   /product="aspartate dehydrogenase"
FT                   /note="PFAM: oxidoreductase domain protein;
FT                   dihydrodipicolinate reductase; aspartate dehydrogenase;
FT                   homoserine dehydrogenase, NAD-binding; KEGG: mba:Mbar_A1866
FT                   putative L-aspartate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14039"
FT                   /db_xref="GOA:A0B5R5"
FT                   /db_xref="InterPro:IPR002811"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011182"
FT                   /db_xref="InterPro:IPR020626"
FT                   /db_xref="InterPro:IPR022487"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5R5"
FT                   /protein_id="ABK14039.1"
FT                   /translation="MPIKVGLVGCGAIGFEIASAIDRGDVNADLAAVFDRNPKNMNRLI
FT                   EAMRNKPEVVELEELAELSDIVVEAASQAAVPQVAEAALKRGKDIMIMSVGALMDRELY
FT                   RRICSMAESSGGRVYIPSGAITGLDGLKSASVGRLKRVVLTSTKPPASLEGAPYVVEKN
FT                   MDLRSFREPTLIYEGPASEAVRAFPANVNVAATLSLTYGQDAWVRIVVDPKATVNVHEV
FT                   VAEGDFGRMVTRVENVPSPRNPRTSYLAALSAIATLRNATLNVRIGT"
FT   gene            240345..240803
FT                   /locus_tag="Mthe_0243"
FT   CDS_pept        240345..240803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM1414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14040"
FT                   /db_xref="InterPro:IPR012033"
FT                   /db_xref="InterPro:IPR036608"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5R6"
FT                   /protein_id="ABK14040.1"
FT                   /translation="MSNPDALLLMGCPEVPVQMSLVLYLSGALRDKGLKVFIAGNPAAL
FT                   NLARVADRKRCYLGRLIELERTIADIVEGRRSFGICFAFAHNDAGITYAATVRALLPEA
FT                   RFFVIIFGRNAEELAGTVDFDAEKIAERAVHNPLGLKKKIDEVLTWAV"
FT   gene            240791..241099
FT                   /locus_tag="Mthe_0244"
FT   CDS_pept        240791..241099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14041"
FT                   /db_xref="InterPro:IPR012031"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5R7"
FT                   /protein_id="ABK14041.1"
FT                   /translation="MGCIEMLKPQILLRGISFREAREYIESSCDECYHFQPGFRLFGEY
FT                   IIGAPPIAVGIMKDGSIVFPYTKPCHGTFVLKHRDEAEAERVRKLGREEVMRSLKRR"
FT   gene            241242..241811
FT                   /locus_tag="Mthe_0245"
FT   CDS_pept        241242..241811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0245"
FT                   /product="flavoprotein"
FT                   /note="PFAM: flavoprotein; KEGG: afu:AF1518
FT                   DNA/pantothenate metabolism flavoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14042"
FT                   /db_xref="GOA:A0B5R8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR014072"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5R8"
FT                   /protein_id="ABK14042.1"
FT                   /translation="MSDRKPKVAWGITGSGDRLPEIVDMMKNVQEMYRDAVDIRVYISR
FT                   AGDQVVKYYKLFNELEASFDKIWVEANANAPFLAGQLQLGKFAFLIIAPATSNTVAKIS
FT                   LRLADTLLTNAAIMAQKAYVPLYIMPSDYEEGVTITKLPDGRDLKLRIRREDVEHVRRL
FT                   EAMDGTFVLRGVDEIPGVFEKHFGRP"
FT   gene            complement(241816..242289)
FT                   /locus_tag="Mthe_0246"
FT   CDS_pept        complement(241816..242289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14043"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5R9"
FT                   /protein_id="ABK14043.1"
FT                   /translation="MRSPLRAIQLAIILCACMHTGSGGVTVMLTTGESLQFAGNLTLVV
FT                   EDVDPQAGRVWLSLYTSGSPVASSVLGIGDHFVFYGVKRMDLQVINIYAGGDRDLVVLD
FT                   VIEGILASPTGVLRNASYEDADEAKKVNAAPGFGSLEMLLALSLGALASLWQN"
FT   gene            complement(242387..243361)
FT                   /locus_tag="Mthe_0247"
FT   CDS_pept        complement(242387..243361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0247"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: mma:MM0602 O-sialoglycoprotein endopeptidase;
FT                   TIGRFAM: putative metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14044"
FT                   /db_xref="GOA:A0B5S0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5S0"
FT                   /protein_id="ABK14044.1"
FT                   /translation="MYVLGIEGTAWNLSAAIVNEDDVIIERAATYTPARGGIHPREAAQ
FT                   HHSEHIGPLLREVIQGARDLGIKIDGVAFSQGPGLGPCLRTVATAARVLALKLNVPLVG
FT                   VNHCIAHIEIGKWKTGARDPAVLYVSGGNSQVLALRRGRYRIFGETLDISVGNMLDKFA
FT                   RSVGLPHPGGPRIEELARNAKEYIPLPYTVKGMDFSFSGLATAAAEAARRYDLEDVCYS
FT                   LQETAFAMLVEVTERAMAHAEKKEAMLVGGVGANRRLGEMLRLMCEERGARFYLPERRF
FT                   MGDNGSMIAYTGLVMLKSGVSTPIESSGVRPNYRTDEVEVRWA"
FT   gene            complement(243504..244910)
FT                   /locus_tag="Mthe_0248"
FT   CDS_pept        complement(243504..244910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0248"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; KEGG: afu:AF1157
FT                   phosphoribosylamine--glycine ligase (PurD)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14045"
FT                   /db_xref="GOA:A0B5S1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S1"
FT                   /protein_id="ABK14045.1"
FT                   /translation="MAGARILVVDAGGRGNAIAHAFSRSPSVEKVFVAPGNAGSSLLQK
FT                   CSQADGAQIKSIDEMLSFAERNRIDLTFVGPEGYLSAGIVDAFEERGLDIVGPERRAAL
FT                   LEGSKCWTKDLLSEIGVPVPPYRNFDDPDEAKEFVDQFYDTHPGENLVIKADGLAAGKG
FT                   SVVCSSRDEALSTVERIMVEPRIFGDAGNRIEIERRLEGRELMFFAIADGKNILPLESA
FT                   MDYKQAFAPDEITAIRLFNRLSGNPNLENNPNTGGMGGFSPHPWLDDDLRETIMSRIAR
FT                   PTMRRIYDMGLRYRGFIYFGLMIMERDGEREPYVLEINVRLGDPEAEVILPRLRTDMYR
FT                   LSRAVLDQRLNEIELEWNPEYHLGVCAVSGRVVKPVSSGSEERPGYPGAHYTNIPIRGL
FT                   DKVDPDVLVYHNGTAFGDSGKIYTTGGRVLTLVAKGSSLAEARSKAYDNIRRIRFNGMR
FT                   YRKDIGLDYL"
FT   gene            245076..246377
FT                   /locus_tag="Mthe_0249"
FT   CDS_pept        245076..246377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0249"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: mbu:Mbur_1975 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14046"
FT                   /db_xref="GOA:A0B5S2"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S2"
FT                   /protein_id="ABK14046.1"
FT                   /translation="MEIIRDRNVEFIRLQFTDIQGIVKNVAIPVTQLGKAFKTGISFDG
FT                   SSIEGFARIQESDMVLKPDLDTFCILPWRSMGGTNEARLICDVYTSKGVPFEGDPRYVL
FT                   KRNLEVAAKMGYTMNVGPELEFFLFERENGSGTKPHDFGGYFDLGPVDLAEDVKREIVR
FT                   VLIEMGFTVEAAHHEVARGQHEIDFVYDEALRNADKVVTFKYVTKTIALKNNLRATFMP
FT                   KPIYGQAGSGMHVNISLFRKGENTFFDPERPYNLSDVGRYFVGGLLEHAPAITAVANPL
FT                   INSYKRLVSGFEAPVYISWSGPNRSSLIRVPAARGLSTRIEFRSPDPSCNPYLAFAAIL
FT                   AAGLDGIRKGIDPGEPLDLNLYGLSQAELDQLGVRMLPSNLHEALVALEEDKVIRDALG
FT                   EHVVNNLLRLGKLEWRNYNTYVHQWEIDRYINII"
FT   gene            complement(246419..246817)
FT                   /locus_tag="Mthe_0250"
FT   CDS_pept        complement(246419..246817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0250"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: mma:MM0574 arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14047"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S3"
FT                   /protein_id="ABK14047.1"
FT                   /translation="MFSTQSLMKKRVLFVCVHNSARSQMAEALLRALKGDNYEAYSAGI
FT                   EPTEVDPNAVSAMAEIGIDISEQRSKGLDSMRDIHFDTIVTLCDAADSCPYIPGVHMHR
FT                   AFPDPAGGGINAFRRVRDDIKRWIEDTF"
FT   gene            complement(247127..248245)
FT                   /locus_tag="Mthe_0251"
FT   CDS_pept        complement(247127..248245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0251"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: helix-hairpin-helix motif; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   mth:MTH1458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14048"
FT                   /db_xref="GOA:A0B5S4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S4"
FT                   /protein_id="ABK14048.1"
FT                   /translation="MERSILARGASFDLEDVDIKVQALSRSTRYDRCCHRRNDDSLIYS
FT                   ASGRNGCHVRLFKTLFTNECYHQCGYCPNAGTSNGCSYTPEELSNIVSSLRREGLIDGL
FT                   FLSSGAGRDEDSTMEEMLETVRILRERHGFSGYIHLKILPGTSRHLIEEAVELADRVSI
FT                   NIEAPSMDVMHELSPTKDYERDILDRQMYIRDILARRSRGSQTTQLVVGAAGETDLEIF
FT                   QRVVKEYREIGVSRVYYSAFVPIKGTIFEGKQPQLRWRESRLYQLDWLYRVYRLSPEQI
FT                   KNVFDDYGFLINQDPKVILAGESLDLPLDVNEADFQSLIRVPGIGPESARRIISYRRRE
FT                   RIESPSDLIRLGIKRKAIPYLKINGWVQKRLL"
FT   gene            complement(248474..249433)
FT                   /locus_tag="Mthe_0252"
FT   CDS_pept        complement(248474..249433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0252"
FT                   /product="methenyltetrahydromethanopterin cyclohydrolase"
FT                   /EC_number="3.5.4.27"
FT                   /note="PFAM: Methenyltetrahydromethanopterin
FT                   cyclohydrolase; KEGG: mbu:Mbur_0653
FT                   methenyltetrahydromethanopterin cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14049"
FT                   /db_xref="GOA:A0B5S5"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S5"
FT                   /protein_id="ABK14049.1"
FT                   /translation="MSINEMGFEVFEEMLDLADDLRVDVIELENGAVVIDAGVKAPGGL
FT                   WAGIFISRICMADLADIQIVPYGLKGISVPGIQVTTDHPAISCMGSQCAMWQIKVDKYF
FT                   AMGSGPARALARKTKDLYERIGFDEYSDVGAIVLEASRIPDAAVAARIAEMCGIEPSDL
FT                   RIAVAPTDSVAGMVQVSARIVETGMHKLFTMGFDITKIKSGWGVAPIAPVAGDATMCMG
FT                   ASNDAIIYGGDTYYTIEYENLEELKDYVRKMPSSASRDYGVPFYSAFKAAGFDFFKVDH
FT                   NIFAPARVVMNELISRTTIVSGRLNHDVLMESFGIQVL"
FT   gene            complement(249567..250268)
FT                   /locus_tag="Mthe_0253"
FT   CDS_pept        complement(249567..250268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0253"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   sru:SRU_0303 conserved hypothetical protein TIGR00266"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14050"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S6"
FT                   /protein_id="ABK14050.1"
FT                   /translation="MSLRYTILGDDLQVLEVQMAPGESIRSEAGAMLFMDDEIDMSAST
FT                   GGIIKGLKRAVAGEGLFITSFTNRSDDMKRMAFSAPFPGKILPLNLDEFGGQLLCQRGA
FT                   FLCGESGVEIELAFTKRLGAGFFGGEGFVLQRLRGRGMVFIHAGGALITRDLQEEEVIN
FT                   VDTGCLVAFSRDVDYDIRFVGGIRNALFGGEGIFLARLKGPGRVYLQSLPLSRLADRIL
FT                   QGRVVSSNNTE"
FT   gene            complement(250381..252213)
FT                   /locus_tag="Mthe_0254"
FT   CDS_pept        complement(250381..252213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0254"
FT                   /product="glycogen debranching enzyme, putative"
FT                   /note="TIGRFAM: glycogen debranching enzyme, putative;
FT                   PFAM: Amylo-alpha-1,6-glucosidase; KEGG: mbu:Mbur_0439
FT                   glycogen debranching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14051"
FT                   /db_xref="GOA:A0B5S7"
FT                   /db_xref="InterPro:IPR006451"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024742"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S7"
FT                   /protein_id="ABK14051.1"
FT                   /translation="MIPYSDGISREWIVTNGIGGYASSTSIGANTRAYHGLLIASLSPP
FT                   VDRWLLLSSLDETVNGIELANHQYPGVVHPRGFMYLESFTAEPVPTYLYRANGIEVVKQ
FT                   IFMVHGENTTVVKYHISGDSHIRIMPLVTSRCFHAVSGRPEIRQEIMERGTLLRSRCNL
FT                   HLFSDRARYVRNEVWYHNFEYEIERVRGLGWVEDLLCPGWFEADVENELDLCITASTRM
FT                   VDADDSVLTDELKRQSKLLSTLPEEMRSLAIAADSFLVRRGSGMSIIAGYHWFDDWGRD
FT                   AMIALPGLLLCTGRFDDARAVLRTFSEQMQDGLIPNDLGAGSYNTVDASLLFIRAVCEY
FT                   HRFSSDSSFIRELWPTLMGIIECYTTMTPVGYMDSDCLISSSEGATWMDARVDGRCVTP
FT                   RAGKCVEVNALWYEALRSLEELSEAAGLEWRWHGLAERVRRSFRRFWNPAGYLYDTIDP
FT                   YDGSVRPNQVVAVAFSHGLLSLERTRAVVRNATEELLTPYGLRTLSPRDPAYIGRYEGS
FT                   PRERDQAYHQGTVWPWLIGPYITAYLRASRYSKRSRMHAISLLRPLLEERRYGIGTIAE
FT                   VYDGDPPHRPGGCISQAWSVAEVIRAFLEARDGI"
FT   gene            complement(252248..253735)
FT                   /locus_tag="Mthe_0255"
FT   CDS_pept        complement(252248..253735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0255"
FT                   /product="Alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /note="PFAM: glycoside hydrolase, family 57; KEGG:
FT                   mbu:Mbur_0437 alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14052"
FT                   /db_xref="GOA:A0B5S8"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S8"
FT                   /protein_id="ABK14052.1"
FT                   /translation="MFEHMTDISISFEVHQPFRLKKEFFWSGSIFRRTRPHHDFYFDDI
FT                   ENRNVFERVAEKCYLPANRIMLELIKRFSDTDRPFKVAYSLSGVFVEQCRRYRPDVLDT
FT                   FIEMVDTGNVEILDQTYYHSLTSLFDRKEFREQVRMHRELMWDIFGVKPTIFENTELIY
FT                   NDEIAAMAEDMGYRGIFAEGVIADPNHVYRPEGCRSISLLLRNYQLTDDIGFRFSSRNW
FT                   EEFPLTADKYAAWLAATPGRCINLFMDYETFGEHHWPETGIFEFLRCLPGEILKWKNLR
FT                   FSTPAEIVERVEPSRTVSVRSARSWADLERDTSCWLGNALQWACYTYLQNLQGPSREAG
FT                   EDTLRIWRLLSLSDHLYYIFTHGGGPGEVHSYFSPYGNPYDAAVTYFSVLSDLHRRLSE
FT                   ILDMADHPFVLSTKDGAEIGTAWSTQGMVNMLSRADTDTLEHHASLGSFATWASQSLGD
FT                   ERLARALRKASKLKGEDLRGALLDALNRRMKRSAKKS"
FT   gene            254316..255212
FT                   /locus_tag="Mthe_0256"
FT   CDS_pept        254316..255212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0256"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: nph:NP0262A
FT                   homolog to prenyltransferase (probable 4-hydroxybenzoate
FT                   octaprenyltransferase , probable protoheme IX
FT                   farnesyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14053"
FT                   /db_xref="GOA:A0B5S9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5S9"
FT                   /protein_id="ABK14053.1"
FT                   /translation="MTWSNQFREVIPFKYFYLVCRDAIDAVERLLAFLAVTSLFIGGTG
FT                   FFKTYMASLLLGIQPSMMICFAVFLVSFSVYTLDKLVDLDRDISNMPARKQFLYSRRRF
FT                   FLVLALSAYLAAALIMVYVRPAALPLVFVPVIANAFYGMRLLPWIPRLKDIPVMKNVVV
FT                   GSAWALVTVLIPVFHSGYGSPWALVLYFIFIKTFIDTVLYDIRDVAGDRISGVRTMPVI
FT                   LGETPTVLVLLILNTTILPVSLFLPGGSREIALALTLYGYAYIAYLRRRRNPVVLDMLV
FT                   EGEWMMACVALYLLNAL"
FT   gene            255613..256047
FT                   /locus_tag="Mthe_0257"
FT   CDS_pept        255613..256047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0257"
FT                   /product="CMP/dCMP deaminase, zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding; KEGG:
FT                   mac:MA0137 dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14054"
FT                   /db_xref="GOA:A0B5T0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T0"
FT                   /protein_id="ABK14054.1"
FT                   /translation="MDRPGLDEYFMEIASVVAKRSTCLRNRVGAVIVRDKRILSTGYNG
FT                   APTGLEHCDVAGCLREKVESGTRHELCRAVHAEQNAIIQAALHGVSIEGATLYCTHQPC
FT                   ILCAKMMINARIRRVVYRNQYPDEGALRFLEQAGIEVVRI"
FT   gene            complement(256121..257398)
FT                   /locus_tag="Mthe_0258"
FT   CDS_pept        complement(256121..257398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0258"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase; KEGG: sso:SSO0989 sugar
FT                   phosphate nucleotydyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14055"
FT                   /db_xref="GOA:A0B5T1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T1"
FT                   /protein_id="ABK14055.1"
FT                   /translation="MPPPVIATVGGGGTRLYPLTLCQPKPLVEVCDTAIIAVLFRVLAI
FT                   QGCRRFILGSKGFENTLALSNYFKAGEGFFKRLGIDEHEEFSYQPQYEDHGSADSLRYC
FT                   INYFNLNDDVLVVSGDNLIDIDLEEFIAYHRRRNPILTVALKELPREESVSQYGVAELE
FT                   SDMRIRRFVEKPKAGTEPSRMINTAFYLFSPEIRDVLAEMGDKSRDIGGDLIPYLTENG
FT                   YDVCGYPLKGYWIDIGTPERLLQATMNVLAGKVRHFKFRHPYRESQWIHPSTLKRIGPL
FT                   LERGDIELRGSVFIGRDCRIEPGVVIENSHVGHTCMIERNVEIRNSAVMSISNIMHGVR
FT                   LNRAIVGRYSTIEAHSVLDADQFNGRKGIPVVGDNVRLQKESVVGPGTRVAPLRYSHMI
FT                   LATGKFLELGSDERNIYFTQRPQTPA"
FT   gene            complement(257588..259657)
FT                   /locus_tag="Mthe_0259"
FT   CDS_pept        complement(257588..259657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0259"
FT                   /product="replicative DNA helicase Mcm"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: MCM family protein; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: mbu:Mbur_2432 MCM"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14056"
FT                   /db_xref="GOA:A0B5T2"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T2"
FT                   /protein_id="ABK14056.1"
FT                   /translation="MSYDPVSKWEEFIRSRYWDDLLKLAESYPSTRSLIVDFADLDRYD
FT                   TEFADDLLENPDVMLDAAHTALQEIVLPVDVDLSGAHVRIVNLPQHLKTRDLRSDHIGK
FT                   LIAIEGQVRTATEVRPKIVRAAYECQRCGHVFYVDQSGTKFIEPYECPNEACDRRGPFR
FT                   LLPKRSQFVDAQKVRVQESPEDLRGGEQPQTLDVELGDDLVGRIFPGDRVIINGILRSY
FT                   QRTTQSGKSTYFDLFLDGISIEMMEQEFEEIEISPEDEKRILELSRDPNIYEKIVRSIA
FT                   PSIYGYEDVKEALALQLVSGFSKRLPDGARIRGDIHILLVGDPGVAKSQLLRYMAKLSP
FT                   RGIYTSGKSSTSAGLTATAIKDELGDGRWTIEAGALVLADKGIAAVDEMDKMSPDDRSA
FT                   LHEAMEQQTISVAKAGVMATLKSRCALLAAANPKMGRFDRYEPIAPQINLTPALMSRFD
FT                   LIFVLTDEPNVERDSHIATHILKSNYAGELTSNKHNSSINEEEIENATEVIKPEIEPEL
FT                   LRKYVAYARKNVFPMLTRVAMERFKEYYINLRSQGQDGNKPVPVTARQLEALIRLGEAS
FT                   ARLRLSNWITEEDVDRVIKIVESCLKKVGVDPETGMLDADVISIGISKSTRDKTKQMLN
FT                   IIKELGGKDGAHIDDVLDRAEAEGIDRDRAEEIISRLRQEGSLIQTSRGTLKAV"
FT   gene            259976..261280
FT                   /locus_tag="Mthe_0260"
FT   CDS_pept        259976..261280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0260"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: mbu:Mbur_0207 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14057"
FT                   /db_xref="GOA:A0B5T3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T3"
FT                   /protein_id="ABK14057.1"
FT                   /translation="MSGYWDPHMERMPAEDLYALQLDRLKAVTRYVYDHSSFYRQRFAE
FT                   AGVTPDDVKELDDITKLPFTRKVDLRNTYPTGMFCLPKNWVVRYHVSSGTTGKPTVVGY
FT                   TKGDIEAWTESLARALTSIGLGRNDVIQVGYGYGLFTGGLGLHYGAERIGATVLPTSTG
FT                   NTERQIELMQDLESTAIACTPSYFLHIAEVAERMGVSIRDDTKLRVGIFGAEPWSIETR
FT                   RRIEDITGIKAYDIYGTSEISGPLFTECQHQNGIHVWADMFLIEIVDPKTGEQVEDGEQ
FT                   GELVVTTLNKWAMPLIRYRIGDLTIKESEPCECGRTHPRIMRILGRTDDMLVIRGINVF
FT                   PSQIESVLMNIPEVGPHYQIIVSREGALDVMKVRVELTDRGFSDRIGDLMALNRRISKE
FT                   LKNVLNIFAEVELVEPGVIPRSEGKAKRVIDTRKV"
FT   gene            261294..261728
FT                   /locus_tag="Mthe_0261"
FT   CDS_pept        261294..261728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0261"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   mbu:Mbur_0208 amino acid-binding (ACT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14058"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T4"
FT                   /protein_id="ABK14058.1"
FT                   /translation="MSEIKQISLFVENRPGRMAKVSKTLSDAGVNIRAMTIAEAGDFGV
FT                   IRMVVDDPQKGYDVLRDSGFTVSMTDVLAVEMRDTPGGLYEIVSALGENNINIDYAYAF
FT                   VTAKSEKAMLIMRVDDIDAARRTLSSRGVKIATPEEIQKI"
FT   gene            complement(261881..262798)
FT                   /locus_tag="Mthe_0262"
FT   CDS_pept        complement(261881..262798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0262"
FT                   /product="replication factor C small subunit"
FT                   /note="PFAM: AAA ATPase, central domain protein;
FT                   Replication factor C; SMART: AAA ATPase; KEGG: afu:AF2060
FT                   activator 1, replication factor C, 35 KD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14059"
FT                   /db_xref="GOA:A0B5T5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T5"
FT                   /protein_id="ABK14059.1"
FT                   /translation="MGQPEIVRRLKSYVATRNLPHLLFSGPPGVGKTAAAISIVREIFG
FT                   EGWRDNFIELNASDERGIDVVRTKVKDFARMAPLGGAEFKVIFLDEADALTSDAQSALR
FT                   RTMERYSATCRFILSCNYSSKIIEPIQSRCAVYRFRALTPDAIEKRIRYIAEQEGVEVT
FT                   EDGIEAINYVARGDMRKAINALQAAALISDKVDMNTIYQITSMARPEQIRNLIKMAISG
FT                   DFAGARNELDDLLLVQGLSGQDVVVQIHREMLDLDVPDADKVRMINRIGEIDFRITEGA
FT                   NERIQLEALIAYMALTGLSKSTAT"
FT   gene            complement(263073..263672)
FT                   /locus_tag="Mthe_0263"
FT   CDS_pept        complement(263073..263672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0263"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="PFAM: GPR1/FUN34/yaaH family protein; KEGG:
FT                   gme:Gmet_1126 GPR1/FUN34/YaaH"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14060"
FT                   /db_xref="GOA:A0B5T6"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T6"
FT                   /protein_id="ABK14060.1"
FT                   /translation="MATNKALDSTIKVLDTTANPAPLGLMGFGMTTVLLNLHNAGYFEL
FT                   GSMILAMGIFYGGIAQIIAGIMEWKKGNTFGTTAFTSYGLFWLTLVGLIMIPGMNLGEK
FT                   TSLPAMTAYLFMWGLFTAVMFFGTLRANRALQFVFLSLAILFFLLAARDATGSAAIGTL
FT                   AGYEGIICGLSAIYTALAQVLNEAHGRVILPLGQVK"
FT   gene            264271..265098
FT                   /locus_tag="Mthe_0264"
FT   CDS_pept        264271..265098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14061"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T7"
FT                   /protein_id="ABK14061.1"
FT                   /translation="MIIAVSDVHMAERPSDRQVKADDARFLEFLDCTASDQLSSGGHLV
FT                   LLGDIVDLWRRDFVRALIESEPALSRLIEISRKATVHYIAGNHDFHMLRMWELANNRFP
FT                   FEVTKPLRLEDGMTKLFFIHGYQLEVLANPYCKSVSAYETFSEGLCIAGDDTGNAADKL
FT                   WDTFNVAKSALDGIKRLPSDLKGAIDSMMQSQGIRMTGPHNTRAMAEQLASSMARVVYL
FT                   GMEPDEFLISGHTHRPFCNPEERIANTGSWNKEPCDHYSFIEIDDGRVALRKF"
FT   gene            complement(265271..266284)
FT                   /locus_tag="Mthe_0265"
FT   CDS_pept        complement(265271..266284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0265"
FT                   /product="Transcription initiation factor IIB (TFIIB)"
FT                   /note="PFAM: Zinc finger, TFIIB-type domain protein;
FT                   Transcription factor TFIIB, cyclin-related; SMART: Cyclin;
FT                   KEGG: mbu:Mbur_0963 transcription factor TFIIB,
FT                   cyclin-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14062"
FT                   /db_xref="GOA:A0B5T8"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5T8"
FT                   /protein_id="ABK14062.1"
FT                   /translation="MEEIERIREIERTEQEKIKERIKLQREKEKEEELDKYTVECPECG
FT                   SRALVRDYERAELVCSECGLVIDENFIDQGPEWRAFDHDQRMKRSRVGAPMTYTIHDKG
FT                   LSTMIDWRNRDSYGKTISSKNRAQLYRLRKWQRRIRVSNATERNLAFALSELDRMASAL
FT                   GLSRNVRETAAVIYRRAVEKNLIRGRSIEGVAAAALYAACRQCNVPRTLDEIAEVSRVS
FT                   RKEIGRTYRFVSRELSLKLMPTSPIDYIPRFCSGLNLKGDVQAKGIEILRQAAEKELTS
FT                   GRGPTGVAAAAIYIASILCNDRRTQREVADVAGVTEVTIRNRYKELAEELNIEIIL"
FT   gene            complement(266272..266529)
FT                   /locus_tag="Mthe_0266"
FT   CDS_pept        complement(266272..266529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0266"
FT                   /product="snoRNP protein GAR1"
FT                   /note="KEGG: hma:rrnAC0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14063"
FT                   /db_xref="GOA:A0B5T9"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5T9"
FT                   /protein_id="ABK14063.1"
FT                   /translation="MKRLGTALHVVQNKLIVRRDAADPPRIGSVVVDRKSTKVGKVSDI
FT                   FGPLERPYVIVRPARGVDATVHVGSMLYVKSPRRDDKWKR"
FT   gene            266619..267539
FT                   /locus_tag="Mthe_0267"
FT   CDS_pept        266619..267539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0267"
FT                   /product="Nucleolar GTP-binding 1"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; Nucleolar
FT                   GTP-binding 1; Miro domain protein; KEGG: mba:Mbar_A2164
FT                   GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14064"
FT                   /db_xref="GOA:A0B5U0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041623"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5U0"
FT                   /protein_id="ABK14064.1"
FT                   /translation="MFERLSTVPDAQELLERAFRRGSKAVKAAGDDAAFVGTAGGVLAT
FT                   ALSSIVRRFPTFEKLPEFYYDLVDAVVGVDQLRISLSRVGWAAKQIRRISREYMRSPRG
FT                   AGERRSALGRMASVVKSIDEDLAFLNEASARLREIPGIDPSLPTIIIAGYPNVGKSSFL
FT                   AMVTRARPEIASYPFTTQGLIVGHITMKDKRYQILDTPGLLDRPLSERNEIERQAIAAM
FT                   RHLRGVVLFLIDPTGHCGYPLDAQHRLLEEIKSWLELPVVVAYNKSDIPSDHPRDGIRI
FT                   STLTGDGVQETLEICLSIMSAESRL"
FT   gene            complement(267514..267918)
FT                   /locus_tag="Mthe_0268"
FT   CDS_pept        complement(267514..267918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM1973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14065"
FT                   /db_xref="InterPro:IPR012546"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5U1"
FT                   /protein_id="ABK14065.1"
FT                   /translation="MRIRVVSTKSEIERLNRDEMFVHLAFRASNADIFRLLQRCPQLKA
FT                   IQVPASYYRTLSQAGKMFLQIHGVTLIEGDVWGHRKDLSEYLIIEEQDLRRISELLSSG
FT                   MSPEDIAESLCDDMKVSPGLVRFIGETRRS"
FT   gene            complement(268135..269580)
FT                   /locus_tag="Mthe_0269"
FT   CDS_pept        complement(268135..269580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14066"
FT                   /db_xref="GOA:A0B5U2"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5U2"
FT                   /protein_id="ABK14066.1"
FT                   /translation="MICRLRSSFLLLLLISITSDSSAVTISADEIMQKVVSGEPVILDG
FT                   VSISGSLNLSRIEPQIVRRAFVITNSEMGDVDLSGLVFEDAVDLTSTKFDGMNFASAVF
FT                   SDGAFFDRIVVSGDASFEGAHFKQDVSFSGSRFLGDAEMNFTAFDGYGYFADSAFLGDL
FT                   HISSSSFQGFADFYGVCISGDFICLNTKFGDGAGFMSTEFDGDANFGMSSFAGYTSFDG
FT                   SVFRGDANFALARFDKAVYFGDIRFEGDAIFGLTEFEGLANFAGTYFAEDLNLNSARID
FT                   AFVLDNTTFGRASGINLKGAEFRRLTAPWPHIRDHILYDGATYLALVKNYQELEWFEDA
FT                   DDCYYDYRREAQLRKPLGWGKIIDYLAWITCGYGVRPSYPFVWSIVLIPLFGLIFYLGK
FT                   GIHRQSAAPNENPERLKEDFPAEEIPASLHESMYFSALIYLYAGPVEFRPSGIYRYLVI
FT                   LEGILGWLFLSLFLVCLGRVMIR"
FT   sig_peptide     complement(269494..269580)
FT                   /locus_tag="Mthe_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.783 at
FT                   residue 29"
FT   gene            complement(269889..270521)
FT                   /locus_tag="Mthe_0270"
FT   CDS_pept        complement(269889..270521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14067"
FT                   /db_xref="GOA:A0B5U3"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5U3"
FT                   /protein_id="ABK14067.1"
FT                   /translation="MMAAENWRSSLIKEIRRKSIHLTGLSVPIILLKAGWYVTVGFVAT
FT                   ALLVAVVLEALRLRGMIHLPEVRQSEQGRVAGYFFYISGCLLAVILFSEMVAALAILML
FT                   CIGDAASGIVGSVVVGSNVRDIDNTQLNSTRKRKPRVVAAAMLSVCVLLGFLTSGFTHL
FT                   PPHVYLAGAAGATLADSVPLFIKGRSVDDNFAIPLVSGALMTAASVI"
FT   gene            complement(270518..272251)
FT                   /locus_tag="Mthe_0271"
FT   CDS_pept        complement(270518..272251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0271"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: mbu:Mbur_0919 glycyl-tRNA synthetase; TIGRFAM:
FT                   glycyl-tRNA synthetase; PFAM: tRNA synthetase, class II (G,
FT                   H, P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14068"
FT                   /db_xref="GOA:A0B5U4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022960"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5U4"
FT                   /protein_id="ABK14068.1"
FT                   /translation="MDRYEQVTELARRRGFMWPSFELYGGAAGFYDYGPLGARLKRRIE
FT                   DIWRRFFVIGEGFAEIECPTIGIEEVFRASGHLSGFSDPLTECKECKEIYRADHLIKHI
FT                   VEVPDALSAEEIYRMIKENDITCPECGGELSEVYEFNLMFRTAIGPGNRHPGYLRPETA
FT                   QGMFINFQRLLRYYRDSLPFGAVQIGRSYRNEISPRQGVIRLREFSQAEAEVFIDPRNK
FT                   QHPRFSEVKDLRLRLYSREAQERGQVEEMSVGEAVERGIIAHEILAYFVARTYEYLLAV
FT                   GVDRERLRFRQHKADEMAHYAADCWDAEVLLDRLGWIEIVGIADRTDYDLRSHMALSKA
FT                   NLSVFVHYPEPVRRKRVAVKPDMKVLGPRFKGRAKAIADALQAMSVADLKGDTIKITVD
FT                   GETYEIERRLVSVEEIEEEIRGEYVVPHVIEPSFGIDRILYTVLEHSYHEEPVEDEMRV
FT                   VLRFLPGISPIDVAILPLMDKDELVEPARRIFDEFRRCGMLAEFDTSGSIGRRYRRNDE
FT                   IGTPYCITVDYQTLEDGTVTVRDRDTMQQIRIEADRAVDIIRDLMSGALCFSEAGMPVK
FT                   S"
FT   gene            complement(272306..272731)
FT                   /locus_tag="Mthe_0272"
FT   CDS_pept        complement(272306..272731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA2388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14069"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5U5"
FT                   /protein_id="ABK14069.1"
FT                   /translation="MHIMDVRIMTTIKNAPRTATTIKVRSKPEYMISRSRDPYHELMLR
FT                   LFKDETTAMRGRRFLGIVEDRMREGNPLKTNEWESLIRELGISRSAFYAMRNKLLGAGL
FT                   ISIRGGEYRLSGAFSKDLVDMARWWWTAVLGNSLENL"
FT   gene            complement(272860..273141)
FT                   /locus_tag="Mthe_0273"
FT   CDS_pept        complement(272860..273141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14070"
FT                   /db_xref="GOA:A0B5U6"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5U6"
FT                   /protein_id="ABK14070.1"
FT                   /translation="MLWDRRRSRSFTCSDMHLYSGSCIHHAMEMWKILLICLLMLPVFF
FT                   VLNYLVVVYMARSRREREMRVERFVGDSVGSDYRARRFVTRRYRPRRR"
FT   gene            273205..273546
FT                   /locus_tag="Mthe_0274"
FT   CDS_pept        273205..273546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0274"
FT                   /product="signal recognition particle, subunit SRP19
FT                   (srp19)"
FT                   /note="PFAM: Ribonucleoprotein complex SRP, Srp19
FT                   component; KEGG: mka:MK1551 19 kDa subunit of the signal
FT                   recognition particle"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14071"
FT                   /db_xref="GOA:A0B5U7"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5U7"
FT                   /protein_id="ABK14071.1"
FT                   /translation="MDSDEWTSQKLKWILKREIHMPEDRLVIWPAYFDLERSRGQGRRV
FT                   ATANAVRNPKLEDIIRASKDLGLDPVVETEKCYPKNWYEQPGRVLVLKKGSKTKTLRSI
FT                   ARALKKRRS"
FT   gene            complement(273543..273860)
FT                   /locus_tag="Mthe_0275"
FT   CDS_pept        complement(273543..273860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0275"
FT                   /product="protein of unknown function DUF211"
FT                   /note="PFAM: protein of unknown function DUF211; KEGG:
FT                   pho:PH1931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14072"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5U8"
FT                   /protein_id="ABK14072.1"
FT                   /translation="MYLIHYCLGGNMIRRIVLDVLKPHKPTIIELANVLSDLKGVKGVN
FT                   MSLFEVDRQTETVKVTIEGDNIDYHAVERLIQEFGGAVHSIDQVVAGREMVEEIDTCQE
FT                   P"
FT   gene            complement(274058..275167)
FT                   /locus_tag="Mthe_0276"
FT   CDS_pept        complement(274058..275167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0276"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase;
FT                   Myo-inositol-1-phosphate synthase, GAPDH domain protein;
FT                   KEGG: mth:MTH1105 myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14073"
FT                   /db_xref="GOA:A0B5U9"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5U9"
FT                   /protein_id="ABK14073.1"
FT                   /translation="MKKIRLAVAGVGNCASSLIQGIEYYKDRSAEDCVGLMHYDICGYR
FT                   PGDIDVVAAFDIDARKVGHDISEAIFAKPNCTKIFYPHVPYKGVEVRMGPVLDGVAPHM
FT                   VDYPEESTFVVADQPPCDVRKELEDSGAEILINYMPVGSERATRFYAQAALDAGVAFIN
FT                   CMPVFIASDREWATKFQERGIPVVGDDIKSQIGATIVHRTLAKLFMDRGCRLDRTYQLN
FT                   VGGNTDFLNMLSRDRLRSKKISKTEAVQSVLDAPLDPENIHIGPCDYIPWQKDNKVCFL
FT                   RMEGRIFGDVPINLELRLSVEDSPNSAGCTIDAIRVCKLAIERGIGGPLLEISSYTMKH
FT                   PPVQYPDEVAKELVERFIAESKNVIEAKV"
FT   gene            complement(275373..276233)
FT                   /locus_tag="Mthe_0277"
FT   CDS_pept        complement(275373..276233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14074"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V0"
FT                   /protein_id="ABK14074.1"
FT                   /translation="MIHRGIRTKGGTMPLETQEKIDALLDEFVSFVNEISDSRHLQRGI
FT                   ARSSLPCSIVVILDRSKLLVIAQFRPSNLSSMYISAEHLELAADQALSKASWEFGFEDP
FT                   FLLQFPADLLDTPAADRADALRKMAEDHVDSEFLRFMGMLSMLRLRPAFGPAPYVLENS
FT                   CAVLSPKGGQDVYDVISATLENLRVEPIMLRNITRTELSLRQAWRVICSSRLVIADLTE
FT                   RDADVMYGLGMAHAVGKPALIIHVEGEGVAFPGRKLPYSPSDMQSMRANLERALNDLLG
FT                   PILNL"
FT   gene            276361..276855
FT                   /locus_tag="Mthe_0278"
FT   CDS_pept        276361..276855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0278"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   gvi:glr3535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14075"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V1"
FT                   /protein_id="ABK14075.1"
FT                   /translation="MDVEIRRSKRRKKTIEIRLREDKIEVLAPADISDGDLNAHIARFR
FT                   SRMEMRKSRDDSYLEQRAMRLNMKYLGGVISWKSISYSDKMERRYGSCTPSNGTIRISP
FT                   RLRSMPVWVEDYVIVHELAHMIEPNHGPRFWSLVNRYPLAERARGFLMAMDMCRRNTMR
FT                   K"
FT   gene            276920..277477
FT                   /locus_tag="Mthe_0279"
FT   CDS_pept        276920..277477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0279"
FT                   /product="putative methylase"
FT                   /note="TIGRFAM: putative methylase; PFAM: methyltransferase
FT                   small; KEGG: mac:MA1440 HemK related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14076"
FT                   /db_xref="GOA:A0B5V2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V2"
FT                   /protein_id="ABK14076.1"
FT                   /translation="MVDVYPPSEDTYLLMRAAISEASAGDSVIEIGCGSGVISASLIGK
FT                   VRSILATDINPHAVRAAASLGIPAVRADLFHGINSKFDLILFNPPYLPTEDGLDLNPED
FT                   DRWLSTALDGGADGREVIERFLKGVKNIMSPRGRLLLLISSLTGLDEVQELARRSGFNT
FT                   EIVAMERYFFEELYVLKLRRAE"
FT   gene            277598..278557
FT                   /locus_tag="Mthe_0280"
FT   CDS_pept        277598..278557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0280"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain; KEGG:
FT                   mac:MA4460 dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14077"
FT                   /db_xref="GOA:A0B5V3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V3"
FT                   /protein_id="ABK14077.1"
FT                   /translation="MPILRDMSILVTGGAGFIGSHLVDALIKHNDVTVIDNLSTGKREY
FT                   LRAHEPNPRFRLIEADLLDRLEVYDAVKDKDIVFHLAANPSVAVGETDTRVHLEQNALT
FT                   TYNLLEAMRRARVRRIAFTSTSTVYGEAKIIPTPEDYGPLKPISLYGASKLACEAMISS
FT                   YCHTFDMQAWIYRFANIVGERGNHGVIVDFIRKLRANPNELEILGSGAQRKSYLDVRDC
FT                   VDAMIHCVEHADEQVNIYNIGSQDTIDVREIADIVVKTMGLDGVRYRFTGGIDGRGWKG
FT                   DVKLMCLSTDAIRALGWRPRLSSREAVARATESLLKEI"
FT   gene            complement(278664..278900)
FT                   /locus_tag="Mthe_0281"
FT   CDS_pept        complement(278664..278900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14078"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V4"
FT                   /protein_id="ABK14078.1"
FT                   /translation="MKFKEWTRPIRKFDDIYYTIERIVYGRGKLSGFTSEDIYNNLHDK
FT                   RFFRDVADLHNYLLAKGKTYRIRPKDGGWERIW"
FT   gene            279157..280065
FT                   /locus_tag="Mthe_0282"
FT   CDS_pept        279157..280065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0282"
FT                   /product="ribosomal RNA methyltransferase NOP2"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: putative RNA methylase, NOL1/NOP2/sun
FT                   family; PFAM: Fmu (Sun) domain protein; KEGG: hal:VNG0499G
FT                   Cna"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14079"
FT                   /db_xref="GOA:A0B5V5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V5"
FT                   /protein_id="ABK14079.1"
FT                   /translation="MGSEHLERYRDIIPDFDAFLDFMSRPLPVTIRINTLKTSVPELLS
FT                   RLDRLGIGYERMRWYPLGLRLDAEKPGRLMEFHMGLIHVQEELSMLPPVVLDPQPGERI
FT                   LDLCAAPGGKAAQISMQMSNKGLVVANDSSSARIVPLRANLERLGAVNVVVTSYDGRRF
FT                   PQYNFDRALVDAPCSSEGTARRYPEVIARCSAKRSADLQNLQVSLLRRAIQLTKPGGVV
FT                   VYSTCTFAPEENEGVVSRVLDLADLESFTIQGLRSSQGIASWNSIDYGEELVKCRRYYP
FT                   HENDTGGFFVAKLRRRLSAGE"
FT   gene            280058..280540
FT                   /locus_tag="Mthe_0283"
FT   CDS_pept        280058..280540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14080"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V6"
FT                   /protein_id="ABK14080.1"
FT                   /translation="MNKDAVVSLWNERFGIPEKVFERISFFRRGRMIWAFSLPEIPPFR
FT                   CESVGMRVISMRESPWKPTTYALQLWGRYARKNVIDLDDEMARRFFAGESLELRAPVER
FT                   GYVVVTHMGSVIGCGLYTPGRLISQLPRERRILEIEDQPACQDNTHPGDAHHEGAE"
FT   gene            280524..281600
FT                   /locus_tag="Mthe_0284"
FT   CDS_pept        280524..281600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0284"
FT                   /product="FO synthase subunit 2"
FT                   /EC_number="2.5.1.-"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: mac:MA1490
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14081"
FT                   /db_xref="GOA:A0B5V7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V7"
FT                   /protein_id="ABK14081.1"
FT                   /translation="MKALSDSTCEDMLNDSGDRAELNRDLMRFLWRNPMRLFSLSRRLQ
FT                   ESCCGREVTYVINRNINFTNICVGRCRFCAFRKSDGYILTHEEIVQRAKEAEQLGATEI
FT                   CLQGGLAPGLTVEDYCEILEVLKSNFPRMHLHAYSPMEVMHMSRCSGVDVHEALRSLRD
FT                   SGLDSMPGTAAELLVDSVRKVICPEKLSTSEWSFIIKAAHAMGIPTTSTMLYGHIESFE
FT                   DRLSHLEVIRSIQLETGGFTEFVLLPFVPGNTELGRISSPPDILENLKMHALARVALHP
FT                   YITNIQASWVKLGREVAGAAIEWGANDLGGTLMEENISRCAGSKEGQYMSPDEFQDLIK
FT                   KHGRVPTQRDTLYRRILR"
FT   gene            complement(282083..284023)
FT                   /locus_tag="Mthe_0285"
FT   CDS_pept        complement(282083..284023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0285"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: putative aconitate hydratase; PFAM:
FT                   aconitate hydratase domain protein; KEGG: sat:SYN_01409
FT                   aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14082"
FT                   /db_xref="GOA:A0B5V8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V8"
FT                   /protein_id="ABK14082.1"
FT                   /translation="MGYTLTERILRDHLVDGKYEPGSEIGIRIDQTLTQDATGTMAYLQ
FT                   FESMGLEGIATELSVSYVDHNTIQVGFENADDHRYLQSVAERYGIYFSRPGNGICHQVH
FT                   LERFGRPGKTLLGSDSHTPTGGGLGMIAIGAGGLDVAVAMGGGPYYLTAPKVMEVHLTG
FT                   ELQPWVTPKDVILKVLQILTTKGNIGWVCEYTGDGVAGLTVPDRATITNMGAETGVTTS
FT                   IFPSDEQTRRFLAAQGRAEHWVPLAPDRDATYDKSIEIDLSELEPLVAAPHSPGNVIPL
FT                   SRVVGTPVDQVLVGSCTNSSYTDMMTVASMVKGKHLPPNVSFGVAPGSRQVLRMMARSG
FT                   ALDDLIAFGARILESACGFCIGNSMSPGTDAVSIRTSNRNFKGRSGTPSANVYLTSPVV
FT                   AAAAAIKGEFVDPADLKMEFPRVEMPDRFEIDDSMIIPPKPAAERARVEIFRGPNIGEP
FT                   PRNTPMPGSIKGIVAIKVEDNITTDHIMPAGSRLKYRSNVPKYSTFVFEPLDPEFSRRA
FT                   AELRDKGLHNFIVAGVSYGQGSSREHAAMCPMYLGVKAVVAKSIERIHAANLVNFGILP
FT                   LYFVRESDYDIIEQGMSMTIPDIRNALESGESQVKAIAGDREIPLRMELSRRQREILLA
FT                   GGLLPYTVRSR"
FT   gene            complement(284484..284882)
FT                   /locus_tag="Mthe_0286"
FT   CDS_pept        complement(284484..284882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0286"
FT                   /product="uncharacterized domain 1 protein"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: mta:Moth_0402
FT                   phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14083"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5V9"
FT                   /protein_id="ABK14083.1"
FT                   /translation="MLRSKVDEQPFARRLGMRLVELDEGYSKVVMEPSWENRNFFGTVH
FT                   GGAIFSLIDQAFGAAANSHGAVAVAISVTVDYLRPASPDETLYAEAREVSRTRRISTYN
FT                   IEVRNQEGQLKATCLAMAYRRDERIQFE"
FT   gene            complement(285126..286538)
FT                   /locus_tag="Mthe_0287"
FT   CDS_pept        complement(285126..286538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0287"
FT                   /product="acetyl-CoA decarbonylase/synthase gamma subunit"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit; Fe-S cluster domain protein; KEGG: mbu:Mbur_0863
FT                   CO dehydrogenase/acetyl-CoA synthase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14084"
FT                   /db_xref="GOA:A0B5W0"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="InterPro:IPR016218"
FT                   /db_xref="InterPro:IPR023427"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W0"
FT                   /protein_id="ABK14084.1"
FT                   /translation="MKEKSPLNLYKHLPQTNCGKCGFQTCMAFAAALIDRSKRVEECTP
FT                   LAEEKKYAKKYETLKAIVAPEIRLVYVGTGEKEQKVGGEDVMYRHQMTFFNKPPFAYDV
FT                   TDTMEEAALVERVKKISTWKKFYIGKWERVEMIAVRSTSGDPAKFAACVKKVMETTDYP
FT                   MILCSFDPKVLRAGLEVAAKTRPLVYAANKDNWQEVAKLVHEFNVPVVLSVPFDLDGLK
FT                   SMALTFEQMGIHDLILDFGTAPNGKKLQESLHNLLKLRRAALEEGQKDIAYPTIALPIN
FT                   AWFTTKDPVRAAYWESVLTATFVIRGASIMIKHCIEPHCVMPDMHLRYNIYTDPRRPVQ
FT                   VKPGIYKVGNPTEESPVFVTTNFALTYYTVESDVASNNIDAYIMSINTDGIGVQASVAG
FT                   GQLNPQKIVEAFKEADFDFTKMKYPSIVLPGMAAKFSGELEDLFGGKVKILVGPEDSGR
FT                   IVEWMKSYWPPK"
FT   gene            complement(286544..287902)
FT                   /locus_tag="Mthe_0288"
FT   CDS_pept        complement(286544..287902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0288"
FT                   /product="acetyl-CoA decarbonylase/synthase delta subunit"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase, delta
FT                   subunit; PFAM: CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit; KEGG: mbu:Mbur_0862 CO dehydrogenase/acetyl-CoA
FT                   synthase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14085"
FT                   /db_xref="GOA:A0B5W1"
FT                   /db_xref="InterPro:IPR004486"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W1"
FT                   /protein_id="ABK14085.1"
FT                   /translation="MAEEKKIKLSDLNKTLAQYGVEALEGVSIEGDIEIEIDTGAAGIG
FT                   PLFAYYFGQEVAQIAVQLVKFARSMGYPVDALLQPAAVAHAISPAPAEVVEAAAKVPEW
FT                   KVATSLVQAKFQVGIDETWKYPIQEVTLGATKADGGSRGHTIKIGGEKALPFFYDAPMP
FT                   HRPVVTMDVFDMPIGMAKAVKMHYEDVINDPGEWAKKAVTKFGADLVTIHLISTDPLLK
FT                   DTPPREAAKTVEEVLQAVDVPICIGGSGNPDKDPEVLKAAAEVAQGERALIASANLNMD
FT                   WEKIGRACVDNGHVCLAWTQLEINSQKELNRKLMKVAGVPRESIVMDPTTAALAYGLDF
FT                   AYTNMERIRLGALKGDEELTFPMSSGTTNAWGVREAWMVRSPNKEDSDWGDRMLRGPIW
FT                   EIITGFSLAMAGVDIFMMMHPLAVAYLQEITQTLMGLIDAETPDITNWVKMEV"
FT   gene            complement(287915..288676)
FT                   /locus_tag="Mthe_0289"
FT   CDS_pept        complement(287915..288676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0289"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; SMART:
FT                   AAA ATPase; KEGG: mbu:Mbur_0861 cobyrinic acid a,c-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14086"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W2"
FT                   /protein_id="ABK14086.1"
FT                   /translation="MGRVIAITGKGGTGKTAVAALLVRYLIKSGRKYRVLVIDADPDSN
FT                   LADALGVEVTKTVGDMREFMQEARYTTPPETDKERLFEAKIFEILVEENGYDLLVMGKP
FT                   EGSGCYCFVNNLLRGIMDRLIDQYDITIIDTAAGLEHFSRKVIPDLDSLIVVTDSSRRG
FT                   LTTGERIRELASELGLKYNNLYVIANKVTENNKEKIIENARSVSLNVIGTIPYDERLAN
FT                   FDLVGDPLINLPDDAPSVKEIEEHVVKALGI"
FT   gene            complement(289137..290546)
FT                   /locus_tag="Mthe_0290"
FT   CDS_pept        complement(289137..290546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0290"
FT                   /product="acetyl-CoA decarbonylase/synthase beta subunit"
FT                   /EC_number="2.3.1.-"
FT                   /note="KEGG: afu:AF0379 acetyl-CoA decarbonylase/synthase,
FT                   subunit beta; TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, beta subunit; PFAM: CO dehydrogenase/acetyl-CoA
FT                   synthase complex beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14087"
FT                   /db_xref="GOA:A0B5W3"
FT                   /db_xref="InterPro:IPR004461"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR023432"
FT                   /db_xref="InterPro:IPR038571"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W3"
FT                   /protein_id="ABK14087.1"
FT                   /translation="MAEEIQLDISPMYEGERIRKDDLWVEMGGPKADGFELTLAASMDE
FT                   VEDGKVTIIGPDLKDVKEGSTIPFGMIFKVAGEKIEKDLESIIERRNHALLSYISGLMH
FT                   LNQRYDIWMRLGKSLQKKGVTSWEQIFKPVINLYKAEMPFIEKMEVTIVTDPAKVKEEL
FT                   EKAMQVYRARDERAKGLHDEDVDVFYGCTLCQAFAPTSACVVTPDRPSLCGAITWFDGR
FT                   AAAKVDPEGPQFPIPKEGLKDPITGEYESINQMAAKRSGGEYTVMKLYTFFDAPHTSCG
FT                   CFETIGFYMPEVDGIGICDREYKGNAPNGLPFSTMAGQTGGGKQVVGFLGMGVLYYFSP
FT                   KFLQADGGWRRIVWMSKRLKERVKEGIPAEMYDKIATEDDATDLESLKRFLLKVDHPVV
FT                   TGVVRPVDNKKITEGWKFEEITDELKEQVIAFIEKYEGEIDTDNVKNELLMSEGQFMQV
FT                   VEALQADGVLE"
FT   gene            complement(290597..291145)
FT                   /locus_tag="Mthe_0291"
FT   CDS_pept        complement(290597..291145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0291"
FT                   /product="acetyl-CoA decarbonylase/synthase epsilon
FT                   subunit"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, epsilon subunit; PFAM: CO dehydrogenase beta
FT                   subunit/acetyl-CoA synthase epsilon subunit; KEGG:
FT                   afu:AF2398 acetyl-CoA decarbonylase/synthase, subunit
FT                   epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14088"
FT                   /db_xref="GOA:A0B5W4"
FT                   /db_xref="InterPro:IPR003704"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W4"
FT                   /protein_id="ABK14088.1"
FT                   /translation="MAVDTTKNPIPFEMAQIPGPEMAKAYPVKVIGAIIKKAKRPLLVV
FT                   GAELFDDPVMFDKAIEIAKAKNMTIAATAHTIKGFIERGYTTNVYQIGLHPLTNYLRFK
FT                   DWKGLDGQGHYDVVIFMGIFYKFANAMFSALKHFNRDIKRVSIDRYYHVNADMTFGNLA
FT                   FDSAGYHEAIDELIAILKK"
FT   gene            complement(291151..293568)
FT                   /locus_tag="Mthe_0292"
FT   CDS_pept        complement(291151..293568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0292"
FT                   /product="acetyl-CoA decarbonylase/synthase alpha subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="KEGG: afu:AF2397 acetyl-CoA decarbonylase/synthase,
FT                   subunit alpha; TIGRFAM: CO dehydrogenase/acetyl-CoA
FT                   synthase complex, epsilon subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; Prismane"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14089"
FT                   /db_xref="GOA:A0B5W5"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR004460"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W5"
FT                   /protein_id="ABK14089.1"
FT                   /translation="MAKLEGSFTVEDMKNVQINIGAVVKEEEEWDQPMGPFPKPQIATL
FT                   RDWDFKILNRYRIFYAPADDTCTLCTFGPCDLTGNKRGACGIDMAGTCGKIVLVACLMG
FT                   TCAHTAHGRHLYHWTLDKFGDMKFDMGTDILVTAPLTETIIGIRPKSLKDFGKALEYCE
FT                   EQITQLLAATHTGQEGSYVDFESKALHAGMIDSLGKEICDMLQIVAYNMPRGDPNAPLV
FT                   EIGMGTLDQNKAVLIAYGHNLAAGAEAMFYTETNNLWDKVDIGGVCCTAIDLTRIGEGM
FT                   GEKKVPDMIGTKAKVAGAVGWWRKMVRAGIMDTVMVDEQCVWCDALKDCEERKIPLIAT
FT                   NDKILYGLKDRTNDPVDEIVDDLVNFRVPGVVILDPVKAGEVGVKTAIAVKPKRADIRN
FT                   RIVLTEDEFKKLVSSCTKCNECAFVCPPHIRISNLMEEAAKGNLEPFSSTYEVCVGCGR
FT                   CEQVCRQNIPILKMYEYANREYIRNQKFKMRAGRGPIRDTEIRAVGAPIVLGTIPGVIA
FT                   LVGCSNYPNGTKECYDIAKEFVDRGYIVVTTGCMAMDMSLYTDAEGKTIWEQYPGAFDG
FT                   RNICNVGSCVANAHIHGAAIKVATIFAHRNHRANYDDIADYILSKVGACGIAWGAYSQK
FT                   AASIATGVNRIGVPVVVQPHSVIYRRAFLGRADLPEDWMVIDARDGSKVRIEPAPEHML
FT                   YVAETKEEAMLMMAKLCFRPSDNSIGRMIKLTHYCDISMKYFGKLPDDWPVYVRHASEL
FT                   PLAWKDQMMKELEEKYGWKIDWKAKKIVEGPIRPADVSFDPTNIERKIRVRK"
FT   gene            293995..295322
FT                   /pseudo
FT                   /locus_tag="Mthe_0293"
FT                   /note="putative L-threonine-O-3-phosphate decarboxylase"
FT   gene            295319..296269
FT                   /locus_tag="Mthe_0295"
FT   CDS_pept        295319..296269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0295"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: mma:MM2059 cbiB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14090"
FT                   /db_xref="GOA:A0B5W6"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B5W6"
FT                   /protein_id="ABK14090.1"
FT                   /translation="MITEIFPFSVLILALLIDIVLGEPPAALHPVVIIGTAVDRLRRMM
FT                   PRRKISGMIISVLVISGAVLAGFALIRIAYATGSLAGSSEMGDILALIISSYLLKSTFA
FT                   FKSLIMTSREIGNLIDEDLDAAKHLLPALVSRNPLNLTHAQARSAVIESLSENYVDTIV
FT                   SPLFYYVLFSCAGLGVEAALAFKAVSTMDSMLGYKSDDLREIGYVPARLDDILNWIPAR
FT                   LSLPLIMIASPRKSMDILKACMRYHSVTPSPNSGWPMAAAAGALGTRMAKPGVYTILDE
FT                   GRDPESEDVSSAISLIGRAMVLAALLSALLLILLR"
FT   gene            complement(296330..297982)
FT                   /locus_tag="Mthe_0296"
FT   CDS_pept        complement(296330..297982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1643 cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14091"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W7"
FT                   /protein_id="ABK14091.1"
FT                   /translation="MISRRGVSSILPLWLAVLILIASADAATYTVCPSGCSKSSIQDAI
FT                   NNASPGDTIVVYSGTYNENVVVDKTLKLVGINNPTINAANPSGNAVSITGSGVVLTGFT
FT                   ITGASTGNGIDVSNTSPLIFYNNIEGNGVGLRNTLTSTILSRVCFWGEGGVGMDKGKPV
FT                   SPNNIVLGSVDYAPWLTARTINGKITKASPVVFDNPDAGIRVELSGIVYSGTIMGSAAY
FT                   MPGEEPYDASKLPAIPIRYLDVILTGNPGGEATITATYADADLAYVAENSLNLYVWDGS
FT                   NWIAATDTAVNAAENRVSGKFSASLLTGSPIALAGKDYSVTIEPASSPVPYATKPVLTT
FT                   LQVESIWDLLTAEYRIDGGDWNIISTGIYAKSWYYPGWSITDDEWASLGPGSHVITFRF
FT                   TRAGAPNITETWLFVKSMDTNLVRLITPNGGEVLKRQIPVTITWTMPSSASVSGVVLSY
FT                   STDGGKTYPHTIASIMGPATSFTWRPPNIATTQARVKVTVIYETGAEASDTSDGDFTIQ
FT                   KGYSFTAWRPDFGGYYTSFRAWLKPPYSFRAGW"
FT   sig_peptide     complement(297902..297982)
FT                   /locus_tag="Mthe_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.841 at
FT                   residue 27"
FT   gene            298565..299209
FT                   /locus_tag="Mthe_0297"
FT   CDS_pept        298565..299209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14092"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W8"
FT                   /protein_id="ABK14092.1"
FT                   /translation="METMGDLIRGLREISRAEPAAEDVERILGWRPEFIRFFTPSEDES
FT                   IMVMVFERGVVLEVRYFLNDNLRALGDDLEIRLMLKIDITSRVGYSVFYSKYIHGQGYI
FT                   RVSLRDVENKMVQKILEDYYLPRLKSIYKPVIMEFRGFSDRDFFGVEAGREHGYIYYSP
FT                   VRPKSGENEVRILDVIARLYHLESILKNRDVPHQLAELELQMSLLPSVMWM"
FT   gene            complement(299429..300220)
FT                   /locus_tag="Mthe_0298"
FT   CDS_pept        complement(299429..300220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14093"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5W9"
FT                   /protein_id="ABK14093.1"
FT                   /translation="MGDSRAQTNRQYGEHLSRHQNLSAETEMCEDLVSLIRAELLQNAD
FT                   AQTQESAQRFFREPVRLYGVRTPVVREIARRHFRSIRHLEKTEIFELCEALLKTDYNED
FT                   AIVAFDWSYALRRSYAPRDFQVFERWVASYINNWVKCDTFCSRSLGTFVEMYPAYIQNL
FT                   KGWATSENRWVRRAAAVTMVPSARRGRFLGEMLEIVDLLLGDPEDIVQKGCGWLLKEAS
FT                   RCHQQEVFSYIMSRKGEMARIVLRYAIEKMPHDMRRMAMER"
FT   gene            complement(300226..301458)
FT                   /locus_tag="Mthe_0299"
FT   CDS_pept        complement(300226..301458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0299"
FT                   /product="LOR/SDH bifunctional enzyme conserved domain
FT                   protein"
FT                   /note="PFAM: LOR/SDH bifunctional enzyme conserved domain
FT                   protein; KEGG: afu:AF1278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14094"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X0"
FT                   /protein_id="ABK14094.1"
FT                   /translation="MSEICDIEMEGHLIDSLILTKALDKIMDMGGEFEIKEFTVGKRKD
FT                   EPSHVRLTLIGKDPAHLNQILDELNALGARLVDSEDVRLEPAPSDMVVPRGFYSTTNHP
FT                   TYIRLRGTWIPVDGSRMDCLIVVSGSSARCTPIHHIKKGDMVVVGTTGVKVVPPERPRE
FT                   KSFFGFMRNEVSSERPSVEIVRQIAEEIVATKGKGGRIAAICGPAVVHTGAAPALAQLI
FT                   RDGYIDVLLSGNALAVHDIERQLFGTSLGMDMKGNVTSGGHRNHLYAISEIIASGSIEN
FT                   AINEGKIRGGIMYECIKKGIPFVLAGSIRDDGPLPEVITDTVKAKDAMAEALKGVDMAL
FT                   MMATMLHSIATGNLLPSYVKTLCVDINPATVTKLMDRGTAQAIGLVTDVGTFLPMLAEE
FT                   IRKAGSGSRIQ"
FT   gene            complement(301485..302606)
FT                   /locus_tag="Mthe_0300"
FT   CDS_pept        complement(301485..302606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0300"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: mma:MM1307
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14095"
FT                   /db_xref="GOA:A0B5X1"
FT                   /db_xref="InterPro:IPR001072"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="InterPro:IPR041596"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X1"
FT                   /protein_id="ABK14095.1"
FT                   /translation="MNLSRAARSLGLPVERLESLMEGILKLSRWPEPRLLRFDKGTSGV
FT                   EPGTVIFENGDVVHGYPKIRRAMMLGPAIRRNFIDRVAVEEKMNGYNIRAVSVDGDVYA
FT                   LTRGGYICPFSTEIVRERISPDLFEDHPDIVLCGEMVGPENPYVPKDVYPVESIDFYLF
FT                   DISKKNCRSMMGVHATHALAEEYSIKVVPFFGEFPVERAAEEIFRIIKRLGRSGREGVV
FT                   IKDPENRTSPLKYTASESNCSDLEFAFRYYNDYAQDFFFSRVVREGFQSVEWNEDEAAL
FT                   RERALRLGESILVPLTDTIRRRMQGEQIMQQVQIRVRSIQTARDFEQHLRRMGTKAIFD
FT                   IPEQDGDRYVVRILKQVMSTNDKTLAVIEGQPW"
FT   gene            complement(302693..303481)
FT                   /locus_tag="Mthe_0301"
FT   CDS_pept        complement(302693..303481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0301"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mbu:Mbur_1759 CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14096"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X2"
FT                   /protein_id="ABK14096.1"
FT                   /translation="MQVKDIMTPPITIDKSERLGHALDLMEKHGTRRLLVTNNGKLGGI
FT                   ITMRQIARVLGTRRRLGMPASSLHVAAATLDAVIPVHPEMGVEEAILLLQKTSVLVVTQ
FT                   NDEILGWVRPREILANVKLTGVSKDAMRSALTVSPRDRLIHARRMMMDRDIGRLPVLDG
FT                   GKLVGILTERDIARALRAFRDLVSWRQQETRIKNLLVSDVMTHDVKYVYVDTPLEEVRR
FT                   IILEENRGGLPVLNSDGTLAGMITRRCLIDYLVRTKALAA"
FT   gene            complement(303485..304333)
FT                   /locus_tag="Mthe_0302"
FT   CDS_pept        complement(303485..304333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0302"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mac:MA4650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14097"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X3"
FT                   /protein_id="ABK14097.1"
FT                   /translation="MRVKDYMATPVWVVERNEPIQRARNLMFKHDISRLPVMDKGKLVG
FT                   IVTKYDISNRLAQAAPEWRRRPIDRIPVQLVMTENPITIYPDATLTQAAELMMENEIDG
FT                   LPVEKDGELVGIITSRDLLKYFAQQNLDSKVGDLMAEGMVSVHRHHTIAHVVEQMNLHG
FT                   VSRVLVYEDNMRPVGVITRSNLTFAGIFDSFDQPKMKSIKMTRKESTAGRKQYRYIKQV
FT                   PLVAEDIMSSPIIAARVDDKAVDDAKVLVEKSICGMPVIENDSMVGFFSTREIVAEIGR
FT                   W"
FT   gene            complement(304330..305292)
FT                   /locus_tag="Mthe_0303"
FT   CDS_pept        complement(304330..305292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0303"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mma:MM1303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14098"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X4"
FT                   /protein_id="ABK14098.1"
FT                   /translation="MKRVDHRIGDQRVEGIPVPPGSMDRGPVEFDSRVARRQGDILSIA
FT                   STEVVTAPPTTTIIGAIKIMNSYGFRRLPIADAGTNRLLGFVTCVDIVDFLGGGIRHNL
FT                   VRKKYEGNILAAINAEIREIMSTKLISAPDTASVDEALRIMYERNVGGLPIVDERSRIK
FT                   AIVTEEDFVEVVRNTDIDTTVSDYMSPNVVTAPASMSIEKTSRMIVQKGFRRLPIIQDG
FT                   ILTGIITASDIMKYMASGEAFSKIITGDIREVMEQPIKSLIKRSLIMTDPRTRLKDAAN
FT                   LMVEKDVGSLPVMEGGSMVGIITERDFLRALAEHRGVAR"
FT   gene            complement(305293..306078)
FT                   /locus_tag="Mthe_0304"
FT   CDS_pept        complement(305293..306078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0304"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mma:MM1302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14099"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X5"
FT                   /protein_id="ABK14099.1"
FT                   /translation="MIVADIMSRDPLYVEKTDFATRARQLIRDNHVRGLPVIDPEGRVI
FT                   GIVTNQDMLRITSTRSNVTVAGFTVSVPLITEEMDMMDAARLMFQEKVTLLPVVDSPSS
FT                   RMLRGVVSLLDIFKHLDLSRVPDKPVDAIMSRDVITARPDDPISKVWDRMLEEDITGLP
FT                   VVNESGRPIGIITRFDILKRGWARLGKEDMYRSKDTAKIRVEKLMSTPLYSIKRDAPLR
FT                   QAVEVMLKHDIGRISVVENDVLVGIVDRYDLIKAVLGDV"
FT   gene            complement(306127..306684)
FT                   /locus_tag="Mthe_0305"
FT   CDS_pept        complement(306127..306684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0305"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   afu:AF0847 IMP dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14100"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X6"
FT                   /protein_id="ABK14100.1"
FT                   /translation="METTMRVREIMSRPVLTVDADTDVLDAANRMISANVGSLIVVQGA
FT                   KPIGIITERDLVKKVVARAEDPRKSRVGDVMNSPLIKIHPDASLRDAAELMLKSGVKRL
FT                   PVISDDGKLVGIITDTDLVSGASLGLNDILADLIEMHRESVHFQEPSEMVRGICERCGQ
FT                   LSDSLVSVDGEMLCWSCRDISR"
FT   gene            complement(306885..307373)
FT                   /locus_tag="Mthe_0306"
FT   CDS_pept        complement(306885..307373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0306"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: mac:MA0187 molybdenum
FT                   cofactor biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14101"
FT                   /db_xref="GOA:A0B5X7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X7"
FT                   /protein_id="ABK14101.1"
FT                   /translation="MIIDSITVSTSRFMQYGAVSGPDDAEDVSGKAIVEKITASGHDFR
FT                   YRLIPDGVMPVRIALLESIERKSDAVIFCGGTGLSPSDLTIEAIEPLVEKSIPGFGEIF
FT                   RLKSMEQVGTRVMLTRASAGIISGVPVFAIPGSPAAASLGIELILQELEHILQHVRGR"
FT   gene            307701..307946
FT                   /locus_tag="Mthe_0307"
FT   CDS_pept        307701..307946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14102"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X8"
FT                   /protein_id="ABK14102.1"
FT                   /translation="MISQIEQAIEGFEKMSADKRSAMRGILQRYVEGDMGLDEAYYELL
FT                   DTGLIPMPSRCAMKPKVASEGDEARLKDMIKARILQ"
FT   gene            complement(308070..308366)
FT                   /locus_tag="Mthe_0308"
FT   CDS_pept        complement(308070..308366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0308"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   tac:Ta0847m hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14103"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5X9"
FT                   /protein_id="ABK14103.1"
FT                   /translation="MIVAEFSVIPMGAGTSAGRYIRAVHEMLRNSGIRFVPGAMSTTIE
FT                   AESIEQVCMIVERANKILTDMEVQRVITTVTIDYRLDKVISIDTKLKALEGGA"
FT   gene            complement(308431..308504)
FT                   /locus_tag="Mthe_R0007"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(308431..308504)
FT                   /locus_tag="Mthe_R0007"
FT                   /product="tRNA-Val"
FT   gene            complement(308539..310071)
FT                   /locus_tag="Mthe_0309"
FT   CDS_pept        complement(308539..310071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0309"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: mhu:Mhun_0882
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14104"
FT                   /db_xref="GOA:A0B5Y0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y0"
FT                   /protein_id="ABK14104.1"
FT                   /translation="MDFNMAIILGLYLVGLLAIGAWASKKVKSSEDFIVAGRNLGFWLL
FT                   TLMIVASICSGMTILGTSGLGYIGGWPTIWEQIFVPLSAAFVILVYGTKLHAISERMGY
FT                   ITIQDYLAQRFYSQRGLRGLSAVAGILVSLIYLVGQYVAISMVLSWMLKISYTDALLIG
FT                   AIIVMIYTILGGLYAIAWISLVQGLMILIGVLIVSPFIIQSAGGLTHVNNVLAGIDPNY
FT                   VKIWYPQMHPPYAKYAFLTPMYLVSFFFLLTFGLASAPHVINNVLSARSRSFFKWSPLA
FT                   AFVLYLIVMYLIKISGFASRVMVEEGMIALPTNVSNAQDYAFVVAAMHIFPHTAGPLVA
FT                   VIVLSAVMSTTDRLMLTIGSYVGWDIYKMFFNKKASDRSITLVSRLAIVFSVILTLILA
FT                   WRKPPELLAFLIWMGIGIMLATFVVPILSGLYWRRATREGAIASMSLGLIGALVAGWYH
FT                   WFVSPLPVHFSFYGFLLSIAAMVVVSLLTRSPPADVLDETMTGMYIRTKSKR"
FT   sig_peptide     complement(310000..310071)
FT                   /locus_tag="Mthe_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.607 at
FT                   residue 24"
FT   gene            complement(310681..311295)
FT                   /locus_tag="Mthe_0310"
FT   CDS_pept        complement(310681..311295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0310"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   mac:MA0264 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14105"
FT                   /db_xref="GOA:A0B5Y1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y1"
FT                   /protein_id="ABK14105.1"
FT                   /translation="MTLDDLRGVSRSVTEPMAEIVERLGLTPNMLSVLSLCFSFLAFVF
FT                   YYISASDQRMLLGAAIMVMLNGLADAVDGALARRMGHADQRGDFLDHVIDRYSDVLLLS
FT                   GIIFAGYIGWEIGYLAVVGVLVTSYIGTQAQAVNLRRCYGGMLGRADRLVFLIIATLAN
FT                   ALYPHRIEGLQILGWMVLITMILSHITAVQRFVYIWTRLGR"
FT   gene            complement(311282..311803)
FT                   /locus_tag="Mthe_0311"
FT   CDS_pept        complement(311282..311803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14106"
FT                   /db_xref="GOA:A0B5Y2"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y2"
FT                   /protein_id="ABK14106.1"
FT                   /translation="MRIALTGTPGTGKTTVSGLLPFRVVNLNDLIRDGMSAGFDPEREC
FT                   LEADMDALEEKIEEIERSCGDDVLIIEGHFAHHFADEAIVLRLHPNVLRRRLEARGYSA
FT                   SKIRENVEAEAIDLILVEALELCSRVHEIDTTDLSPEEVASIITAILKREIEMPPGGID
FT                   WLGDPEIDLG"
FT   gene            complement(311794..312852)
FT                   /locus_tag="Mthe_0312"
FT   CDS_pept        complement(311794..312852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0312"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase, class I and II; KEGG: mma:MM1405
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14107"
FT                   /db_xref="GOA:A0B5Y3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y3"
FT                   /protein_id="ABK14107.1"
FT                   /translation="MERDYRLRPVLSRLRPYVAGRGIEEISRTYGIPPERIVKLGSNEN
FT                   PYGPSPAVRRAIAEAPLNLYPETVDLIESIARYTNFPEGQVLIGSGMDGVIDTLSRLFL
FT                   DHGVRALIPTPTFSYYEIVTILCGADPVFVRRTEPGEMIERLRDKSIGMVFICSPNNPT
FT                   GEVVDEELLRSIIESTDAVVFLDEAYVEFAERSMVDLVNEYENLVVGRTMSKAFGLAGV
FT                   RLGYALAPEWIAEAYRMAAPPFFGVTTPAVAAGIAALSDLEHMRRSVEMIKRERELLLS
FT                   EIVEASPSWGNFLYIETSERSDVITERMLRKGIIVRDCRSFRDAGDHHIRVTVGTPEQN
FT                   ARFLEAYREICG"
FT   gene            complement(312836..313978)
FT                   /locus_tag="Mthe_0313"
FT   CDS_pept        complement(312836..313978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0313"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferases; PFAM: aminotransferase, class I and II;
FT                   aminotransferase class-III; KEGG: mbu:Mbur_2204
FT                   acetylornithine and succinylornithine aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14108"
FT                   /db_xref="GOA:A0B5Y4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y4"
FT                   /protein_id="ABK14108.1"
FT                   /translation="MSIDDIIKRESRAIFQTYTRQPVLIARGSGARVWDQDGREYIDFV
FT                   AGIAVNNVGHCHPRVVEAIKRQCELLIHTSNLYYTENQVRLAEELKSLSGMDKVFFCNS
FT                   GTESVEAALKLTRRATGRIEIVAATGSFHGRTLGALGLTYKQSYREPFRPLNEATFVPY
FT                   NDLEALKSAVTKETAAVILEPVQGEAGVYPASNEYLRAAREICDDRGALLIFDEVQTGF
FT                   GRTGRWFAKEHSGVMPDIMTLAKAIAGGLPMGAMLSNENISGCFQRGDHASTFGGGPLV
FT                   CAAALASISAIRDENLVRRSEEMGSYLLRELSRLPVSARGLGLMVGVDIDKDARAVVDA
FT                   ARADGVLLNSTGEHTLRLVPPLVVTKEEIDRVVDVIGERL"
FT   gene            complement(313975..314619)
FT                   /locus_tag="Mthe_0314"
FT   CDS_pept        complement(313975..314619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0314"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   afu:AF0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14109"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y5"
FT                   /protein_id="ABK14109.1"
FT                   /translation="MVEVHKVSGAAYDGNAYLVMAERPVLIDAGMFAEPTIRNIRRFID
FT                   PEELEMIILTHCHHDHSAAAPAIKERTGAKIMLSKEEIGLVGDDLATVAYLFGDTAPEF
FT                   EVDMPLEDGMVLDLGDLRLEVIHTPGHSPGSMCFYERREGMLFSGDTVFPDGNIGRTDL
FT                   FGGSTEDLVRSIERLLELDDVSCMYPGHMGITCNNVMAQIRDSLRFARRFL"
FT   gene            314665..315945
FT                   /locus_tag="Mthe_0315"
FT   CDS_pept        314665..315945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0315"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   mbu:Mbur_0703 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14110"
FT                   /db_xref="GOA:A0B5Y6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y6"
FT                   /protein_id="ABK14110.1"
FT                   /translation="MTLMEDAKNGRIPDALRSAAEIEGVDPEALRRLLAAGRVVVPMNA
FT                   RRMRERAVGIGELLCTKVNVNVGTSPSLSNIEEEVEKALAAVNAGADTIMDLSTGGDLD
FT                   EIRRSILKKVDVPVGTVPIYQAAVEENLTSQGMFNALEKHAKDGVDFVTVHVGVNKESM
FT                   RRLCRDPRLMGVVSRGGSLTMKYITETGEENPYYEEFDYLLEIAKEHDLTLSLGDGLRP
FT                   GCIEDASDRAKYMEFILLGEMVARAREAGVQAMVEGPGHVPADEIETSVRAMKHLTDGA
FT                   PLYLLGPIVTDVAPGYDHITAAMGGLIAGMAGADFLCATTPSEHLDLPTLEDIIEGTVV
FT                   TKIAAHAADLTKPGVRERARAWDRRMADARANLDWEAQFREAIDPTKARRIRHRRGIDV
FT                   ETCTMCSELCAIRIAREALKHERSDES"
FT   gene            315923..316945
FT                   /locus_tag="Mthe_0316"
FT   CDS_pept        315923..316945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14111"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y7"
FT                   /protein_id="ABK14111.1"
FT                   /translation="MSAQTNLERAADSLIKYLTVRPEELMRQTGIKEKDFAPIEPQPFE
FT                   GRIFAVDGSNVKVCDLSVVKANHIRAGYVVYRGRRWERTAVTYDDLFVADRRDYMEWFR
FT                   EPLERLEMGEIDLSGLRGSELDRISTYFRELQEYVALDAALSESEEGDLILYDGGFAIW
FT                   KDRPFGRVVDEIIKRAAKRGVDLLGVSKSTTISWGEISMPLVYHVSRLGKNLLPGMAWC
FT                   VDLGGKNVHPDLQEGRWEGSIYMVLFHPEADRAFRVDVPSYMNGRVTSALSKAAAFSGS
FT                   SESPGYPHALFRAHHDLKLSSHDGNMSWFRMIDTMAKRHSVSMKDLRSAMDYHEILDIF
FT                   "
FT   gene            complement(317030..318238)
FT                   /locus_tag="Mthe_0317"
FT   CDS_pept        complement(317030..318238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0317"
FT                   /product="TraB family protein"
FT                   /note="TIGRFAM: TraB family protein; PFAM: TraB determinant
FT                   protein; KEGG: mbu:Mbur_1730 TraB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14112"
FT                   /db_xref="GOA:A0B5Y8"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y8"
FT                   /protein_id="ABK14112.1"
FT                   /translation="MADITEGSSTDARNEILVIGTAHVSEKSVAEVREAIEQTRPDIVA
FT                   VELCQRRYLALTGQDRDEDIKVSELLSGGRIYLVLVQWLLAYIQRQIGSEMGVRPGAEM
FT                   LAAIEAARVVNARVALVDRDISITIQRFWSAMSIWEKLKMLWSLVVAALGFGKEDLDID
FT                   SVTDSDVVSQLMAEFRKIAPSAARALVDERDAYIARNLYDLSRYGKVLAVVGAGHREGI
FT                   MRYLSDPSRIPDTQIFDAPPEKRFSLGKAFGIIVTLLIILTFVYILVAGYSSGVVLLAF
FT                   GIWFLVTGGLAALGVVAARGHPLSVLTAFMIAWMTTLNPLVAAGWFAGMVEAWKRKPTM
FT                   GDVKRLASAESMDEMMENRFFRVVLVAALANLGATLGTFLGIYIIWQRMGLIDPHAIIS
FT                   HII"
FT   gene            complement(318239..319351)
FT                   /locus_tag="Mthe_0318"
FT   CDS_pept        complement(318239..319351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0318"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; peptidase M50;
FT                   KEGG: mba:Mbar_A0978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14113"
FT                   /db_xref="GOA:A0B5Y9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Y9"
FT                   /protein_id="ABK14113.1"
FT                   /translation="MENSIQLGRVMGIPIRLHVTFLLIIPWVAYLFGSVSATVFGKLYG
FT                   FGAVEPPLVRWIYSLLFAVLLFICVGLHELGHSYVAKRYGIEIRSITLYFFGGVASMEE
FT                   IPRNPSMELRMAIAGPAVSAALGVMSILLYTQSESILGEGHPFSILLWTLGIMNIILMI
FT                   FNLIPAFPMDGGRVLRAWFSTRMPYVVATKNAAALGKIFAVFLIFLGLFTLNFLTLIIG
FT                   IFLYIAASEEDRSTTIEDSLRGIKVRHIMSKDVRVVPPEMTLAELMRLMFYEKHRGYPV
FT                   MVNDELVGIVTITDLQRVPEHLRETTRVGDVMTRNIYVIGPDDEATAAIKIMGDKKIRR
FT                   LPVIEDGRLVGIISREDLLRAIELCSDVRL"
FT   gene            complement(319648..320295)
FT                   /locus_tag="Mthe_0319"
FT   CDS_pept        complement(319648..320295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0319"
FT                   /product="HhH-GPD family protein"
FT                   /note="SMART: HhH-GPD family protein; KEGG: fnu:FN0622
FT                   8-oxoguanine DNA glycosylase / DNA-(apurinic or
FT                   apyrimidinic site) lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14114"
FT                   /db_xref="GOA:A0B5Z0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012092"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z0"
FT                   /protein_id="ABK14114.1"
FT                   /translation="MSTHEIEQLKELHRKLEDVVEARLREFDQLWLDADEERLFEELVF
FT                   CLLTPQSRARSCWAAVEKLSSMGELRCPVPARIQMELKGVRFSRRKAEYICMARDLFML
FT                   DGMLSVRARIDPENLFQTREWLVGNVKGMGYKEASHFLRNIGLGRDLAILDRHILKSLV
FT                   RYGVVPDYPRSLSRSRYLKIESEMSDFARSIDIPMAHLDMVLWYMGAGEVFK"
FT   gene            complement(320362..321528)
FT                   /locus_tag="Mthe_0320"
FT   CDS_pept        complement(320362..321528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0320"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   tte:TTE1000 uncharacterized flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14115"
FT                   /db_xref="GOA:A0B5Z1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z1"
FT                   /protein_id="ABK14115.1"
FT                   /translation="MIREICKNVFHVGAIDWDRRLFDALIPLPDGTSYNSYLIKGSEKT
FT                   ALIDAVDPGKKDVLIDNLDSLRIDRIDYIISQHAEQDHSGAIKFLLERYDSTVLGSQKC
FT                   IELLLDFGIVSKDRTRAVSDNELLSLGDMTLEFISAPWVHWPDTIFTYLRERRMLFTCD
FT                   FLGAHLATSDLFAWNPESAKRYYAEIMMPFRANARRHLERIRALGPEIIAPSHGPLHKR
FT                   PEVVLNAYSEWTSDDVKNLVVVPFVSMHGSTEKMVSHLVDALIDRGVSVERFDLTKTDT
FT                   GALAASLVDAATVVFGTPAFITRPHPLIAYAAILANALRPKARFASIIGSYGWGARIVE
FT                   EMRSLMPNLKMEIIEPVIVKGYPKEDDLRAIERLADEILRRHRELGLL"
FT   gene            complement(321525..321755)
FT                   /locus_tag="Mthe_0321"
FT   CDS_pept        complement(321525..321755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14116"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z2"
FT                   /protein_id="ABK14116.1"
FT                   /translation="MGIQNIQFAFAKPGRGIMPASIWRAPGAEHEAVNGHNVIDLAHAN
FT                   GACMFSFFIHSMANVKSDAYTLHIYKRLGWI"
FT   gene            321801..323747
FT                   /locus_tag="Mthe_0322"
FT   CDS_pept        321801..323747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0322"
FT                   /product="periplasmic copper-binding protein"
FT                   /note="PFAM: periplasmic copper-binding; KEGG:
FT                   mbu:Mbur_1643 cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14117"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z3"
FT                   /protein_id="ABK14117.1"
FT                   /translation="MHMRYALCLLMLIQISLADAGTIVVTPGGSIQAAIDSASSGDAIE
FT                   IQGGIYSERIVVDKSLIIRGNTTSGYPVVNAGGSGTAVTISGDDIQITGIRAIGSGMAP
FT                   RDAGIFVTGRNNRVMDCQVSGNRYGIVLSFAEGCTLENILAEASSEAGMLLDNSTKNSI
FT                   IGCKLENNIHGIRLVSSESNTIRGNIISNTTFEALSLERSSNRNLIEDNIIRFNQIGIS
FT                   LETSRGNNITRNLASNNSVGIKIANHNDTESISPIENPGKYGGVSIKYKPNSDIKSYDV
FT                   RDKDLSSYTTNTIYNNTLINNEENAIDDGNNQWDNGTLGNHYSDFDEPEEGCRDRNRDG
FT                   ICDSAHEIEGGMSTDRHPLSPKDPMKARFMSKKNGAYLGLDRMVFMPGERIDMRLSVPE
FT                   NITAWIGVLPAGEPHGALDRTKAISYTTVNSSIREVALEAPRMVGSYEIRMYSTEEMVY
FT                   LPISVEVPEIHISPAEVKACEPINVTYSGAPGYEGDWIGMFSTGAGDRSPLSRKYLDGS
FT                   TNGSLVLYTPSTPGTYNVRMFADDGYRLLAVSEPVTVKQNAGVRIVAEPETVSPGQAIY
FT                   VHFWGAMPDSVIGMYGVTRPDKFWISMQPTGGPSCGTLTFRAPYGGGNYDFRLFENNVY
FT                   RKHMGASNVVRVV"
FT   sig_peptide     321801..321902
FT                   /locus_tag="Mthe_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.887) with cleavage site probability 0.701 at
FT                   residue 34"
FT   gene            complement(324043..325461)
FT                   /locus_tag="Mthe_0323"
FT   CDS_pept        complement(324043..325461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0323"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mma:MM3272 putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14118"
FT                   /db_xref="GOA:A0B5Z4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z4"
FT                   /protein_id="ABK14118.1"
FT                   /translation="MCDPHENSDAERIQSCALVVSVIGSFLTAFMSSSINIALPAIGSE
FT                   LSMDAVMLSWISTAFLLAAAVFLVPFGRLADIYGRKRIFGYGIALFTLASILAPVSRSA
FT                   SMIIAARFVQGVGAAMIFGTAVAILTSVFPLRKRGRVIGINAASVYLGLSLGPVLGGIL
FT                   TQYLGWRSLFVATVPIGALALALLMNLRGEWADARGERFDLSGSLVYGISIMALVYGMS
FT                   LLPSSAGRFVTVAGLAGLVLFLYLETKAENPVIEVDLFKSNRVFALSNLAALINYSATF
FT                   ATGFLLSLYLQYIKALDPRSAGLVLLAQPLMMTILSPLTGRLSDRMEPRLVASAGMAIT
FT                   LLSIVPFVFLDERTPVWFIGAVLLLLGFGLALFTPPNTNAIMSSVERKYYGIASATLGT
FT                   MRLLGQMLSMSLAMVIFAIYIGRVEITPDTYSSLIESSRIAFAIFSVLCFIGIFASLAR
FT                   GELRGGSAATELEK"
FT   gene            complement(325854..326083)
FT                   /pseudo
FT                   /locus_tag="Mthe_0324"
FT   gene            326083..327411
FT                   /locus_tag="Mthe_0325"
FT   CDS_pept        326083..327411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0325"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; KEGG:
FT                   jan:Jann_0783 acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14119"
FT                   /db_xref="GOA:A0B5Z5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z5"
FT                   /protein_id="ABK14119.1"
FT                   /translation="MQKRGRSRFPATALIRAHPHSPRVKTLNSVGIATYMSAADEMFDP
FT                   EYMLDLLRDLIAFRTVAPPGSFYHEIVDYLVPVLNDMGFATKKLVMPAEVFESKCTDPR
FT                   LSGDRVNLIADMDLRRPEWLVIYTHLDVVPPGDGWSTDPFSLTIRDGRAYGRGVSDSKG
FT                   AVAAMIAALRGILRERKPKYNLRLLLTTDEEVGGYSGLCYLADSGMVKGDKMLCMDGFS
FT                   DDVVIGSNGIITWEVTVNGRAAHSGSSFLGDNAIEKSLPVIDAILRHKREVEKKSSSLP
FT                   ASSVLRDKGIAHMMPILNINVIHGGIKENIVPDRCVFRGDRRVIPEERMEDAMSELEEI
FT                   VKRFGSDIDIRMWPGYPPMRMDPEHPWVLEVKEAVRRATGTEPHLSGTQGSLDQAYATE
FT                   ITKIPAAVYGVGRQLESNAHGIDENVSVEDLVSYMRFVGELLL"
FT   gene            327486..327890
FT                   /locus_tag="Mthe_0326"
FT   CDS_pept        327486..327890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0326"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: mac:MA1978
FT                   molybdopterin-guanine dinucleotide biosynthesis protein
FT                   B/molybdopterin converting factor, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14120"
FT                   /db_xref="GOA:A0B5Z6"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z6"
FT                   /protein_id="ABK14120.1"
FT                   /translation="MKVVAVVGHHKSGKTTLIEALVKSLKRHGRVGTVKHMPGHHVDQG
FT                   DTHRHLMAGADVVIGLGLGQIVVTPKGSLESALEEMRSRGIDFVILEGFKSSQYPKIVI
FT                   GGIDVQNKICDVHDVNDAAVEHLVEMILSL"
FT   gene            complement(328498..329070)
FT                   /locus_tag="Mthe_0327"
FT   CDS_pept        complement(328498..329070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0327"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   gsu:GSU0857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14121"
FT                   /db_xref="GOA:A0B5Z7"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z7"
FT                   /protein_id="ABK14121.1"
FT                   /translation="MSNRTWMFVDLFIPFITIAIAELGDKTQLSVLLLSTRTKEHFKLL
FT                   IGVMSAFLIVDGFAILLGAWITEVVPASILKIISGGIFLLFGIITLRDLDGDEGDGRKF
FT                   DESPFLSGFLVIFLAEWGDKTQIASAVFATQYNPWLVLGGTMLALFILSISAIYLGRFI
FT                   LGYINRRTITLAAGLIFMAMGIVLLLL"
FT   gene            complement(329458..330354)
FT                   /locus_tag="Mthe_0328"
FT   CDS_pept        complement(329458..330354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0328"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: gsu:GSU0487
FT                   cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14122"
FT                   /db_xref="GOA:A0B5Z8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z8"
FT                   /protein_id="ABK14122.1"
FT                   /translation="MIAHEVRVIERRFSLAMILTISILIAELLGSWWTGSLALLSDAAH
FT                   VFLDLFALGLSWFAIRISALPASERYSYGFHRFEVIAALANGLTLGFVALVILIEAYRR
FT                   LLQPEPVKGLDLLLIATFGLIVNLIVAFVLSRDGHMDDLNLRSAILHVLGDAAASLGVI
FT                   AAALVIWRTGWYPADPIISLLISVMIFAGSYRLIKDSFRLIMEGVPECIRTDEVVDQIS
FT                   TASGVIQVHDLHIWGVCSSNILLSAHVVVSPESDHQRTLSEIRDKLSSIFGIEHATIQL
FT                   ENEYCGQGRVVFQKRVD"
FT   gene            complement(330451..330801)
FT                   /locus_tag="Mthe_0329"
FT   CDS_pept        complement(330451..330801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14123"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5Z9"
FT                   /protein_id="ABK14123.1"
FT                   /translation="MGIGRPWLISEHAPWLYGCITMPARGFSYMFYDPFGGLAAEYRDR
FT                   RYSSLERIPLREGVVLGYVTVDSGVLSLLDADTQNPIGVIKIHAKRGAYPVIAIVDSDG
FT                   CLSGVYIDLRYS"
FT   gene            331132..332007
FT                   /locus_tag="Mthe_0330"
FT   CDS_pept        331132..332007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM0716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14124"
FT                   /db_xref="UniProtKB/TrEMBL:A0B600"
FT                   /protein_id="ABK14124.1"
FT                   /translation="MNQKEFAKAFAIFVGAVMVLSAFAGFVLRSGDVETPSSPESVETA
FT                   PLSAFGVRGNLVDMSFSSMQDLLEMCPENTTFAYWIDLEASQNITDAAASVIPEIYPPA
FT                   AGLMYRDKMYPTEIRRGASVFFNGTWAEFHWIMPFTYNYQGLVIPYNDFMIVPATGDLG
FT                   RVFGRPTLFGPEGALKQILDVILGGFPTDRLTLAYDEIADLQIAGVGGIENAPLGGEYE
FT                   EFYAGITQRENDVYVRCRFLSPAGNTLTRIQAFASKYNMSISRDGSILRLDGTIAPEEI
FT                   RGVIADLLAP"
FT   sig_peptide     331132..331239
FT                   /locus_tag="Mthe_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.299 at
FT                   residue 36"
FT   gene            332114..332482
FT                   /locus_tag="Mthe_0331"
FT   CDS_pept        332114..332482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0331"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   tko:TK1311 LSU ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14125"
FT                   /db_xref="GOA:A0B601"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR022481"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B601"
FT                   /protein_id="ABK14125.1"
FT                   /translation="MARPIYVRFDVPPELASKSLEALELARDTGRIKKGTNEATKAVER
FT                   GVAKLVIIGEDVEPPEIVAHLPPLCEEKNTPYVYVKKQSDVGAAAGLSVKSAAAAIIEP
FT                   GKGKELLEEIIQKLQALK"
FT   gene            332493..332705
FT                   /locus_tag="Mthe_0332"
FT   CDS_pept        332493..332705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0332"
FT                   /product="SSU ribosomal protein S28E"
FT                   /note="PFAM: Ribosomal protein S28e; KEGG: mba:Mbar_A3387
FT                   SSU ribosomal protein S28E"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14126"
FT                   /db_xref="GOA:A0B602"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR028626"
FT                   /db_xref="UniProtKB/TrEMBL:A0B602"
FT                   /protein_id="ABK14126.1"
FT                   /translation="MVEENGVPAEVIEVIGVTGMHGEATQIKCRILEGSNKGRIITRNC
FT                   MGPVRVGDVLMLLETAREAKKLTGR"
FT   gene            332710..332880
FT                   /locus_tag="Mthe_0333"
FT   CDS_pept        332710..332880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0333"
FT                   /product="LSU ribosomal protein L24E"
FT                   /note="PFAM: Ribosomal protein L24E; SMART: TRASH domain
FT                   protein; KEGG: mth:MTH257 50S ribosomal protein L24e"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14127"
FT                   /db_xref="GOA:A0B603"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023438"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B603"
FT                   /protein_id="ABK14127.1"
FT                   /translation="MEERRCSFCNTRITPGTGKLYAKKDGTVYYFCSSKCEKNMRLGRV
FT                   SRKIKWARKGA"
FT   gene            332902..333333
FT                   /locus_tag="Mthe_0334"
FT   CDS_pept        332902..333333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0334"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   mba:Mbar_A3385 nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14128"
FT                   /db_xref="GOA:A0B604"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A0B604"
FT                   /protein_id="ABK14128.1"
FT                   /translation="MIKPDGVQRGLVGRIIQRIEEKGFKIVAMRLSVMDKERAEKHYAE
FT                   HAGKPFYGDLVEFITSGPSVQMVVEGKGVISAIRKMNGATNPAEAAPGTIRGDFGIETG
FT                   RNVIHGSDSPESAAREIALHFSDSEIFEYKRIDEPWLYE"
FT   gene            333533..334186
FT                   /locus_tag="Mthe_0335"
FT   CDS_pept        333533..334186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0335"
FT                   /product="protein of unknown function DUF99"
FT                   /note="PFAM: protein of unknown function DUF99; KEGG:
FT                   mhu:Mhun_1565 protein of unknown function DUF99"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14129"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:A0B605"
FT                   /protein_id="ABK14129.1"
FT                   /translation="MGQHLRSKLENRSDENPSVRGGNKQAIRVSKPGIRALGIAESFVR
FT                   SDSLSTLAGLVMRGDMRIDGVALAEITVGGMDATDGVLSIYRKLGREDINILMLSGNVI
FT                   SWFNIIDPERIHRETGLPVISVTYEESDGLERYIEEYFPGDVERLMKYRALGERSAIRL
FT                   KTGYDLFVRAHGISLKETRAVLNRFTIEGRIPEPVRVARLVARAAMRIGRESGE"
FT   gene            complement(334193..334431)
FT                   /locus_tag="Mthe_R0008"
FT   ncRNA           complement(334193..334431)
FT                   /locus_tag="Mthe_R0008"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 22.51"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(334685..335746)
FT                   /locus_tag="Mthe_0336"
FT   CDS_pept        complement(334685..335746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0336"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   mbu:Mbur_1075 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14130"
FT                   /db_xref="GOA:A0B606"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0B606"
FT                   /protein_id="ABK14130.1"
FT                   /translation="MLDMGCNPEVTGWSRANTNDIDLVLEMDGIRETGILMSISDPHIL
FT                   IKMGLPGREAAREMYLDALQYAVDHGLRTRAHLEDITRADLEGFVYPLVREIIDIDRDC
FT                   TIRICDTLGYGLPFEGMNDPYSIPNMVRRLREIGVKNIETHIHDDFGFGTVNSIVGYWY
FT                   GANWSNLTFLGIGERAGNAELEKVLLFLKTRVEGFEKYDLSCLTEFAQFMEEHVGIRVP
FT                   RNKAVVGRNIFSHESGIHTAGVIKNPFTYEPYPPEIVGASRSLMIGPTSGREVLKIKVE
FT                   EALRDLIDMDVTINKDDWRLNLIHSEIKRLYDEEKRRSCISDEELKAYVEKYFLFESIF
FT                   EDESHTSGEPISD"
FT   gene            complement(336653..336844)
FT                   /locus_tag="Mthe_0337"
FT   CDS_pept        complement(336653..336844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0624 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14131"
FT                   /db_xref="GOA:A0B607"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0B607"
FT                   /protein_id="ABK14131.1"
FT                   /translation="MQFMSYEDLPKIRLPNGNDVFISDSTLRDGAQMPGIVINLRDRLR
FT                   IYEYLHRRVCLSFKFILY"
FT   gene            337605..338168
FT                   /locus_tag="Mthe_0338"
FT   CDS_pept        337605..338168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14132"
FT                   /db_xref="UniProtKB/TrEMBL:A0B608"
FT                   /protein_id="ABK14132.1"
FT                   /translation="MKSVYATLMLFLLLGLACAGTFTAGLDVDTYVDRDNPNDTFGDAT
FT                   TLWVASAAGEPVKIAYIGFINAFGNQGIFSPDQVSTATLKLTVSDVEKPGIIKVYFVYG
FT                   YISPELTWEDAPEAVENASAEIEIDSPGEYTLDATDIIKEAVRTCTEGCPYGLKIVAEG
FT                   DASVGLASSEVSKGSTELKYIAEM"
FT   sig_peptide     337605..337676
FT                   /locus_tag="Mthe_0338"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.443 at
FT                   residue 24"
FT   gene            338517..339182
FT                   /locus_tag="Mthe_0339"
FT   CDS_pept        338517..339182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0339"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mth:MTH1882
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14133"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0B609"
FT                   /protein_id="ABK14133.1"
FT                   /translation="MRLICIADVHDAPSRLWFLEGRSADLMVIAGDLHNDGTPDTAVRV
FT                   LDQLSRFPQMKLIIPGNMDPRTFAEDLWRSHGLIPIHRSTFVIGKVGFVGMGGMVARNP
FT                   KRIGDPARYYHSDEDLYRTLTDLLRSIRDLDRRVVVVHQPPRGVRDRLYNGELSGSSGL
FT                   RRVIEELQPDLVICGHIHEDRGALNLGGTLVVNVGEARMGYAALIDLDDLDVEWLTAE"
FT   gene            339255..339617
FT                   /locus_tag="Mthe_0340"
FT   CDS_pept        339255..339617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0340"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mth:MTH1226 inosine-5'-monophosphate dehydrogenase related
FT                   protein V"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14134"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0B610"
FT                   /protein_id="ABK14134.1"
FT                   /translation="MSYPVLTVPPNAKVIDAIKLMASGPKGCVIVAEGGLLKEVEGIVT
FT                   TSRIFKKVFAAGLDPANVSVADIMTPAPLVTISPEATTREAAELMVRHNIRRLPVVKDG
FT                   VLVGIITSKDLLQCVK"
FT   gene            339791..339875
FT                   /locus_tag="Mthe_R0009"
FT                   /note="tRNA-Ser1"
FT   tRNA            339791..339875
FT                   /locus_tag="Mthe_R0009"
FT                   /product="tRNA-Ser"
FT   gene            complement(340083..340997)
FT                   /locus_tag="Mthe_0341"
FT   CDS_pept        complement(340083..340997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0341"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14135"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0B611"
FT                   /protein_id="ABK14135.1"
FT                   /translation="MSIAVISDTHFGLKSSVLSRRDNVDYFIWELWRYGDGIDEVVLLG
FT                   DILDLWRVRMESAIRDASYFFRRLDELGLGVSYVVGNHDHHMTVICQELSLLERAARGE
FT                   LFSVYLPNLRWAMNLAGLRMTFHYPTYEMEIGSRRFMFTHGHHLDGIKSLPVQIFEGIR
FT                   RLSGEPVLPADLERMMAYAYESIYRSCYLGEAVEIEESLWRVTSIFDKVRSGVLRTLRY
FT                   SPVESQYDAIIKFIRERHPGKVDCFIYGDTHQAAIYRRNEDLLVANAGSLADGGDNTYL
FT                   ILTDDEIQLRGFGRQEPLMKMYV"
FT   gene            341767..342570
FT                   /locus_tag="Mthe_0342"
FT   CDS_pept        341767..342570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0342"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mhu:Mhun_0286 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14136"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0B612"
FT                   /protein_id="ABK14136.1"
FT                   /translation="MRCFILLVMLALLVVPSMAQQEQPITIRDEDGRDVVIPATPEKIV
FT                   CLSPAAAEVLCALGMSDKIAAVTEDCIIPSLCRCLQEKERVGTSGRNADLERILELKPD
FT                   LVIAKTGSLFPEESEKVLVSCGIPVLRYRALHIDALIPMINDLGRIVNAEDKSHEIIGW
FT                   ITKYYNTILERVSLVPESERPTVYFMSMGHFDWTAGNQSAGDIRISEAGGRNIAGNLTE
FT                   TVPHVDMEWVIQQNPQIIIFSMASNQYKGDTPTEDEMRVLCWITI"
FT   sig_peptide     341767..341826
FT                   /locus_tag="Mthe_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.934 at
FT                   residue 20"
FT   gene            342596..343465
FT                   /locus_tag="Mthe_0343"
FT   CDS_pept        342596..343465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0343"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sso:SSO3220 transposase ISC1058"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14137"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M1"
FT                   /protein_id="ABK14137.1"
FT                   /translation="MAYEDNRNWREYNEKLVRRGWFYLSTDFVNNWDEELLKMNKNKNG
FT                   RPYRYPETFIQFCGLAYAFLHLPYRQLEGFIQALSGFVPGLLAADYSTLWQRITNLELN
FT                   IPIPDNDLVVAVDSTGMKVTNRGDWMRESHGVERRGWIKVHIAVDVETRKPVTFEITDE
FT                   TVTDHEMVKPLLEDVKLEDSLMDGAYDKEGVFDFMKEKGVDMPGIKIRKNAIVKAGSSR
FT                   AEPVLEFMKYGYHSWKIVHGYGRRWAAESVFSAIKRIFGETVRATSKEGMIREVRRMFT
FT                   FYTIILSV"
FT   gene            343537..343791
FT                   /locus_tag="Mthe_0344"
FT   CDS_pept        343537..343791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0344"
FT                   /product="periplasmic binding protein"
FT                   /note="KEGG: mhu:Mhun_1314 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14138"
FT                   /db_xref="UniProtKB/TrEMBL:A0B614"
FT                   /protein_id="ABK14138.1"
FT                   /translation="MRAKRDEIMSLTGFDSIDAVKSGRVYVMDINMASGLSELITLLYY
FT                   AKWFHPDLFQDINPREVHAELLKKYFGMEIDGIHQVYPE"
FT   gene            344466..344966
FT                   /locus_tag="Mthe_0345"
FT   CDS_pept        344466..344966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tko:TK0931 probable transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14139"
FT                   /db_xref="UniProtKB/TrEMBL:A0B615"
FT                   /protein_id="ABK14139.1"
FT                   /translation="MGRRIGHLRAKCPSWHKTMNHNQSGFKLDQDHGRLHLSKIGDIRI
FT                   RIGPVRIRAEARNLDLIASAYHKHLILIRTRPQNTSQGSRSHQSNPDACIVTSMRHYYN
FT                   ASRNILIAGNNKSMHRDIHDAFWSRFMFMLSYEAECAGRRLIKSHEHHSKVFCLWKHCR
FT                   KHP"
FT   gene            345021..345218
FT                   /pseudo
FT                   /locus_tag="Mthe_0346"
FT   gene            complement(345269..345952)
FT                   /locus_tag="Mthe_0347"
FT   CDS_pept        complement(345269..345952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0347"
FT                   /product="histidine biosynthesis"
FT                   /note="PFAM: histidine biosynthesis; KEGG: mbu:Mbur_1675
FT                   histidine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14140"
FT                   /db_xref="GOA:A0B616"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0B616"
FT                   /protein_id="ABK14140.1"
FT                   /translation="MRCIFVMDIYNSKVVHAVRGERSRYRSINTFSRVVSTPDPIEIIE
FT                   ILAPKEVYVADLNRLSGSGDNLKTIERISSKAITMADIGISTLSDLSLLPEPTTPVLGT
FT                   ETASLDLISDASDLRDIVVSIDMKHRKVISHSGLLDPLELIKEMNDLDLLGIILLELDR
FT                   VGTSAGVDIEFLSSAVASSDHPVLVGGGVRGLSDVHALEEIGVHGVLVATAVHSRAMPI
FT                   EMIQL"
FT   gene            345973..346677
FT                   /locus_tag="Mthe_0348"
FT   CDS_pept        345973..346677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0348"
FT                   /product="protein of unknown function DUF556"
FT                   /note="PFAM: protein of unknown function DUF556; KEGG:
FT                   mac:MA4436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14141"
FT                   /db_xref="GOA:A0B617"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="InterPro:IPR035081"
FT                   /db_xref="UniProtKB/TrEMBL:A0B617"
FT                   /protein_id="ABK14141.1"
FT                   /translation="MNMRLLVSPMDLEEAVAALDGGADIIDVKNPREGSLGANFPWAIR
FT                   SVVELVAGRTPVSATIGDLPFKPGTASLAALGAAVSGADYIKAGLLGVSEPEEAIELLR
FT                   PIVRSVRDYDSRRKIVAAAYSDFRRAGSLPPLVLPEIAAECGADVVMVDTAIKDGRSTL
FT                   EFMSVEELKHFVESAHDLGMEAALAGNLGVRDLEAIRAASPDILGVRGAVCGGDRNSRI
FT                   RAELVRSLKDSL"
FT   gene            complement(346772..347317)
FT                   /locus_tag="Mthe_0349"
FT   CDS_pept        complement(346772..347317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14142"
FT                   /db_xref="UniProtKB/TrEMBL:A0B618"
FT                   /protein_id="ABK14142.1"
FT                   /translation="MRFCYAVILLIAFMAMNAGAQRYESTPPQYDDSLGGGLGWMNIVS
FT                   PEHTAEYLAKTGGATGSATTYTSIDIRGNWSFELRTLDDKMVGTVNLNLAQIGTVVFGA
FT                   GTVRGSNAIVTANGAIVDNMLTLNIVTYPNVELYSARLNQIGGGGRSAAGYFDAYSSSG
FT                   GSLQGTIRGEKDVPRTLS"
FT   gene            complement(347314..348393)
FT                   /locus_tag="Mthe_0350"
FT   CDS_pept        complement(347314..348393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0350"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mbu:Mbur_1236 Fe-S protein,
FT                   radical SAM family"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14143"
FT                   /db_xref="GOA:A0B619"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A0B619"
FT                   /protein_id="ABK14143.1"
FT                   /translation="MTATGPLAPVAKPIVKKINSIFANEKPISSGDRLIFSTWIPPAPS
FT                   MAFDRMISAQLRHLMRRKVPDQLSISVFRGCPNSCIHCSAPSRSGDVLEGDVVKRVISE
FT                   ALDLGSYLVTFDGGEPMLRLDLPDLVASVDDRAIATCFTSGYALSEKLALELKKRGLYA
FT                   IRVSIDSPVEEQHDHFRGRRGAFGDAISGARNALQAGLLVDLFMVVSPYNIDQLEDAYS
FT                   LASDLGAHELSLYEIVAVGRWEDHLDEVLSSKDIERLAEFHMRKNRQPDGPRVTALPYL
FT                   LSPEMFGCFAGRRWIHVDPSGDAMPCAYMPISFGNVKKSSLKNIWRRMSRYSWFRHRCS
FT                   CQMKDDVFRSLHLEKEVPK"
FT   gene            complement(348426..349295)
FT                   /locus_tag="Mthe_0351"
FT   CDS_pept        complement(348426..349295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0351"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: mma:MM0789
FT                   farnesyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14144"
FT                   /db_xref="GOA:A0B620"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0B620"
FT                   /protein_id="ABK14144.1"
FT                   /translation="MFANWEEHGLIEDGLGALVQESQGLHVGEVIEYVLMSPGKRVRPL
FT                   ILLFSSEAFGCDPRYALNAALAVELAHAASLIHDDILDCGVERRGAPSAFRRFGMEASL
FT                   LAGDYLISMSIGLISSYGEPAIRLFSKACMDMAEGEIIDLSRIASPQEYYQCITKKTAS
FT                   LFAASARLGCMIAGADREDQILYERYGLELGLAYQIVDDLEELIGIDQGKRSTKKSMTL
FT                   PRIYALRSGPEETLRMCVDAVREHTGNAHTSLRSAGGDPEMKERLLMILDCMTESMVKR
FT                   CSLPSPLF"
FT   gene            complement(349496..349969)
FT                   /locus_tag="Mthe_0352"
FT   CDS_pept        complement(349496..349969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0352"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: mma:MM0963
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14145"
FT                   /db_xref="GOA:A0B621"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:A0B621"
FT                   /protein_id="ABK14145.1"
FT                   /translation="MRERFILIVLCITVCQLAGVLGSYFTDMSVSTWYPMLIKPSYTPP
FT                   GWLIGVVWVVLYTLMGISLFLVLDSKPESGTLKSALIPFGVQLLLNISWSGAFFGLRSP
FT                   LYALVVIAALWLSIIITMRRFYDVSRIAGVLLIPYIMWVSFAAYLNYTIWRLN"
FT   gene            complement(350327..350692)
FT                   /locus_tag="Mthe_0353"
FT   CDS_pept        complement(350327..350692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14146"
FT                   /db_xref="UniProtKB/TrEMBL:A0B622"
FT                   /protein_id="ABK14146.1"
FT                   /translation="MKHPDRIFSFMEVESEDDLVKAITEHTWPLCYGFYHEDLLYLGDG
FT                   DREDAPEYSVVRIERTEGHHGIVGTEVGRVSSHNKDEVRRIIREIKAGAYTMSNPVKVQ
FT                   VEPKWHHSCELCRLEED"
FT   gene            complement(350689..351474)
FT                   /locus_tag="Mthe_0354"
FT   CDS_pept        complement(350689..351474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF2093 A. fulgidus predicted coding region
FT                   AF2093"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14147"
FT                   /db_xref="UniProtKB/TrEMBL:A0B623"
FT                   /protein_id="ABK14147.1"
FT                   /translation="MGLHEIMTDKIGLIGERINSLLKERGIIARCELLHRIYQAVREAD
FT                   LSDAEMDILRRMVGDRPAPGIFSSMMSGHPVFPDTPKLDSFIVIHGRIFHFPLSGKYDR
FT                   PDFERAYETFKRLRGELLELVRFNLEDLTTDFLIRAGYSQSHRGLGRLSFVKGDDRLEV
FT                   LVYPRISMLDVEECILASELYDSMAAIVPHEENLDPFMAFYREHVSHLEDTDVQIWVAN
FT                   MEEGTIDPFMGFTTDPEIYMAFKNPKLASLVRSRWRFIR"
FT   gene            complement(351542..352510)
FT                   /locus_tag="Mthe_0355"
FT   CDS_pept        complement(351542..352510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0355"
FT                   /product="GTP cyclohydrolase MptA"
FT                   /EC_number="3.5.4.-"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   mbu:Mbur_0054 protein of unknown function DUF198"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14148"
FT                   /db_xref="GOA:A0B624"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022840"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B624"
FT                   /protein_id="ABK14148.1"
FT                   /translation="MERLPDVQACHPAYPINLTRVGVTGVKKLVKVERSGERPIVLISN
FT                   FEVFVDLPSSRKGANLSRNTEAIDEVLEEEISRPVYEIEELCGKIALRLLERHEYATRA
FT                   EVKMKSEYIVKRQTPATRVNCQEVVDIFAEAMATSGPDPHVKKIVGAEVIGTTACPCAQ
FT                   EIVREQMRRDLLNLGLSEDAIEGFLKKVPVATHNQRGRGSISIEVRDRKCVPIDRIIRI
FT                   IEESMSSKVYGLLKRPDEALVVSRAHMNPMFVEDCVREMAQRVVATFVELPDDAVVTLK
FT                   QINEESIHRHNAFAERVAKMGELRAELAAIHEMQPCGASQM"
FT   gene            complement(352522..352797)
FT                   /locus_tag="Mthe_0356"
FT   CDS_pept        complement(352522..352797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14149"
FT                   /db_xref="UniProtKB/TrEMBL:A0B625"
FT                   /protein_id="ABK14149.1"
FT                   /translation="MADPRISEKAQISLAQVFYREDNHMHDPDDIERQLRELMLTGYDG
FT                   SVRAELESILDGINERDCRISEMLDELLEEVDRLLLLMDELGLDDE"
FT   gene            complement(353408..354292)
FT                   /locus_tag="Mthe_0357"
FT   CDS_pept        complement(353408..354292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0357"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: mma:MM2245 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14150"
FT                   /db_xref="GOA:A0B626"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A0B626"
FT                   /protein_id="ABK14150.1"
FT                   /translation="MFYDSLMIVINFFVKIALELTVLFIGVSFLVGLIHEYVSDDAVKR
FT                   ALGGRHIVAGSVLGAAFGALTPFCSCSTIPMLLGMLNAGVPFAACMSFLFSSPLLNPVI
FT                   LSLFVVLLGWRVALLYLAVTFLVAVSAGLVLDALGFKSQVKSVAFVRDDLPAQDAGSRI
FT                   RRSADFALTLFCQLMPYLLLGAGIGAFIYGFVPSDLVVQIAGQDNTLAIPAAAIIGIPL
FT                   YIRTETILPIGLALIEKGMSVGAVLALVIGGAGASIPELSLLSAIFERKLLAAFVLTIF
FT                   TIAVAAGFMGNLL"
FT   gene            complement(354400..354654)
FT                   /locus_tag="Mthe_0358"
FT   CDS_pept        complement(354400..354654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_00346 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14151"
FT                   /db_xref="UniProtKB/TrEMBL:A0B627"
FT                   /protein_id="ABK14151.1"
FT                   /translation="MSGGCCGRVVSLQQINVGGRIIGIMGMNEVFQEYFKKGKTPDDVT
FT                   GDELVKDLRKFNYIAEGAEQYYKEAFLREYRRYYEARTK"
FT   gene            354917..356158
FT                   /locus_tag="Mthe_0359"
FT   CDS_pept        354917..356158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0359"
FT                   /product="peptide chain release factor subunit 1 (aeRF-1)"
FT                   /note="TIGRFAM: peptide chain release factor eRF/aRF,
FT                   subunit 1; PFAM: eRF1 domain 1; eRF1 domain 2 protein; eRF1
FT                   domain 3 protein; KEGG: mbu:Mbur_1738 peptide chain release
FT                   factor eRF/aRF, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14152"
FT                   /db_xref="GOA:A0B628"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:A0B628"
FT                   /protein_id="ABK14152.1"
FT                   /translation="MEISAQEKYEFKRLLDELRSKSGRGTELISLYIPPDKQISDVMAQ
FT                   LREEHGQAANIKSKLTRTNVQSALESAMARLRLIPRAPENGVVLFIGAVDIGGNRTDMY
FT                   TKVIEPPEPITTYRYHCDSSFLLTPLEEMLSEKKTFGLIVLDRREATIGILKGKRIEPL
FT                   KHLTSTVPGKQRKGGQSSHRFQQLRLIAIHDFYKRIGEAANDAFLSIDQKELQGILIGG
FT                   PSPTKEEFIAGNFLHHELQRKIVDAFDVSYTDEAGLSELVEAAQDRLLDLELTQEKLAM
FT                   RRFMKELVSDRGLASYGEKEVRHNLALGAVDLLLLSEELRKTRAKVRCQNQSCDYSEEM
FT                   TRTPSSPAIGTCPKCGSPLTITEEVDLITELSQLAEQSGAAVKIISTDFEEGAQLLHAF
FT                   GGIAAVLRYKTSHR"
FT   gene            356222..356635
FT                   /locus_tag="Mthe_0360"
FT   CDS_pept        356222..356635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0360"
FT                   /product="protein of unknown function DUF54"
FT                   /note="KEGG: mbu:Mbur_2152 protein of unknown function
FT                   DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14153"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:A0B629"
FT                   /protein_id="ABK14153.1"
FT                   /translation="MIEVTVRTLVRPTERVEKVVAAIERIFPGLTLDIRDDLVQGYGGI
FT                   SSLRVFRKVLRDERILDTARSVMLAGRIGDSYQFRISKPGAFMGRVGFPPEEEPLGSIH
FT                   VEISGGEEVIDWLAPRTIDGKPVAEIELDEVEQ"
FT   gene            356632..357393
FT                   /locus_tag="Mthe_0361"
FT   CDS_pept        356632..357393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0361"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mma:MM1311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14154"
FT                   /db_xref="GOA:A0B630"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0B630"
FT                   /protein_id="ABK14154.1"
FT                   /translation="MISFSSSALVDRPFDWAYQLEDLGYTGWEIVCEGMQRLTEDNVDE
FT                   ARRIAETTDLVITLHLPYSDLNLASVNQPIWEESVRQMKSCLTLAADFTELAVVHPGHL
FT                   SPLGAQVPERAWEQNILGIRSICDHAEDLGITIAVENMVNIPTLLGRAPFEIVGIMDTV
FT                   DRENLGFTLDVGHANTNGNLKEFLQLRERITHIHIHDNHGERDEHLPVGSGTVDWRLVF
FT                   SSLNGYRGRYVTEARSLVQGQTSLSRIKMLM"
FT   gene            357438..358109
FT                   /locus_tag="Mthe_0362"
FT   CDS_pept        357438..358109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0362"
FT                   /product="Translin"
FT                   /note="PFAM: Translin; KEGG: mba:Mbar_A1205 translin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14155"
FT                   /db_xref="GOA:A0B631"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:A0B631"
FT                   /protein_id="ABK14155.1"
FT                   /translation="MHPKEESNRSDLDDLIDALLKHFDEKDAAREEALRLSRIVIRLSS
FT                   TAIRATHRRERREAESLLKDAREHLTTIKDLLVEHQDVRYSGFVDDAEQEFVEASVLYS
FT                   LIFEGRMPTHEDLEVDPVSYLSGLGDLTGELRRNILELIRNGRPEDGEVLLEIMEEIYH
FT                   MLMRFDYPDALMRGLRRKTDLTRSMIERTRGDITNALQIQSLERHLALLEDKLKGLYSK
FT                   L"
FT   gene            358176..359813
FT                   /locus_tag="Mthe_0363"
FT   CDS_pept        358176..359813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0363"
FT                   /product="phosphoserine-tRNA(Cys) ligase"
FT                   /EC_number="6.1.1.-"
FT                   /note="TIGRFAM: O-phosphoseryl-tRNA(Cys) synthetase; PFAM:
FT                   phenylalanyl-tRNA synthetase, class IIc; KEGG:
FT                   mbu:Mbur_0923 O-phosphoseryl-tRNA(Cys) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14156"
FT                   /db_xref="GOA:A0B632"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR005246"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041590"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B632"
FT                   /protein_id="ABK14156.1"
FT                   /translation="MKFDPAEIREAAEKDFDGTWKRGVDYLERPSLERIYPRRSYPHGR
FT                   PHPVFETIQRLREAYLRMGFTEMMNPVIVDAQEVHRQFGSEALAVLDRCFYLAGLPRPD
FT                   IGISESRLSEISSIVGKELTAEEIEALREILHSYKKGAVEGDDLVPEISKAINASDSQV
FT                   SMMLESVFPEFRELRPEPTSRTLRSHMTSGWFISLSNLWYRMPLPVRLFSVDRCFRREQ
FT                   SEDAARLMSYHSASCVVMDEDMSVDEGKAISEGLLSQFGFENFRFRPDEKRSKYYIPGT
FT                   QIEVYAYHPGLVGSETKYGSGWVEIATFGVYSPTALAQYDIPYPVLNLGLGVERLAMIL
FT                   YGSKDLRALSYPQLQPDWSLKPIEIARMIHVDKSPMTVTGKEIARSVVETCVKYGNTPS
FT                   PCEFDAWEGELFGRRIKVSVVEPEENTKLCGPAYLNEIVVYRNEILGIPRTPKWEAAFE
FT                   EGVQTGIRFIDAFAELAAHEIEMATIEGRGSETRVRIVRTAGEINVRIDPALERYITSY
FT                   KKRIDIRGPVFTTVRSELMQGDKHGEKT"
FT   gene            359875..360495
FT                   /locus_tag="Mthe_0364"
FT   CDS_pept        359875..360495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0364"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: mba:Mbar_A3172 ribose 5-phosphate epimerase;
FT                   TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14157"
FT                   /db_xref="GOA:A0B633"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0B633"
FT                   /protein_id="ABK14157.1"
FT                   /translation="MVVGLGTGSTVAWTIRAIGRMVAEGLDILAVPTSYQSEALAIECG
FT                   IPLTTLSQNPVLDLAIDGVDQIDIRMNAIKGGGAAHTREKVVSIAARRFVVVADGSKRV
FT                   EVLNRPVPVEVLPFAAMVVERELVRIGGYPVVRQARMKDGPVITDNGNFVMDVSFGEIR
FT                   DPATLAQEISQIPGVVDHGIFTKIDELHIAHNGTVEVIRRNDL"
FT   gene            360485..361504
FT                   /locus_tag="Mthe_0365"
FT   CDS_pept        360485..361504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0365"
FT                   /product="translation initiation factor 2B subunit I family
FT                   (IF-2BI)"
FT                   /note="KEGG: mma:MM1371 archaeal protein translation
FT                   initiation factor 2B subunit 1; TIGRFAM: putative
FT                   translation initiation factor, aIF-2BI family; eIF-2B
FT                   alpha/beta/delta-related uncharacterized proteins; PFAM:
FT                   initiation factor 2B related"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14158"
FT                   /db_xref="GOA:A0B634"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:A0B634"
FT                   /protein_id="ABK14158.1"
FT                   /translation="MISESRTIWWDNGIKTIDQTRLPAEFVVITIRSIKELVNAITSLK
FT                   IRGAPALGAAGGYGIALAAMRSKFQERDGVLHEMEIAAEMIKNSRPTAVNLSWGVDRVL
FT                   RAAQEGEIADEVREIALREAERIAEEDLIINKMIGRHGAKLLNDGDSVLTHCNAGRLAC
FT                   VGWGTALGVIRQAVMDGKEIHVYACETRPLNQGSRLTSWELMEDNIDVTLVCDSASGIL
FT                   MRRGMIDSVIVGADRITRDAVFNKIGTYTHAVLAKAHGIPFYVAAPLSTFDASHDESEI
FT                   VIEERDGDELRRLGVTRLAPDGVKVYNPAFDATPIDLVSAMITEKGVFRQPLMPPGIL"
FT   gene            362791..363099
FT                   /locus_tag="Mthe_0366"
FT   CDS_pept        362791..363099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0366"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="PFAM: translation initiation factor SUI1; KEGG:
FT                   mba:Mbar_A0534 translation initiation factor SUI1"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14159"
FT                   /db_xref="GOA:A0B635"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B635"
FT                   /protein_id="ABK14159.1"
FT                   /translation="MSSEMCTVCGLPKELCICEEVAKEQQRIVVKIHKRRYGKEVTVIQ
FT                   GIDPHEIDLQDLCTYLKSKLACGGTVKDGVIELQGNHIGRIKDLLSKKGFSASQISL"
FT   gene            363758..365098
FT                   /locus_tag="Mthe_0367"
FT   CDS_pept        363758..365098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0367"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: pfo:Pfl_1454
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14160"
FT                   /db_xref="GOA:A0B636"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0B636"
FT                   /protein_id="ABK14160.1"
FT                   /translation="MFTISFVGMHDGHLMLIPILLYLLITAFLGYLVRSERSWNDFFLG
FT                   GRGFGTLHITGSLVATILGASSTIGLVGLGYSRGLPGAWWLLSGALGLLVLSKVAHAVR
FT                   RTGARTLPDLIGIFYGSSAKKTASILILISWLGVIAAQIVAAGRIMGALFGHDWFWMSA
FT                   MAVVLVAYTAHGGQRAVVRTDLWQIYVILAGVILMFAICLRSAPEALNRLEFPMSEQMS
FT                   LQDIISMVVVVGSMYLIGPDIYSRVLSARNPESARVAAIFSAMIIIPLAFVITSIGIFA
FT                   QHLLPDIRPEDALPLLITDILPPWAGGVVAAAFLAAVMSSADTSLLTASSILTLDLGLG
FT                   SGVRARWLAALFIGTCSMLLAMSTPGIISTLMLAYTVFSGGFLVPVIAGFHRERLGLTQ
FT                   SSATAGMLCGGATSLLLAEVFPLSGICVSALTMAIVSAVEKRRRVTE"
FT   gene            complement(365345..366643)
FT                   /locus_tag="Mthe_0368"
FT   CDS_pept        complement(365345..366643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0368"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: mbu:Mbur_1426 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14161"
FT                   /db_xref="GOA:A0B637"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/TrEMBL:A0B637"
FT                   /protein_id="ABK14161.1"
FT                   /translation="MEVKLDPWGTSQIEDYSKLFEEFGISRFEEILPEIDDPHPYMRRR
FT                   IIFGHRDYDVVLRAMNEHRPFAVMSGFMPSGKAHFGHMMVMNEIIWHQKHGADAFVAIA
FT                   NMEAHAVRGISWQRCRELGINDYILSLIALGFEPTGHIYFQSENYRMRDLAFELAAEAN
FT                   FSEVSAIYGFSGETSIGHMESVMAQSADILHPQLPDYGGPKPVVVPVGSDQDAHMRLTR
FT                   DLAYRMRKFLVEQREGYISIRGKAAGPDLIKAAANALSEAGYTIKQYSEHIDLFDGVSA
FT                   ERIDELIREVEVNNGEFGFIPPASIYHRFMTGLTGGKMSSSRPESYIALTEDPDEAANK
FT                   IMKAITGGKQSLAEHRRYGGEPERCAVYEFLLFHLAEDDSELEELYKECRSGRQMCGSC
FT                   KKIAAARIREFLKEHQSARRDAINRLKEFGLKA"
FT   gene            367022..368356
FT                   /locus_tag="Mthe_0369"
FT   CDS_pept        367022..368356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0369"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54,
FT                   G- domain; Signal peptide binding (SRP54) M- domain
FT                   protein; GTP-binding signal recognition particle SRP54,
FT                   helical bundle; SMART: AAA ATPase; KEGG: mac:MA4587 signal
FT                   recognition particle, 54 kDa protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14162"
FT                   /db_xref="GOA:A0B638"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B638"
FT                   /protein_id="ABK14162.1"
FT                   /translation="MVLDNLGGSLRGALKKIASATRVDKALVDDAVRDIQRALLQADVN
FT                   VKLVMSLSNRIRERALNEKPPAGMNPREHVINIVYQELINLIGRGTDIPLKKQTIMLVG
FT                   LQGSGKTTTAAKLATYFQRRGLRTAVICADTFRAGAYDQLKALCDRQGIFFYGEKGNEN
FT                   APEVAKNGLEATKKYDVRIVDTAGRHALESDLIQEMKDIHAVVNADHKLLVMDAAIGQQ
FT                   ASEQARAFNEAVGITGVIITKLDGTAKGGGALSAVAETKTSVAFIGVGETASDLEKFEA
FT                   DRFISRLLGMGDIKGLIEKAQEVQIESDVDVDAMMKGKFTLKDMYKQLEAMNKMGPLKQ
FT                   IMQMLPFGGIGIELSDKEYQVTKERLEAYRFIMDSMTDEELEDPKIINASRIKRIARGS
FT                   GTRPELVKELLKSHAAMQKAIKGMRGGMGRMNMKKLMKRLGQPKV"
FT   gene            complement(368353..368550)
FT                   /locus_tag="Mthe_0370"
FT   CDS_pept        complement(368353..368550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14163"
FT                   /db_xref="GOA:A0B639"
FT                   /db_xref="UniProtKB/TrEMBL:A0B639"
FT                   /protein_id="ABK14163.1"
FT                   /translation="MIIGILVAVVGIWTMANPAWFGHNSWMYGLNWWSYTASIIKGSIG
FT                   PLLILVGIVIVWIAYEESRV"
FT   gene            368861..369619
FT                   /locus_tag="Mthe_0371"
FT   CDS_pept        368861..369619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14164"
FT                   /db_xref="UniProtKB/TrEMBL:A0B640"
FT                   /protein_id="ABK14164.1"
FT                   /translation="MYTRLSFVFIMLVMLLTISSAQEPLWLGRGATEDVMNLNVGARSP
FT                   GYVPAFGTSGFAAPASPQVMALSTSAMVHQAESLLSEMKRERDEILSIYNLTRKMAVYA
FT                   SENASIARSMAESAEMNARRAETSAYECRVALNETESVRSEILSIYNLTRKMAVYASEN
FT                   ASIARSMAESAEMNARRAETSAYECRVALNETESVRSEILSIYNLTRKMAVYASENASI
FT                   ARSMAESAEMNARRAETSAYEFRMAINTSS"
FT   sig_peptide     368861..368926
FT                   /locus_tag="Mthe_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.901 at
FT                   residue 22"
FT   gene            369722..370741
FT                   /locus_tag="Mthe_0372"
FT   CDS_pept        369722..370741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0372"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mbu:Mbur_1326 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14165"
FT                   /db_xref="GOA:A0B641"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0B641"
FT                   /protein_id="ABK14165.1"
FT                   /translation="MNIKRNWMIAVVLIAFIAIAYFMFPLVDGIILGTVFAYIGRPIRD
FT                   MFGPRKRLGSAIATIGIIVPISLVLILGVMEIANFFMWIAQNPGSMAREMSSTISGLEI
FT                   PDEIYTLITGSLQSILSFVADVAARMPLLDYGRRVVLLAVNIIVAIPVCYFLLCDGERF
FT                   VDSWFTIVPEESLDTYRAYFNRIDRILSGIFLGSMYTAIVGSVISAIVFYAFDVPRPFA
FT                   MASLVFIAGLVPALTAWAVIVPVSIYRYIHMGPAEALMFFAVASALIYLPSELIVRPYL
FT                   VAARSSIHPLLVMLSFLGGAMVAGIGGFFLAPAVMGVIVGIYQVRREQSLAAKETQNL"
FT   sig_peptide     369722..369835
FT                   /locus_tag="Mthe_0372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.958 at
FT                   residue 38"
FT   gene            370760..371995
FT                   /locus_tag="Mthe_0373"
FT   CDS_pept        370760..371995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0373"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: pab:PAB1134 hypothetical protein; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; MiaB-like tRNA modifying
FT                   enzyme; PFAM: deoxyribonuclease/rho motif-related TRAM;
FT                   Radical SAM domain protein; Protein of unknown function
FT                   UPF0004-like; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14166"
FT                   /db_xref="GOA:A0B642"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A0B642"
FT                   /protein_id="ABK14166.1"
FT                   /translation="MRFCIETYGCTSNTGNSMELRGALIAHGHQESDLDGSEVVILNTC
FT                   AVTSRTERNMLRRIGELKGRRLIVAGCLPAAIPELIESVECVGVLNRWGIDRVLDALGR
FT                   SEHPTSELSASCLPGSLCGVVNISEGCLGACAYCIVKRARGTLRSREPHEIEKDVMRLI
FT                   SSGAVEIQLTSQDAGAYGCDIGASLPELLDLLSDIDGAFMIRVGMMNPNSVLKILDDLL
FT                   DSYKNEKIYRFIHLPLQSGSDRVLERMRRGYTSDDFVNVVSAFRSRYPEISLTTDVITG
FT                   FPGESDQDFRMTEDVIRITQPDKVNVTRFSRRPHTLAFMMHDMPDRIKKERSRRVTELW
FT                   MDIALIRNRRYIGETLDVLVTEQGRAGTMKARTRNYTGVVVHGLSSPGKWVKARAIDAT
FT                   PFYVKARYTESL"
FT   gene            complement(372046..372588)
FT                   /locus_tag="Mthe_0374"
FT   CDS_pept        complement(372046..372588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14167"
FT                   /db_xref="UniProtKB/TrEMBL:A0B643"
FT                   /protein_id="ABK14167.1"
FT                   /translation="MFEELLEVYKNRAAETERKLREEQAMIELITAVNRLTESAGYGRD
FT                   VELLGRLIDQVDRLSKEVADLKTQLRARHARAAKDLEHSEGRAIDRHARALIEIMSERP
FT                   GEYTTAELVDMLGLNKTTVISVMKRAAELDPRHVRLTHGKRRKLTLTYLLDESLTSNSG
FT                   SDMSDRERMKLELMALT"
FT   gene            complement(372991..373788)
FT                   /locus_tag="Mthe_0375"
FT   CDS_pept        complement(372991..373788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0375"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mbu:Mbur_1901 haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14168"
FT                   /db_xref="GOA:A0B644"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0B644"
FT                   /protein_id="ABK14168.1"
FT                   /translation="MGELAVVLDVAGTLLRMYRVANDLIHGRILEGIVTAQLIIERPGR
FT                   ALVVPQMDPGDIQRCPEDTHLLKLIEMSSEGIEISCYSTPVSHSDVIEAIRCSDATVRD
FT                   LLIAHNAVRQRCPETYHTTGLIVDAVDMTVPYIVSTGGVPFPGVRSVLDELRDMGADIY
FT                   IASGDSARSLIHMVDYGIDPKNIYSVADPMRKREIVKRLKENHRAVVMVGDGLNDIYAL
FT                   EEADLGVLTIQQNPDPHPRLLEVADVMIRDIRQLPAAVKTYIL"
FT   gene            373976..374860
FT                   /locus_tag="Mthe_0376"
FT   CDS_pept        373976..374860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0376"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /note="KEGG: afu:AF0504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14169"
FT                   /db_xref="InterPro:IPR014426"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B645"
FT                   /protein_id="ABK14169.1"
FT                   /translation="MNLIPIAFDSLGVRSMATCLEARGLRVMIDPAVSLGPRRYGLPPH
FT                   PIELDRLNTTWQDVRGLAESSDILIVTHYHYDHHNPNDPDLYRGKIVYIKDPKNRINFS
FT                   QKRRAHYFLSRIEDADIQIADGGEFGHGPLTIRFSQPVYHGTGNRLGYVIEASISCGED
FT                   KVVYTSDVEGPAMDDQVTFILEESPRTLILDGPMTYMLGYRYSEEDLRRSVNNIIKIIC
FT                   NTSVKTVVIDHHFMRDIGYAERIPEVYRSAEDAGVRVLCAAELIGRAPDLLEARRKELY
FT                   RSSPVGEESSKQE"
FT   gene            375690..376619
FT                   /locus_tag="Mthe_0377"
FT   CDS_pept        375690..376619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0377"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: afu:AF1300 putative ABC-2 type transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14170"
FT                   /db_xref="GOA:A0B646"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B646"
FT                   /protein_id="ABK14170.1"
FT                   /translation="MKDAVCASGICKGFNTIFRGKKEVLKDINLLIDGEEIFGILGPNG
FT                   SGKTTLLSIFSTLIYPDSGELTILGIDARRNTHEVRKLINISTGKPNFPWSLTVKENLR
FT                   HSGMLYGLHGRELDRAVDWSMESFELYQYQDTRFENLSTGVKQRLSLAKAMLNGPKLLF
FT                   LDEPTTGLDPQMAQRTRALVKRIHRDMGVSVVMTTHYMPEAEELCGMIAFLKEGRIIAQ
FT                   DTPARLKRNLKIGERMRIRYSGNIDCDALRSIPGLISAEISKGRADLVVDKNEATFSRV
FT                   MRTFQSAEILELELEEPDLEDVFIELAG"
FT   gene            376603..377388
FT                   /locus_tag="Mthe_0378"
FT   CDS_pept        376603..377388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0378"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: afu:AF1302
FT                   putative ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14171"
FT                   /db_xref="GOA:A0B647"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0B647"
FT                   /protein_id="ABK14171.1"
FT                   /translation="MSLQGEINKCLSAAYKNWIISKRNVFTVFELVFWPLISLLSIGLM
FT                   TRFLGVGGDTVAFLLVGAIGLTILQICQIDVAYVLLFDMWSKSIKNTFVSPVRGYHLVL
FT                   GALLFGMVRGTFAFTILVVISRILFGFDFLAGGFHTVLIFLAGVFAVSAIIGMIVCISI
FT                   LLFGQKADVAAWSLSGVIMLISGIYYPVSVLPEPLQLMARAVPLTYFLEYYRSAYGFGD
FT                   HNIVIGVLMVAAYMIAGLIVLEMTIERARKTGILLRLSE"
FT   gene            complement(377617..380274)
FT                   /locus_tag="Mthe_0379"
FT   CDS_pept        complement(377617..380274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0379"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein domain protein; Haloacid dehalogenase domain
FT                   protein hydrolase; cation transporting ATPase domain
FT                   protein; E1-E2 ATPase-associated domain protein; KEGG:
FT                   dsy:DSY2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14172"
FT                   /db_xref="GOA:A0B648"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0B648"
FT                   /protein_id="ABK14172.1"
FT                   /translation="MANWHALPPEEALKLLNSGPDGLTDAEAASRLERFGPNDLARISG
FT                   PGPVRILLRQFENYMVIVLMAAAVISWLSGERSNAIVVLGILLFIAILGFVQEYRAERA
FT                   MEALRKMVAPEARVFRSGKLITLPARDLVPGDLIYLEAGDIIPADARILDAAALKTVES
FT                   SLTGESTPVRKSPDPVEEGAPLADRSSMVFMGTMVIYGNGKAVVTSTGSDTEIGRISGM
FT                   IQETPAEPPLKIRLQQLSKSLAVLVFIAALVVFSIQVYRGYPVLDTLLIAAALAVAGIP
FT                   EALPFVVTLALAYGTQSMARRNAIVRRLPAVETLGSTTVICTDKTGTLTRGEMTVREVW
FT                   CGCRVEVTGSGYVPEGVFRVNGSEIDLGSDAAVRETIITGALCNNSEIVFEDGWHVVGD
FT                   PTEGALIVLARKAGLDVREMCREVTEYPFASDTRRMTTVHECDSGLRVSMKGAVEVVLE
FT                   RCAYMMDSTGLKPLTDVDRRRILEIADEMAGRALRVLAAAFKRIESEEPDREVLESDLI
FT                   FTGLFGMMDPPRDEVCGAIDVCKKAGIRPVMITGDHKRTAEAIASELRMLNGEVLDGSE
FT                   LDSMSDQELSDRIERISVFSRATAEHKMRIIKALKEHGHVVAMTGDGVNDAPALRSADI
FT                   GIAMGRTGTDVSKEASDMVLADDNFATIVAAVEEGRRIYENIRKASSYMLAVTFAEVAV
FT                   ILIAVLVGLPAPLLALQILWINVVAEDFPAIGLAVEPARSGIMNERPRNPKEPILSRDL
FT                   LIYTIGTSAAMLIGTLGLFLLNIDGGLGYARTVAFASLGICAIYNAYSSRSFHHSVLQM
FT                   NPMGNRKLLAGIVTSLASVLMVIYVPVFQGAFETLPLTMNSWLQVWLVSTIVIVVAEVL
FT                   KRSMLKASKTCASH"
FT   gene            380584..381477
FT                   /locus_tag="Mthe_0380"
FT   CDS_pept        380584..381477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0380"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   mma:MM0714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14173"
FT                   /db_xref="GOA:A0B649"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A0B649"
FT                   /protein_id="ABK14173.1"
FT                   /translation="MDLNVPLDVPRNARDEYIRNYMEITRGSGRLMLFAGDQKVEHLND
FT                   DFYGPGISEDDADPEHLFRIASRGRIGVFATQLGLIARYGMDYPEVPYLVKLNSKTNLV
FT                   KTSQADPLSRAWLDVSQVMEFRRESGLRILGVGYTVYPGSEHEVVMLREAAQVVHEAHR
FT                   HGLVVVLWMYPRGKAVKDERDPHLIAGACGVAAALGSDFVKVNYPKAENPALAFREAVM
FT                   AAGRTKVICAGGSSEDPELFLQRLHEQIHISGASGNATGRNIHQKRLEDAIRMCNAIYA
FT                   ITVENRSLEEALRMLR"
FT   gene            381839..382573
FT                   /locus_tag="Mthe_0381"
FT   CDS_pept        381839..382573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14174"
FT                   /db_xref="UniProtKB/TrEMBL:A0B650"
FT                   /protein_id="ABK14174.1"
FT                   /translation="MTIKFKSSNDDISCEGGIKTRILILMAVLITVSSAVADPSYGSKV
FT                   LPYDADESRALSAFSSAPVFAYSDANIRGIFDISDPVYIDVDPSDDAVNENDVRLTPFG
FT                   SYPAGSQVRLGDQDYGYKLTPFGVSGMPGAQLVYFDVDGDEAYSIVDPVYLDVGPEYGR
FT                   IDAGDVRITGYMTLQAGTRVRDSDPDNDKPAPVLPAMLCFMNLNGNINSGGWAIYDQGD
FT                   RIYVDTQYPFYTVTVNDIRLFV"
FT   gene            382714..383349
FT                   /locus_tag="Mthe_0382"
FT   CDS_pept        382714..383349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14175"
FT                   /db_xref="UniProtKB/TrEMBL:A0B651"
FT                   /protein_id="ABK14175.1"
FT                   /translation="MLRCKWSHAALLVVFVFCTCGGLAQNATIDQPALEGIWRLSLGQK
FT                   AVTMVIHQYEDQLFGSASSSEESWNGVAMGSTNNSTAEIIITFLRDGGIAEIRLIGSCL
FT                   AEEMRGTFYRSDSIGNAESGEFDAILINPDTSGYTPVKEAQSDIVTTQPESTTTSSNTT
FT                   SVDSSETQGTGAQSRYTDVHSLAHLVPPAAGVIPPGINMGGAGGMGMS"
FT   sig_peptide     382714..382788
FT                   /locus_tag="Mthe_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.724) with cleavage site probability 0.716 at
FT                   residue 25"
FT   gene            383353..383970
FT                   /locus_tag="Mthe_0383"
FT   CDS_pept        383353..383970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0383"
FT                   /product="Kynurenine formamidase"
FT                   /EC_number="3.5.1.9"
FT                   /note="PFAM: cyclase family protein; KEGG: gsu:GSU3349
FT                   cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14176"
FT                   /db_xref="GOA:A0B652"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A0B652"
FT                   /protein_id="ABK14176.1"
FT                   /translation="MRSHLIYDVTHTMSSSLPVYPGDPGFSRDVLKSLDRGDPYTLSAL
FT                   HLSAHAGTHIDAPSHFISSGRSVHEIPIERLIMMVALIDSGMVVSPENLSGLNPPAEGV
FT                   MFRTGSLMGEISESAARACVDLKLKLVGTDALSVDSLEGDVVHRILLSNDILILEGLCL
FT                   DGVPAGIYTLICMPLKIEGAEASPVRAILAPAEWRLTTETPS"
FT   gene            383999..389077
FT                   /locus_tag="Mthe_0384"
FT   CDS_pept        383999..389077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0384"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: cyb:CYB_1640 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; GAF domain protein;
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase A domain protein domain protein; Hpt
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14177"
FT                   /db_xref="GOA:A0B653"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0B653"
FT                   /protein_id="ABK14177.1"
FT                   /translation="MDADQPAVYVFDEKGRIRYLSRTAEMLSGGISKCRSIHEVLGVSC
FT                   SESLASAIASDAPSRIRARIGCSGSEIPLSVIPLRDADGSRGLMIISDPSGSFREEGRE
FT                   ERWYRTALDRCREAVFFVEAESRRILDANAVFQELLGYPPEEIHSLTLYDIMEQDREEI
FT                   DEIIRHAMSRETESIQAYRTIDGSSIQMKGRFSPTEGDGTLCVILSPPENHEDYIQKRD
FT                   VLLAGVAMSANQLLTVDGFERSLMNALEFLGSAADVDRVYVYQNTDSGDEAVLRFRWER
FT                   GSVHARLDERIRYDVLPRWRERFLNDRPVHGIVEEMPLQERELLKCRGARSVLIFPITI
FT                   ADRFWGFIGFEDCERERSWSWNEISILMLGVASIGGAIARSVAEECLRRSEERYRELVE
FT                   SANSIILRLDRRGNVRFINEFAQQFFGYSESEILGKCVMGTLVPEVESTGRDLRGMIAE
FT                   ILKAPEDYRTNVNENMKKSGERVWIAWTNKTVSSESGEMEILCVGNDITELRRAKERLE
FT                   SMNQWLLEIIEFLPDATLVVDADGRVMAWNRAMEEMTGIQKSEMLGKGDFAYALPFHGC
FT                   RRPMLIDLVMRYDEHIASLYENLERRGDTLYAYVYVPSLYSGRGAYLWVKASPLKDSDG
FT                   RIVGAIESMRDITESRIAEMELLRRDHLLAGSALAISSLLSGEDYESSINEAMQILGLI
FT                   SDVDRVYVFENHEEDELCLRFEWCRDGIRSWMDDQIFMGLSYSRFFPGWYEVLSSGKVI
FT                   KGLVRDLPPSVKEILEPYGVLSILIVPITVGGRFWGFVGFDDTTYEREWSDAEISILVA
FT                   SASTIGEAVAKKDSIERMRLLESAVVNSNDAIVIAAPDPSDGMPKIIYVNSAFTRMTGY
FT                   AREEVLGRYPDFLEGPETDRSKIMEILEAVRNAQPVNQELVNYRKDGSRFWVELNIFPV
FT                   RDHMGEVTHWVSIQRDTTERRVAEDRLRWSELLMRSMTESIPFGFYVLNRATGKSLYLN
FT                   HRFCELLGVEDLEEDLRCGRLDGSALFSRIGSMHPDAGDSLREIYNRTDEAEIEIRTAD
FT                   GRVIKVFATDIRDKSGKYFGRLGIFEDVTKDIKAAEELRKAKEAAEEAARSKAEFLANM
FT                   SHEIRTPLNAIIGMSGLLLRTNVTPEQRSYVSAIQSSGNALLEMLADILDLSRIEEGKL
FT                   ELDSSTFSILECVETCIDILSVKASEKQIELAYLIDEDVPELVLGDATRLRQVLVNLLE
FT                   NAIKFTERGEVFLRVICQYMDEDLSELHFFVRDTGIGIPPEKMDRLFHTFSQVDSSITR
FT                   RYGGTGLGLAISKHLVEMMGGRIWAESIPGAGSTFHFTIKARVSERSQERSDLLKGRRA
FT                   LLIYRNDTARSALKMLLLSHNIDVVDAPFHDESLLTGNFDFVIAEFADDSDIMKIKSAL
FT                   PDTRILLITDLQRQGISHDTSLIPKPVKHSQMISAMISALIGESIEVEPSQEVGRSDLR
FT                   ILVAEDNPVNLKVVLMMLSHLGYRADSARNGLEVLSALEHRDYDLVFMDVQMPDMDGLE
FT                   AARRIRDMKGYEGPRIVAITAYALEGDRDRCIAAGMDDYISKPVTMEKLKAAIENVESA
FT                   LDPSAISRLRELQEAGEPDVVAELGEIFLSNAPLRIASMYEALKRNDPYALHRAAHSMK
FT                   SASASIGALRLSRICAEIEELVREARLDGVDEMLSALDEEFERVRRELNRIVEL"
FT   gene            389194..390666
FT                   /locus_tag="Mthe_0385"
FT   CDS_pept        389194..390666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0385"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid a,c-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: mac:MA3250 cobyric acid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14178"
FT                   /db_xref="GOA:A0B654"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:A0B654"
FT                   /protein_id="ABK14178.1"
FT                   /translation="MTKYLIILGTTSHSGKSILVTALCRMLKNRGLRVAPFKSQNMSLN
FT                   SWVTTSGGEIGIAQAVQAWAAGVEPSVLMNPILLKPKGDRTSQVIIMGRPVADKSAADY
FT                   YKDIDSLKEVVDSAIEELSRDYDYIIVEGAGGAAEINLFDRDIANIYVASRLRAPIILV
FT                   GDIERGGVFASLYGTVKLLPPEIRELVKGMVINKFRGDPTILQPGIKMLEELTGIPVLG
FT                   ILPYLDLQIPSEDSVSLLDKTGPQKEQKEDLPEIAIIKLPRISNFTDFEPLERYARVRY
FT                   VDLKDDLGNPDAVIIPGTKNTVSDLAEMRRHGMDRKILSLKNVPIIGICGGYQILGREI
FT                   IDCGIEDICGSIPGLGLIDAVTRFDAYEKRTVQVTKEVTGDGPILGRIKGEYVKGYEIH
FT                   MGITESRERSAFGDDGAVAGDGMVIGTYLHGLFENENFRNAFLDYLYDQRGLMRRELSR
FT                   DTGFDALSEAVERHLDMKSILKMLELDVSASK"
FT   gene            390726..391874
FT                   /locus_tag="Mthe_0386"
FT   CDS_pept        390726..391874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0386"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: mac:MA4087
FT                   molybdenum cofactor biosynthesis protein MoeA2"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14179"
FT                   /db_xref="GOA:A0B655"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A0B655"
FT                   /protein_id="ABK14179.1"
FT                   /translation="MFRRLSSLSYALERLLDLCNPLEEREKIQIKDACGRVLASDVLSP
FT                   ENLPSFNRAAMDGYAVRSHETRGASQSSPVRITEYVRVRTGAALPEGFDAVVMLEDSFL
FT                   RGNVLEITAELTPYRNVSRIGEDVRSGDIVLSCEHRLRPPDLALLGAVGIDEVEVFKTP
FT                   RVAVIPTGDELVPRSCVPAPGEAREINSIMICSYVKLWGGEPQLSGVIPDERDAIKEAI
FT                   KRCTGSDLILVSGGTSVGDRDYAPGVLDEMGELMVHGIRLSPGRPTALGAINGTPIVCL
FT                   PGYPVAALASLYLLVRPAVKRLAHLSDDTQRREARLSRKIPSRPGYITFARVSLRDGIA
FT                   EPVMVSGAGILSSVARADGFVLVPEDLEGLDEGEKVEVHIFE"
FT   gene            complement(392283..392765)
FT                   /locus_tag="Mthe_0387"
FT   CDS_pept        complement(392283..392765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14180"
FT                   /db_xref="UniProtKB/TrEMBL:A0B656"
FT                   /protein_id="ABK14180.1"
FT                   /translation="MRILICRALLLIVVLSAMVLTTTSQENLQVAQGYNVDQYFRQKPL
FT                   YDVQAYFMQKPTYDIQQFVKTRDTYDVEMYFRQKPLYDVQAYFMQKPTYDIQQFVKTRD
FT                   TYDVEMYFRQKPLYDVQAYFMQKPTYDIQQFVKTRDTYDIKQYSTKPPYHTVPTSL"
FT   sig_peptide     complement(392664..392765)
FT                   /locus_tag="Mthe_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.957 at
FT                   residue 34"
FT   gene            393335..393715
FT                   /locus_tag="Mthe_0388"
FT   CDS_pept        393335..393715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14181"
FT                   /db_xref="InterPro:IPR017185"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B657"
FT                   /protein_id="ABK14181.1"
FT                   /translation="MKDYTVKVLDDRDLEFIEALRSLGVQRNVAALVTYLSNTKEVSSR
FT                   EIEMGTGLRQPEVSIGMRYLRQNGWIDERDVKGEGKGRPMKVYTLKVSIDDIIKHFEDQ
FT                   KLKESAKAMESIRKLRELTSAT"
FT   gene            393789..395315
FT                   /locus_tag="Mthe_0389"
FT   CDS_pept        393789..395315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0389"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   mbu:Mbur_0970 protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14182"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B658"
FT                   /protein_id="ABK14182.1"
FT                   /translation="MRGSVGVIVGETSPLQFKFMIHGAVGRGDYVKVRGDGRSWILAQV
FT                   EEIRRSNTAYSLAHMERGCTQTCREWVVADARVIGVPSDGRIRSPAMPPRPGEEVFAAD
FT                   EKMIAAALGLSKGDMYIGILKGHDLRVELDANTLVQKHCSVLAKTGSGKSYTAAVILEE
FT                   LLDKGVALLVIDTHGEYGSMRYPNRDGDFNRFRVKPKGYNITVYTPANLAINPRADRPF
FT                   RFDGLNLSARDIARMLPDDPTNGSVALLYEAIAALRSERESYDLEDIIKQVEKANSKSK
FT                   WTLIGQLEQLLEMGLFSGEPTRPEELLQRGHASVIDMTGVPQEMQPMIVAKLLTDLFEA
FT                   RKLGRVCPGMVVIEEAHNYIPERGTGRAASTSIIRTIAAEGRKFGMGLMIISQRPARVD
FT                   KNVLSQCNTQIIMRVTNPNDLKALSKGLEGMSTELEEEIKRLPPGTAMIVSNEIERPIV
FT                   VNIRPRRSKHGGVSTPIVMTDHPVKGPVPRREPQKGPGLFLRKVLGPRGA"
FT   gene            complement(395397..396164)
FT                   /locus_tag="Mthe_0390"
FT   CDS_pept        complement(395397..396164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14183"
FT                   /db_xref="UniProtKB/TrEMBL:A0B659"
FT                   /protein_id="ABK14183.1"
FT                   /translation="MFRSTLYLTVGFVILIGVASSYDFGSKVDNTSPDLGYPLVDFGGS
FT                   QVPIDIGYWDVGPNPQIFDEDDMVYLHFGSAVPTTINANDIRLTTRSDLGLNAGSKVRA
FT                   SDIDCGKPLLPLPAPPLTAGIYFMDLYGSSPGYDVNDLIYLKTLLPAGITATNDVRLSN
FT                   AVHYNGTVLSAGTKVLDFHADHNRLIIPMIIGFPIYPPVWQESIATIRFYNANGNTMNG
FT                   VPIYDYNDEVYIDVPFSPLSPGVVSVNDVHLTV"
FT   gene            396303..396764
FT                   /locus_tag="Mthe_0391"
FT   CDS_pept        396303..396764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afu:AF0059 A. fulgidus predicted coding region
FT                   AF0059"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14184"
FT                   /db_xref="UniProtKB/TrEMBL:A0B660"
FT                   /protein_id="ABK14184.1"
FT                   /translation="MRCLTYPYPIETLRHWYVTPVGGRSPELEPGELGLNREAIVENTD
FT                   LIPFEDRVLLSRLEGGSPRPLFARKYFRIVPLDRSKPDALSKSPLGEAILPASDNETGP
FT                   IKVGEMVVINSVLSRVHTHGLPSIIDRMIRSRSDVQMLDVIYTKERRQS"
FT   gene            complement(396880..397350)
FT                   /locus_tag="Mthe_0392"
FT   CDS_pept        complement(396880..397350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0392"
FT                   /product="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: mbu:Mbur_1771 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14185"
FT                   /db_xref="GOA:A0B661"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0B661"
FT                   /protein_id="ABK14185.1"
FT                   /translation="MERSSCGGDRRFRPVIRQFEIKDLPELMEIDREVGGGYSPELFMT
FT                   FHEYHPQTMLVAEIDGKVVGVAIGFKPTPFEGRVFWLAVRQAYQGHGIGRSLLSAILRI
FT                   FSRLGALSATLEVRIGNRRAQKLYASMGFVVDNVIPTYYSDGEAALIMRKVL"
FT   gene            complement(397367..397873)
FT                   /locus_tag="Mthe_0393"
FT   CDS_pept        complement(397367..397873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14186"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A0B662"
FT                   /protein_id="ABK14186.1"
FT                   /translation="MSGNRCYAVCLLSMICIMVLAEGSVVINEFELNPPSDQPYAVEWI
FT                   ELLNSGEEDVDIGGWQAVIISTVPGETGAQFPWSGKITVPLGTVLKAGEYRVLTGDQRW
FT                   DHGFNATVILYDQVGNEVDRTPMLMDDRDDGSDWSRYPDGIDTDRTSDWAYIPSTRGRP
FT                   NVLPY"
FT   sig_peptide     complement(397808..397873)
FT                   /locus_tag="Mthe_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.914) with cleavage site probability 0.536 at
FT                   residue 22"
FT   gene            397973..398941
FT                   /locus_tag="Mthe_0394"
FT   CDS_pept        397973..398941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0394"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mba:Mbar_A0756 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14187"
FT                   /db_xref="GOA:A0B663"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:A0B663"
FT                   /protein_id="ABK14187.1"
FT                   /translation="MDTATKAYLISVGTVELQGLTPQGPASTAGPSAGEGSVFFKSGDR
FT                   IVRLTVAPSRLRLVFEGEEHLILEGDRVVARGHLVEPLLHCPDQAYITVSERCIYDCRF
FT                   CAVPKLMGPTKSKEKVIEMVRRAAMTGRLKAISLTSGVEVSPEHEVERIAEIARALKTF
FT                   NVPIGISVCPTERSNEILRRAGAVEVKYNLETLDPDIFQTVCPGLSFEDIKNALADAVG
FT                   VFGINRVFTNVIVGLGESDRVLLQGIDELTEMGVMPVLRAVYPHPLRIADLEMRRPSAE
FT                   RILRLAEHLRRALDRNGLRGDLPLTMCYPCTGCDLIPHRDL"
FT   gene            399376..400803
FT                   /locus_tag="Mthe_0395"
FT   CDS_pept        399376..400803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0395"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: ecj:JW2636
FT                   succinate-semialdehyde dehydrogenase I, NADP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14188"
FT                   /db_xref="GOA:A0B664"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0B664"
FT                   /protein_id="ABK14188.1"
FT                   /translation="MYRSMMLINGERVEGASGRYDLIHNPANQEAVAEVAIGDVIDAVK
FT                   ALESAQRAFPGWSSIPATKRCTLLHDAAEIVRERADNIAKLLTMEMGKPIRDSRREVLS
FT                   AADSLDYFAEEGLRNIGEWISAGDTRSIVVRQPVGVVSLITPWNYPVELLAWKVGPALA
FT                   AGCTAVAKPSSLAPVAATEFVMAINDAGLPPGVMNIVHGSGDTIGAELVKNPIPRKISF
FT                   TGETSTGRWIMGTAAEYLKRISLELGGHAPMIVFDDADIDTAAGACVRRAFGNMGQVCI
FT                   SVNRVYVDESIAEDFTEKVIRRTLELRIGDPLDPDVDLGPMVSEAQRRKTREHIEDAVD
FT                   RGANILCGGREPEGFTRGYYFMPTVLTDVDHTMRIMREETFGPVAPIMRFRDEEEAVRL
FT                   ANDTEYGLAAYVYTNSLSRAVRTAERLEAGSVGVNVGSVIDRHAPFGGWKQSGIGRELS
FT                   HRGIEEYMEIKHIRLGL"
FT   gene            400816..402189
FT                   /locus_tag="Mthe_0396"
FT   CDS_pept        400816..402189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0396"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein,; KEGG: mac:MA2448 potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14189"
FT                   /db_xref="GOA:A0B665"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0B665"
FT                   /protein_id="ABK14189.1"
FT                   /translation="MVESIDARGAARAVFFTVVIVAVYSAIYMILMRYEGRSELAHPMN
FT                   AVYWVVMTITTVGYGDIVFSSSLGRLFSIVVSLSGIALVFAFVLPGIVTPWFEHLGREL
FT                   PERVPEWMSGHILICGYGPMVERLTERLDEMGIEFAIVESRESVARSIFKRYITVWGDP
FT                   SDVQVLRNANISTARMVMVNYTDEVNADVILTIREVSRVEIIAMVEDLRHSRFLSYAGA
FT                   SRVLSPKTMLGTFVAQISNPSCGECIFPGAVQLFGTLSLVEVPVLPGSPLSEREISDPL
FT                   LIQTGAAIAGLWKRGEFMPRPAGTERISTGSVVLAVGDSEQLMRLRSLGAGDEMEKRFL
FT                   VVGYGDVGQRLVRVLCEHGVVPVVVDRRDLATDRFEHVRGDGYSEDVLVRAGVKEATCI
FT                   MIMLNNDHDAIYATLVARNLNPDAFIIARANHLKTTEKLYRAGADYVASVPMVGARCS"
FT   gene            402180..402470
FT                   /locus_tag="Mthe_0397"
FT   CDS_pept        402180..402470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0397"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; KEGG: mac:MA3108
FT                   glutathione-regulated potassium-efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14190"
FT                   /db_xref="GOA:A0B666"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0B666"
FT                   /protein_id="ABK14190.1"
FT                   /translation="MLLNMITPESEDLTILYEGLELRRYEVRRRSHMARRTLRELALIE
FT                   RFGCAVVAINRAGDALLSLSGETEVLPGDVLILLGPPGSMDRFSRVFGDGG"
FT   gene            402471..403772
FT                   /locus_tag="Mthe_0398"
FT   CDS_pept        402471..403772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0398"
FT                   /product="Pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="PFAM: tRNA pseudouridine synthase D, TruD; KEGG:
FT                   mba:Mbar_A3206 putative tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14191"
FT                   /db_xref="GOA:A0B667"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:A0B667"
FT                   /protein_id="ABK14191.1"
FT                   /translation="MEGLIPAAERDKALGMEIYITRTPGIGGVIRKSPEDFVVEEIFDE
FT                   DHYEGGRYLVVEVEKRDWDTHKLVREIARALRISQRRISFAGTKDRRAVTRQRMAIMNL
FT                   DEDELIDLRIPDLKISVLGRTNRPLGLGDLKGNRFRIVIRDLAVDVDSARERMERITSE
FT                   ILEIGGVPNYFGVQRFGEIRPVTHLVGEAIVRGDLERAVFTYLSMPFDGEPEETRAARE
FT                   ELWESGDVRAALRRYPRHLTYELAMLNHLVSSPGDHAGALMVLPDNLRRMFVHAYQSYL
FT                   FNRMLSMRLRRCLTFEPVEGDIVCFSKDGMPDVSRIERVTAENIEAVKRLFDRKRAFVT
FT                   LPLIGYESELADGEQGEIERSILESEGISRESFSVKTCPDLSSPGARRPALLQVDPVFE
FT                   LGAESACIRFSLPPGSYATVVLREYMKDTRDVSE"
FT   gene            403931..405199
FT                   /locus_tag="Mthe_0399"
FT   CDS_pept        403931..405199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0399"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pca:Pcar_0783 membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14192"
FT                   /db_xref="GOA:A0B668"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0B668"
FT                   /protein_id="ABK14192.1"
FT                   /translation="MADPQNQRSGMNLTYSGRTRQKYLGNKGLIVLISLLSAFVPLSTD
FT                   LYLPALPGMADYFCVSSDLANLTLTMFFLSFGAGTLLWGPLSDRYGRRPMLLIGLSLYS
FT                   IASLACAFSTDIHLLIAFRALEGIGGSSGFAVATAMIKDVYDVRSREPILAVVQTMVLI
FT                   SPVSAPVIGAILLKFTTWRGLFEALAFIGLLALAGSIALQETLERRCSGSLLHSLGRLY
FT                   VVARNPAFASLLLLFSLPSICALAFIASSSYIYIRGFGLSELEYSYFFAFNAIGMISSP
FT                   TIYLKLSRRMCRRSFVTMCFGVMILSGTLILILGTWSPWIFAVALLPSTIAAGAVRTPG
FT                   TNLMLEQQREDTGSAAALMSCFGIIAGSIGMTLISMTRENMIPALGMMYMLIGTICAIL
FT                   WHYISKKPYVSHVPDRYATATGS"
FT   gene            complement(405488..406543)
FT                   /locus_tag="Mthe_0400"
FT   CDS_pept        complement(405488..406543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0400"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; KEGG: mma:MM0708 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14193"
FT                   /db_xref="GOA:A0B669"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:A0B669"
FT                   /protein_id="ABK14193.1"
FT                   /translation="MPRWIHPDFDFRPLRPLFMCIISNTHVGKIPGVSAAGVTPEFTFY
FT                   TPGADAELVEFNRIVTMPGLPETPGGCPTPGIITRAALSLTGVPALFVASGLDKKPAVP
FT                   YVELGGAAGGDIRYTPGVPEAPEILEKAALLGRKVSALSDCIFIGESIAGGTTTALAVL
FT                   RAIGYNGSVSSSFDSNPIELKSEIVRQALRRCDSEPGEFRDDIMRAIVEFGDPMIPCAL
FT                   GLLKGIGSTTRVVLSGGTQLAAVLLLAKRLGIEGDFSIATTKYVAEDPSASFRDIVEDS
FT                   GWNYYVVDPGLERSRIPVIQAFTRGFVKEGVGAGGAALLAGILGVTQERLVEETDRVLM
FT                   TVELPGCASKA"
FT   gene            407855..411496
FT                   /locus_tag="Mthe_0401"
FT   CDS_pept        407855..411496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2043 protein of unknown function
FT                   DUF11"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14194"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A0B670"
FT                   /protein_id="ABK14194.1"
FT                   /translation="MKGLGIVCSPTTRSCIRFSAWLSLGLLFVSLLPCTIPSACAWPFW
FT                   LPLPTSSSPELEMTVRTDFTDVAAGDVLDYTCILRNTGDRTLSNISVTDGTREIGFRDT
FT                   LPPGDVFSIRAKTPPILSPSRFKLTASSDGRELASQEFSIGVVEKEERSTPYPALRATV
FT                   ESSRIGGGSEHRIRIANTGKTELRRVKIVDRRNSVLGIIPALAPGESHTLVIGSVDVTG
FT                   LRVLALNEAGEHLAGDVRYTGSRPGSAIAAESSETTLRTMEYRPSSSLDLILETSTTRA
FT                   RAGENISYRCTVINSCSDVIYNVDLLCHEKRMTTQFILPKRSVCIEGNFTINSTTEIRA
FT                   NVSGSDRNGALVTNETSVLIWVVSPELNISASADPPKIISGGVTNITVKLENSGSDLLR
FT                   DIVVEDSFGHIGEIKELKPGEVSHVSRKRQITSSIDDIVMASARDSTGKEIYAFSQIAV
FT                   HVYRAGMNLSLDPSELFLYPGEETEVLCTVENTGEVSLRNVTLAGIRSARIGEIPPGTE
FT                   TRIAASISSDISKDVTITATGYGDGDQVVSDTAVLSMKVIRPNITLSVMPTRVVTPAGD
FT                   EFNVSCLVSNSGTDLLHDVQISESEIGTVASLGDLAPGEFRTVTPSISVNKNRTLRFTA
FT                   AGRDARGRIWSADASSEAVVVEAALNLKISVSPEAARFGDKVRISCTVENVGGVPLQEI
FT                   FVTSRVIGPMGSIDFLAPKQRKTVTMTIPLTMDISDTVTAEGLTPSRGHVLDREPLSIR
FT                   LLKGLEPRPSGKSQNSAPAASKAGVYVNDSSVKEIGANALNESESIASLAKTVTSNTTS
FT                   SFTDGAAGNSSSGNAVASENVSRAVKERASDVLSSDGHRESIPTSKDQSALSILRDVIR
FT                   YIQELITRKQIDVSRQNATGRDVSSESGNISLEAYDPSLNTTLGIESVRDIRVPVRILD
FT                   VTAIPPEPVAGAPVRVVAHIRGDSDVDTVVLEYGVADQSIARADMVNMKRTSQIKMLLE
FT                   SGSKSDGYWSCLIPGQSAGTILGISVRAECGQSSAEDGPYMLQWVSQAPSRRPSPLPET
FT                   KTKGDGMLYIESTTVSGRGEVSIRDTFMENSMSYEEDLKGSGSLDMESVRCMEKSNPTV
FT                   NFTEIKDISFDGGVLKGFKRFDSPVFHGGMGASITERFNMSQLDKSERGMIRSINYRNN
FT                   TVAFSTEQAFEGMWNTRTEYSKFSKKMKADQRLNGSFQIQKNIKFQD"
FT   sig_peptide     407855..407980
FT                   /locus_tag="Mthe_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.590 at
FT                   residue 42"
FT   gene            complement(411805..413256)
FT                   /locus_tag="Mthe_0402"
FT   CDS_pept        complement(411805..413256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0402"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="KEGG: mbu:Mbur_0537 thiamine pyrophosphate
FT                   enzyme-like TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14195"
FT                   /db_xref="GOA:A0B671"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0B671"
FT                   /protein_id="ABK14195.1"
FT                   /translation="MRGALEQIYKALRDVGVGYVAYVPGYPITDLAQSLGAEIAVNEKV
FT                   AFECALGASATGIRSLVIVKQLGMNILADPLVISATHTTGAGIVVLVGDDLGPRGSQIE
FT                   MDSRFYGPLTELPVLDPAAPGLYRAVTEAFRVSEEYFIPVILRVTSDVLEDASTEAVIR
FT                   EGVPASLQQTPRRFDRSIWDLTAKGRRQRHLAKVLPALSEVSEASVRVELRGDRGVIAA
FT                   GSVIPMAERVCEETGSSLLAPLYSYPLPWKTIERFLEMHRLVLVAEGPGTFIESHLKDV
FT                   RGRLTGHLPYGRVKANDLRTALSLIHISDLRGSIEMETAASRPARRSICEGCPFLPLYK
FT                   ALSRIDVPIAGDAGCTILSLRMGAVDMVYGLGSSIGVASGFREKGIAIVGDYALAHTGI
FT                   QGLINAIWSRKNVLVGVIWNRVAAMTGFQEVFDLEHVLKALMPEMRIVDMPAPEQEIEQ
FT                   ILKDELRSHGVSLVLFRGRCTDRST"
FT   gene            complement(413241..414152)
FT                   /locus_tag="Mthe_0403"
FT   CDS_pept        complement(413241..414152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0403"
FT                   /product="tRNA(Ile2) 2-agmatinylcytidine synthetase"
FT                   /note="KEGG: mac:MA1981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14196"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR017674"
FT                   /db_xref="UniProtKB/TrEMBL:A0B672"
FT                   /protein_id="ABK14196.1"
FT                   /translation="MVCDLDDPYVVAYKQIHAISSPSGDLVEILERSSCYGGSAWARYH
FT                   YSKGPLVVSSRNLGEWFRYFVRTGEVDLDLISSKRSAGISSVFVKGDEVEITYTGLGGG
FT                   GVGATFTRAKAGDVLRSRTTEAGGGRVATGTIVVPRRERLVIGVDNTDSKTTGATWSLV
FT                   HNISEKVDRYEARYISHSLVQLFPVPTKTQNCVSTAVEFACIPGRERGMIEDFRNLLER
FT                   YTVSDETGMVVCRSFDPSMLFEYAKRCRLDRVSYEDALNAAQSAGLEIVMDGQGLIGAV
FT                   AAVPYFGDPDRSVVPEWLCEEH"
FT   gene            complement(414487..414876)
FT                   /locus_tag="Mthe_0404"
FT   CDS_pept        complement(414487..414876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14197"
FT                   /db_xref="InterPro:IPR017185"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B673"
FT                   /protein_id="ABK14197.1"
FT                   /translation="MKESYVMKFDSRDMQVVEILRSLGVPRKVSNMLAYLANVEEATSR
FT                   DIERGSDLRQPEVSIALRTLRKHNWIEESVRRNDGTGRPVKVYRLKASIDEILKYYEEE
FT                   KLKEANRAMERIQKLRALLSQSESS"
FT   gene            415517..416362
FT                   /locus_tag="Mthe_0405"
FT   CDS_pept        415517..416362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0405"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   mth:MTH1727 phosphate transport system substrate-binding
FT                   protein; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14198"
FT                   /db_xref="GOA:A0B674"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0B674"
FT                   /protein_id="ABK14198.1"
FT                   /translation="MAVPKIVGIIPILILIVVLILLALPSDSVDRIRVSGSTTVMPLAE
FT                   LCAEEFNFMYREYMVTVTAGGSGVGIIDAAEGRADIAMSSREIKPSERALYERPDRKFK
FT                   EILVGYDAIIVVVSPQIYNSSVRSLTATEVKKIYSGEIRNWKSVGGPDREIMVVGRKAG
FT                   SGTRDTFNEIIMGSAAAETPGVSIEALDSSEVKTAILGSDRAIGYLGYSYVRTGGVVPL
FT                   ALDGVYPTMDNIRGGNYTLARKLYFYTFGEPTAGAKAFIDFVLGPEGRRIAETNGFIPP
FT                   "
FT   sig_peptide     415517..415603
FT                   /locus_tag="Mthe_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.913) with cleavage site probability 0.562 at
FT                   residue 29"
FT   gene            416488..417363
FT                   /locus_tag="Mthe_0406"
FT   CDS_pept        416488..417363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0406"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /note="KEGG: mhu:Mhun_1782 apurinic endonuclease (APN1);
FT                   TIGRFAM: apurinic endonuclease Apn1; PFAM: Xylose isomerase
FT                   domain protein TIM barrel; SMART: AP endonuclease, family
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14199"
FT                   /db_xref="GOA:A0B675"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0B675"
FT                   /protein_id="ABK14199.1"
FT                   /translation="MSVWSEGVILVRFGVHISIAGGIHLSVRRAIELGCDTYQIFTSNP
FT                   RGWHTKQLSDDVIEAFKSQLSRSGIWPVVGHMPYLPNLASPRESVYSRSVQALKDELMR
FT                   CSALGIPYLVTHMGSHLGSGRDSGISRIVGAIEAALPDSNGTKILLETTSGSKNSIGGR
FT                   FEDLADVLERVGSDLLGICLDTCHVFAAGYDLRDEKSLDATLRAFDSTAGLKDLMLIHL
FT                   NDSVGDLGSGLDRHEHIGMGKIGLNGFAAVINDYRLRELPMILETPVDKRRDDRGNLEV
FT                   VRGISRIVPS"
FT   gene            complement(417341..417769)
FT                   /locus_tag="Mthe_0407"
FT   CDS_pept        complement(417341..417769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0407"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rru:Rru_A1654 response regulator receiver domain protein
FT                   (CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14200"
FT                   /db_xref="GOA:A0B676"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0B676"
FT                   /protein_id="ABK14200.1"
FT                   /translation="MSSRSACIMGEDTRKLRILLVEDNPEDVFLTRKVLRKSGLDGDMQ
FT                   ITGDGAEALRILEDMLRAGEHLPDLILLDINLPDMGGMAVLKSIKGDARFSRIPVVMLT
FT                   CSNADSDIQKSYDLGASTYLVKPVSRDAMILVMRALFG"
FT   gene            complement(417819..418718)
FT                   /locus_tag="Mthe_0408"
FT   CDS_pept        complement(417819..418718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0408"
FT                   /product="Wyosine base formation"
FT                   /note="PFAM: Radical SAM domain protein; Wyosine base
FT                   formation; KEGG: mba:Mbar_A1006 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14201"
FT                   /db_xref="GOA:A0B677"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:A0B677"
FT                   /protein_id="ABK14201.1"
FT                   /translation="MDPAALERQGYHLVGEGAVKPCLWLKRSLRGREQCYKHHFYGIES
FT                   HRCVQMTPVLHCNHLCLHCWRPVDDSFPLPERWTEPEDLLDLVLREQRRILSGYWGSDV
FT                   VDRARLQDASTPKHVAISLMGEPTFYPHLRGLIKAINERGMTSFLVTNGTNPDVLKDVD
FT                   PTQLYISINAPDEDTYRRVSGGRDWNRILESLAMMRDLRCRTVVRITLIRGVNMFNPDA
FT                   YARLLDAEPDFVEVKAYMHLGRSRYRLSRDAMPSHEEVVSFASALAESMGYTLEDQVSL
FT                   SRVALLTRGNVQRKLDKL"
FT   gene            complement(418781..419992)
FT                   /locus_tag="Mthe_0409"
FT   CDS_pept        complement(418781..419992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0409"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic enzyme domain protein; malic enzyme,
FT                   NAD-binding; KEGG: chy:CHY_1369 NAD-dependent malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14202"
FT                   /db_xref="GOA:A0B678"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A0B678"
FT                   /protein_id="ABK14202.1"
FT                   /translation="MGKIAISSRVVLKDAEDLSLAYTPGVAEPSLAISRNPDDVYLYTS
FT                   KGNMVAVVTDGTAVLGLGDIGPLASIPVMEGKALLFKKFAGIDAFPIALSTKDPAEIVE
FT                   TVVRISPVFGGINLEDISAPRCFEIEEELKKRLDIPVFHDDQHGTAVVVVAALINALKL
FT                   VGKSFKDISIAVSGAGAAGVAVTKFLLDFGVRDIRVCDRKGIIHRGREDLSPIKRMLAE
FT                   LTNPEGITGTLRDAMRGADVFIGLSVGGIVSRDMVEGMGRDPVVFAMANPVPEIMPDEA
FT                   RKAGARVVATGRSDYPNQVNNALGFPGIFRGALDVRASDINERMKRAAAFAIASLVDPV
FT                   REDCIIPSPLDRRVVPAVAEAVAAAAIESGVARMPVDPSEVRAHAVAVLSKEWDELPED
FT                   HEIG"
FT   gene            420386..421324
FT                   /locus_tag="Mthe_0410"
FT   CDS_pept        420386..421324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0410"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   mbu:Mbur_1285 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14203"
FT                   /db_xref="GOA:A0B679"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:A0B679"
FT                   /protein_id="ABK14203.1"
FT                   /translation="MLDLLLRALETTIPVLVTVFLGLFLAGMLMELGVLDRLSVLSKPL
FT                   VSMANLPSISASSFLVSLGSAVAANSMIAEFKMRGAIDDRETVLCAMMNSIPVYIREIF
FT                   TYQIPVVVPLLGPVVGLFYAGVFIITAIVKVLMVIILGRLILRGRNGAEISWEAPRRNI
FT                   NSLDATLKILRTQIRPFARISITYMAMTLLVLSLNDHGFFDKLSVLPIAQTFGISPEAL
FT                   VPLTTYVASPLIGLSMLSPMIQSGSLTEIQAATVLMLGSMFMLPIFAMKSMVPNYTAIF
FT                   GPRVGLMIVAISTGLSVMVRAVFLLALLWIG"
FT   gene            complement(421373..422335)
FT                   /pseudo
FT                   /locus_tag="Mthe_0411"
FT   gene            complement(422343..423191)
FT                   /locus_tag="Mthe_0412"
FT   CDS_pept        complement(422343..423191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0412"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: mbu:Mbur_1877 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14204"
FT                   /db_xref="GOA:A0B680"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037514"
FT                   /db_xref="UniProtKB/TrEMBL:A0B680"
FT                   /protein_id="ABK14204.1"
FT                   /translation="MIIGGPSSQLLAGRVASILGERVALCEYRTFPDGEAYTQLQSEID
FT                   DDVVVIQSTPSDRDIVYLLQLLDIVRERNITLVIPYFGYARQDKIFKPGEPLTARAIAS
FT                   ALNPFLNDNSRVFTVNIHAPSVLTHFMCRAESLDATPHLAEEIRRLDLRDPVVISPDKG
FT                   AMAMASRASEILGCDFDHLEKTRHSGTEVSIAPKEIDVRGRDVVIMDDMIATGGTMATA
FT                   ISMLRRQGARSVHLAAVHPVLTGNALLKLYHAGVDRVTATDTLDRGVSTVSVAPLIAGS
FT                   I"
FT   gene            complement(423331..424683)
FT                   /locus_tag="Mthe_0413"
FT   CDS_pept        complement(423331..424683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0413"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   mbu:Mbur_0882 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14205"
FT                   /db_xref="GOA:A0B681"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0B681"
FT                   /protein_id="ABK14205.1"
FT                   /translation="MRAGARRISGTSDDLKISAERLLERALGLGADEAEVFGVWSRNLT
FT                   LELRRDRVESISASVLRGLGLRAIIKGGVGFSSTSDLSRIDDVAEAAVSAARIFGPDRL
FT                   WRGLPGKSRMPSVDGVFDRRIADVQTDTLLEISEELLGGCGAVGGVEPVSGGVSCTHSL
FT                   EILINSSGLDLSEEGTSIHLALETIARGSSGVATGSEFDNSRSFSVNARAVGEKAADLA
FT                   RRSLDGISIETDTYDVVLSPVAFAELLESTFIPSLSAENVQKGRSTLAGMLNKSVSDLR
FT                   LQVVDDGALPAGMGSSAFDGEGVPSQRNVLLEDGVLRSYLYDSYTAGKEGRSSTGNSVR
FT                   SGYSEMPRIGIRNLIISSKEPVEMLDGVREGVLVNSVIGAHTANPISGDFSVEARNSFR
FT                   IRAGEIAEPVRSAMIAGNIFDLLKHIDVGRDARAVGPIVTPGVRVRMRVVC"
FT   gene            complement(424643..425410)
FT                   /locus_tag="Mthe_0414"
FT   CDS_pept        complement(424643..425410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0414"
FT                   /product="protein of unknown function DUF75"
FT                   /note="PFAM: protein of unknown function DUF75; KEGG:
FT                   afu:AF0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14206"
FT                   /db_xref="InterPro:IPR004426"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:A0B682"
FT                   /protein_id="ABK14206.1"
FT                   /translation="MKKTFVRRLKDLSLESPILVEGLPGVGHVGKLVAEHLIEELKAEK
FT                   IIEIYSPHFPPQVLVQSDGTVRQVRNEIYAYKGADGEPDLLILVGDYQSATNEGHYELT
FT                   GIFLDIAEEFGVRRIYTLGGYGTGQFVEPQVIGATNRSELVEEMKSLGVVFHENEPGGG
FT                   IIGVSGLLVGLGGLRGIDAVCLMGTTSGYLVDPKSAHAVLKVLCKAIGIEVRTQALEER
FT                   AAEMERIVSKLQEMERAQVPYESGGEEDLRYIG"
FT   gene            complement(425407..425589)
FT                   /locus_tag="Mthe_0415"
FT   CDS_pept        complement(425407..425589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0415"
FT                   /product="Nucleolar RNA-binding protein Nop10p"
FT                   /note="PFAM: Nucleolar RNA-binding protein Nop10p; KEGG:
FT                   pab:PAB7213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14207"
FT                   /db_xref="GOA:A0B683"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:A0B683"
FT                   /protein_id="ABK14207.1"
FT                   /translation="MVRSKILRCERCRLYTLKETCPRCGSHTTGTKPARFSPEDRYGRY
FT                   RRALFSESGREEEKA"
FT   gene            complement(425592..426365)
FT                   /locus_tag="Mthe_0416"
FT   CDS_pept        complement(425592..426365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0416"
FT                   /product="translation initiation factor 2 subunit alpha
FT                   (aeIF-2a)"
FT                   /note="PFAM: RNA binding S1 domain protein; Eukaryotic
FT                   translation initiation factor 2, alpha subunit; KEGG:
FT                   mbu:Mbur_1396 translation initiation factor 2, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14208"
FT                   /db_xref="GOA:A0B684"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:A0B684"
FT                   /protein_id="ABK14208.1"
FT                   /translation="MQREGWPEPGDLVVCTVDQVLDFGAFVTLDEYVDKKGFIHISEVA
FT                   SGWIKYIRDHVREGQKIVCKVLNVDKSKHHIDLSLKDVNEHQRREKIQAWKADLKAWKW
FT                   LQMAYEGREDDLKRVKDALMKSYNSLYGALEETAISGEESLSDSGLTEEDIKIISRLAK
FT                   ENVKIPMVEISGYVDLRSFAPDGIEIIKKALKQAKRIRDKDATLEIKYVGAPRYRIKVI
FT                   APDYKHAEAALKKSAQAAIKYMEQHGGEGAFVREA"
FT   gene            complement(426371..426541)
FT                   /locus_tag="Mthe_0417"
FT   CDS_pept        complement(426371..426541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0417"
FT                   /product="SSU ribosomal protein S27E"
FT                   /note="PFAM: Ribosomal protein S27E; KEGG: mma:MM1808 SSU
FT                   ribosomal protein S27E"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14209"
FT                   /db_xref="GOA:A0B685"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023407"
FT                   /db_xref="UniProtKB/TrEMBL:A0B685"
FT                   /protein_id="ABK14209.1"
FT                   /translation="MSLSKFLRVKCNDCENVQVIFSRAATVVKCLVCGRTLAEPRGGKA
FT                   DIKTEILEVLE"
FT   gene            complement(426538..426819)
FT                   /locus_tag="Mthe_0418"
FT   CDS_pept        complement(426538..426819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0418"
FT                   /product="LSU ribosomal protein L44E"
FT                   /note="PFAM: Ribosomal protein L44E; KEGG: mma:MM1809 LSU
FT                   ribosomal protein L44E"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14210"
FT                   /db_xref="GOA:A0B686"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:A0B686"
FT                   /protein_id="ABK14210.1"
FT                   /translation="MKMPKEIEAHCPFCKKHTTHTVERVRRGQARSMTRIARQKARANG
FT                   TGNQGKFSKVPGGDKPTKRVNLRYRCSLCKKAHNRKGIRLGKFELVEG"
FT   gene            complement(426797..427393)
FT                   /locus_tag="Mthe_0419"
FT   CDS_pept        complement(426797..427393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14211"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniProtKB/TrEMBL:A0B687"
FT                   /protein_id="ABK14211.1"
FT                   /translation="MELDLANVLRGERQSAELQHLEGDFYRLAGRHIASLERDLEKLED
FT                   HFSVEAQIIEDELKSSRKSISKLMDLRIKKIAKKAMMQASSSTPGKPPDGMTEEEVVLY
FT                   KTILEALTRCREEILAHLSYTNTERPLTAKKDIAKEYIAVRLLETVPMFVGVDGKRYAL
FT                   RKDDVVMLPEIHARNLCSKKIAVEVRMNHEDAKGD"
FT   gene            complement(427436..428623)
FT                   /locus_tag="Mthe_0420"
FT   CDS_pept        complement(427436..428623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0420"
FT                   /product="DNA primase small subunit"
FT                   /EC_number="2.7.7.-"
FT                   /note="TIGRFAM: putative DNA primase, small subunit; PFAM:
FT                   DNA primase, small subunit; KEGG: mbu:Mbur_1392 DNA
FT                   primase, small subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14212"
FT                   /db_xref="GOA:A0B688"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="InterPro:IPR023639"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B688"
FT                   /protein_id="ABK14212.1"
FT                   /translation="MESKTSTYLRARFREYYLTASMDAPPGMEAREWGFIFYDTPGMRR
FT                   HRSFRSRKELVDYIRSTVPAHVYHSAAYYLKPDAPTMKEKIWKGADLIFDLDADHLAEY
FT                   RGSGIRDFREMLERVKGETMKLLEFLLSDFGFDERMISVAFSGGRGYHIHVRDKSVLKL
FT                   RSDARREIVDYLTGRGLDPERFIHKIGVDGDAGVERARSLRGPASDAPGWGGRINKAIE
FT                   SMVMHLRELDDEEALRLLKNVKGIGKQKARLFLSQIREENAIKSIRAGNLDFFKHASGI
FT                   WNLIIPYIMEETVRALGGETDEPVTADVHRLIRFPESLHGGTGLRVTSLSINSLHAFDP
FT                   LKDAVVFGDDPVHVEIIRPTTLELMGERFDLLEGKTELPEYAAVFLLARGFAEVG"
FT   gene            complement(428641..429378)
FT                   /locus_tag="Mthe_0421"
FT   CDS_pept        complement(428641..429378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0421"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: mbu:Mbur_0211 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14213"
FT                   /db_xref="GOA:A0B689"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0B689"
FT                   /protein_id="ABK14213.1"
FT                   /translation="MRAACVQLSVRECDVGDNKRRALQLSSDVADIGADIIVLPELFLT
FT                   GFCYDLKPESIPYPSLMSFRALSLDSGAILVGSIMASSDRGPINMGFCMAGAETGFYCK
FT                   THPFGDEKKHFIPGEIIAPVKVGGLSIGLEICYDIRFPEVARKLCASGADLLVTIAQFP
FT                   AERIHHWRALVTARAIENQIHHIACNASGSAGGSSMIVGPAGEVLAEAGVEECVITADL
FT                   DLDERDRVRRAITCWEDRRPELY"
FT   gene            429550..430449
FT                   /locus_tag="Mthe_0422"
FT   CDS_pept        429550..430449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0422"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_0813 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14214"
FT                   /db_xref="GOA:A0B690"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0B690"
FT                   /protein_id="ABK14214.1"
FT                   /translation="MEQYPTAIVADREVPFDPEQLRRIREHPCFSEKACHAFGRMHLPV
FT                   APKCNIQCKYCIRDFDCVNESRPGVTSRVLTPQEALERVDEVLSKYHYIKVVAVAGPGE
FT                   PLANEETFETLRLVGEKYPHLILCISTNGLLLPDRIEDLDRIGVTNITVTLNAVDPTIG
FT                   EQIYDYVIYKGERYEGLEAAKILLDNQLKGIEEAVRRKKIVKVNTVLIPGINDKHVFDI
FT                   ARKIKSMGVFIHNVMPLIPQYKFAHIKPPTPEEKRAIQDELSKIIKQMRHCRQCRSDAI
FT                   GRLGCDIQQELEKGKKKS"
FT   gene            431332..432945
FT                   /locus_tag="Mthe_0423"
FT   CDS_pept        431332..432945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14215"
FT                   /db_xref="UniProtKB/TrEMBL:A0B691"
FT                   /protein_id="ABK14215.1"
FT                   /translation="MRRLLCLTALVFAITSSCGIDVSIYFSQEGTPREPLDVGKSLVYI
FT                   VELSGAKNSMMYTVELTAGPDSSDTSISKSFTEKLNLNPGSTGILRFEVNFQSPDLRKG
FT                   DFGRWLSDKNDTSIWDRTWYKATVTSLDPFEKPVVREDYTGHPTLVKVFEEFRDASVTP
FT                   RKGTREDLYTYEVSVFSTAPDNITLEVAPSKNGPWTPVGTQDYTVPGSWKVLRWQNVSL
FT                   DFDFTSAYYRFVGRKEKTFDGPFWPVSVEFRNESLSPERGLPDTPFRYALEVNASKEIE
FT                   VSLNVWDVGSKSFVMVGRRTYRNVSSWERLEWDDVRVTATPEAYGSSQYYYGFHYVDAE
FT                   SPFATTKDMIGRYYAGPDVVVVWVKNTTVSPERGSAYTSYTYTAEIETTKPRCDLELQI
FT                   RPPESDIWVSRGMVTYTGSNSTLVWRNVTFDEVNEDQLGMAAYRFVLDDNVLGEFPGPE
FT                   FDASFRNVTYNRIGNTDRFNYKVSVRALRPIDVELLYTDDGINWINSGLIQNYSAPGNW
FT                   TDLSWNNQPWHQTVKFDVKR"
FT   sig_peptide     431332..431391
FT                   /locus_tag="Mthe_0423"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.801) with cleavage site probability 0.550 at
FT                   residue 20"
FT   gene            432951..434393
FT                   /locus_tag="Mthe_0424"
FT   CDS_pept        432951..434393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14216"
FT                   /db_xref="GOA:A0B692"
FT                   /db_xref="UniProtKB/TrEMBL:A0B692"
FT                   /protein_id="ABK14216.1"
FT                   /translation="MRYRLLALLLLMLVISAYAEGPTVSPPPPTPSEGGGGGSSHRQTD
FT                   MEKIIKALEQGKKQNPKRFEYLQTLLWKEYTPPGEYKLPAVLIYYKGNKTVCRSDPLEI
FT                   QAYVTNENALEIRRPLYIYLEMAEPGEDFRQVNSQTQIVQVNEYYTSDGINYTYRKFPE
FT                   ITDLRDLKKTGNVSFRIRYTDSLYDMYSSNWSISSPQLFPVLVLDVINNPPLVNYTNVT
FT                   YKPRYSDPIEYVAEISDPDGDTLNVTLHILEADNRTERMNVTQELVGGGTVRFKNSEYG
FT                   FFGKDDAGKAFRYYYTVGDGINVTSTNITWGPEIRPTPKLLVESPRMVAEDENYYWWSG
FT                   YNFSIDVKSQDENSFPLTVYLYTSTPSNPWKPRGSKTITVTPERQTVSFETSFDVSDCN
FT                   QTFAYRFSYSEPDQNGRTSIDLRVDKPINPRIVRYTILSPVGIANVILTLVICIFAGVI
FT                   VERVSNNGGRKKEIKGRQEEDR"
FT   sig_peptide     432951..433010
FT                   /locus_tag="Mthe_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.752 at
FT                   residue 20"
FT   gene            434390..434971
FT                   /locus_tag="Mthe_0425"
FT   CDS_pept        434390..434971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14217"
FT                   /db_xref="GOA:A0B693"
FT                   /db_xref="UniProtKB/TrEMBL:A0B693"
FT                   /protein_id="ABK14217.1"
FT                   /translation="MILTAMPLVLLLIGLVLHKMNFERIYRRLSELSDSVSKDKLYEVL
FT                   YIDHGANFSAMVFSSWVAFFIAFMYYLIPSTTPWLLRSGFPIATDYGLAFFAILVAVLA
FT                   SILLWAIRRLPVWLRLSEIHSIYPISRNEKNLCAATVLVLAFSAIFSIYNFVNYPFVNK
FT                   TLEAASWVLIIVAVILLFIPVVKEFVEAGR"
FT   gene            434968..436497
FT                   /locus_tag="Mthe_0426"
FT   CDS_pept        434968..436497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14218"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A0B694"
FT                   /protein_id="ABK14218.1"
FT                   /translation="MRSCCVGIGGCGGKMLEVFLKPLDIYLPFRDPEPVAFGKIKGVYI
FT                   EAYTPDAQKNKFFKPANVGYPGYVIPHASIPDDSKILSYVSHKYGFYLKKEGFHRKAEY
FT                   LKAIFEIFEIDETLKGIAKMENPILDATWDAIKRYTTLAESGECDNILFIVSLGGGTGT
FT                   GFINPIVNYIRSGGRREFPVFVLGILTEEGEDSRTGVSEEQRGLAAAISIYDLLTKNKD
FT                   EGVDALIPIDNQILIDKFGSNYTSINDYISRVMRPFLADRPFPQEEMDGQGLREEFLKN
FT                   LSKPPVMIPCYASLDSKKSSNPETELVSKALTGSVQNDECGPLFPCNPEMAERAFVFSR
FT                   GYISKDKLESSVQSITGLDRKDIFVWRKLGENRKSDVLVLLRNPYGSGYSGPFEKKMCR
FT                   IISLALDYISQKKQETLQVVEEGDDQALTSQSTDALSSYFNRLTSELKNAKSRLKEGKK
FT                   PFFLNELQIFERSSNNTHQQDNVIQNNHGPSEEMIRKIVQEELRKLLPAAT"
FT   gene            436631..437515
FT                   /locus_tag="Mthe_0427"
FT   CDS_pept        436631..437515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14219"
FT                   /db_xref="UniProtKB/TrEMBL:A0B695"
FT                   /protein_id="ABK14219.1"
FT                   /translation="MIRTAALGVMLILMLCVMDSASVLPVTGGNGELCCTVFDIFKGPL
FT                   YQGGSYDADRMILYIDAGLRWSNGSCAELSRVKYILIDGNDRSYSRDIASSRPVSPGRE
FT                   LLAFVVPREAIPKSLVVDSGIGEVFKVDLGEPLNYSDENITVTYYGIMGSRLDYNRKAL
FT                   DIDISVRNNSSNPMRISPENCTLVDQWGWGYRATDGFETRTLNANESIRGVVRFRYLAP
FT                   SSIPSLLLYNLSYGDGMIVISEGSCENTTEPSKEDSSGECNSCTVDESSVKGRVAAAKE
FT                   RLARVRAAHDTES"
FT   sig_peptide     436631..436726
FT                   /locus_tag="Mthe_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.920) with cleavage site probability 0.387 at
FT                   residue 32"
FT   gene            438256..439383
FT                   /locus_tag="Mthe_0428"
FT   CDS_pept        438256..439383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0428"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mac:MA3451
FT                   iron ABC transporter, solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14220"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0B696"
FT                   /protein_id="ABK14220.1"
FT                   /translation="MRRYGLIGVMLIVVFVLSSFIATASYPKTFTDTQGREITLEKPVE
FT                   RIITRSPDEARIIIALGAGDKLIASEQATKYCLCPMTFGDTSEGCVNCFETIIEGRMPD
FT                   LPEISTRYDIYFEKIAALNPDIIFCGSLKDAEAFEDKIGCPVVVLGGRGWNFSDEGYFN
FT                   SIEVAGKALDKEEEAKELIDFIKSKIDRVKSVTDEMDDSEKPKVYFASRGASAAFYDPK
FT                   EGRDFTRTEPEYDPLTVAGGINVASDIPGSTVNVGLEQIIAWNPDYIFIASSDPGNYTA
FT                   LNFIKNSPELQSVNAIKNGNVYYCFYPHCRGTPPDRNLLNMMYMAKILHPDKFRDLDLE
FT                   KEGNEIFRAFLGVDNVFTEYADYLVWPRDYLNSLK"
FT   sig_peptide     438256..438330
FT                   /locus_tag="Mthe_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.711 at
FT                   residue 25"
FT   gene            439394..440221
FT                   /locus_tag="Mthe_0429"
FT   CDS_pept        439394..440221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0429"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mhu:Mhun_2016 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14221"
FT                   /db_xref="GOA:A0B697"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0B697"
FT                   /protein_id="ABK14221.1"
FT                   /translation="MPGIINWDELWKAVHPGGFHHNGDPAAYWDKKAKAFNQRVMKHRE
FT                   WAEMQVASLKLQPHETVLDIGAGTGRLAIPMARMAKSVTALDRSGGMLKCLKANMQAEG
FT                   ISNITCIQRDWEEIGVDEIPPHDVVLSSNSLGVVDLRTALAKMDQLAKRAVYIFTFTDH
FT                   RRDGGFMEFLMPEHSRRSPSWPADYLIIYNLLADMGIHADISIHRFESSEYYANLDDAV
FT                   ASWKEMHDISDEKVPKLREFLSQKLIPTDQGLQMHRRSKIARISWQKDMQFEV"
FT   gene            440230..441015
FT                   /locus_tag="Mthe_0430"
FT   CDS_pept        440230..441015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0430"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: mma:MM2033 stomatin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14222"
FT                   /db_xref="GOA:A0B698"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0B698"
FT                   /protein_id="ABK14222.1"
FT                   /translation="MPIPVTLLAASVLFAVAFMVSARVVRQYERAVVFRLGKLHGEKGP
FT                   GILFLLPLIDRMIRVDMRVRELDVPKQTVISSDNVTLEVDAVIYYKVSDASKAIIEVED
FT                   YEAATLLLAQTTLRDVLGQNQLDTILSDRDDLNKKIQEILDTITGPWGMRVVMVTMRDV
FT                   ALPENMLRAIARQAEAEREKRARIILAEGELRASQMMNDAATMYEDKPSALKLREFQTL
FT                   AEIAREKNLIVVASGVNDDRKASETPLLMALAKAAADKI"
FT   sig_peptide     440230..440298
FT                   /locus_tag="Mthe_0430"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.958) with cleavage site probability 0.957 at
FT                   residue 23"
FT   gene            441012..442136
FT                   /locus_tag="Mthe_0431"
FT   CDS_pept        441012..442136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0431"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein;
FT                   inner-membrane translocator; KEGG: mac:MA3452 iron ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14223"
FT                   /db_xref="GOA:A0B699"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0B699"
FT                   /protein_id="ABK14223.1"
FT                   /translation="MNTRVFFRGNARKRAPIARRTGKKSGMQLAHEQFKLFRSIFVLAI
FT                   LLFLLLLTGFVITLGPLNISMYDAYSALLERFLPSYFQVDALTSRVVWNIRFPRIVGGL
FT                   MAGFGLGMCGCVMQAVLKNPLASPFTLGISAGAQFGISVAAVIGFAIFGGPYFIIGNAF
FT                   ICALLCSLLIVALAAIKGATSENLVLAGIAVNYFFTAMSQLLKYFASDEQLRIMTNWGM
FT                   GDLAAFSWANSRILLGIFLICFPLLISRSWDLNIMTAGDDAAKSIGVDAERTRIFIMVI
FT                   SSLLVATIVCFVGTIGFVGLVAPHMARMVIGGDHRFLIPASGALGSLVLVSADAVGMNA
FT                   IAPTIIPTGIMTSIIGVPFFMYLMLKGKRKEFWT"
FT   gene            442133..442921
FT                   /locus_tag="Mthe_0432"
FT   CDS_pept        442133..442921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0432"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mac:MA3453 iron ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14224"
FT                   /db_xref="GOA:A0B6A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A0"
FT                   /protein_id="ABK14224.1"
FT                   /translation="MMIKLQAKNLTFSYNSHPILNDLSFEIPPSNLVTIVGPNGSGKST
FT                   LIKCIDRILSPQKGSILIDRKELTRMNRREVARYLSYVPQSSVRVFPTNVFDTILMGRR
FT                   PHIGWLGSQDDERKVWDVLRLLDIEHLAMKNFDELSGGQQQKVLIARALVQEAEVMLLD
FT                   EPTSNLDIWHQIDVMNVIRDIVKSRDITAIMALHDLNLASAYSDRIIMMHKGRIVAVGD
FT                   PEFVITKENIASVYRVEAAVRNVSGKPIILPLRQIREKMY"
FT   gene            complement(443297..444394)
FT                   /locus_tag="Mthe_0433"
FT   CDS_pept        complement(443297..444394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0433"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: cte:CT0417
FT                   AslB/AtsB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14225"
FT                   /db_xref="GOA:A0B6A1"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A1"
FT                   /protein_id="ABK14225.1"
FT                   /translation="MPKQAGVTDQDAQIDIDASGTHPRTLILWVTTDCNLRCVYCYANG
FT                   GDNKAYMGWDVAKRAIDLVAEGADCFKVQLAGGEPLLNFGLIERIVFYIHDLGADASIQ
FT                   LQTNATLISPAIASRLRALGIGVGVSLDGVPAINDHLRPFADGHGSTHSVINGIRNLRD
FT                   AGISVGMTSVLSSTSVKGLSSLVDLASYLGNVAGISLDPLRPLGRGSCDMMPSPHLTAE
FT                   HLYKAIKRSEYLAGSGGNPVRFREVERMRCLLKTGGVRRYRCYFDAYQSLMVCPNGDAY
FT                   PCASLHHPDFRLGNILEPRFWDTISERLRDARRSIKTPHKCMTCSELWLCGGPCPAGVF
FT                   SRAGGAEIECAVKRVFVKYVTGSLH"
FT   gene            complement(444401..448135)
FT                   /locus_tag="Mthe_0434"
FT   CDS_pept        complement(444401..448135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0434"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: cte:CT0418 cobalamin biosynthesis protein
FT                   CobN; TIGRFAM: cobaltochelatase, CobN subunit; PFAM:
FT                   CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14226"
FT                   /db_xref="GOA:A0B6A2"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A2"
FT                   /protein_id="ABK14226.1"
FT                   /translation="MEKVRIAYITTQQSKDVVPLVTAFREILDKEGEIAELQLRSGDDL
FT                   SDLKQIEELTNFAISSHIIIFSLMGGKKSLPCFDELIKRLSEKGVPIFAQSGSAEHDLE
FT                   LREVSTVTEDVYETVSEYISYGGRENFRNLVLYLANRFAGAKYAFRDPEKSVWEGIYHP
FT                   EFDHVPSLEEYMQKRCREDRLTVGIWFYHSFWQSGNTAFVDEMIREVERAGANVIPVFM
FT                   YSLKDEDLGTRGAEWVIENYFMQNGRPIIDVLINPLMFSISMRSCTEGSSIFSRLRVPI
FT                   IKAIITYNSLKDWQESQCGLTPMDITLSVAMPEFDGDLITVPVAAKERTERDPLTGVTV
FT                   TRLEPIPERVRKLVQLSLNWARLRHKPNDEKRVAIILHNYPPRDDRIGTAFGLDIPASV
FT                   LNIMRVLKAAGYRIYEIPESGDALIRDIKKHLTNDNRLRSPEEMKSRAVASVSRERYMK
FT                   WFDELPINIRRRMVKSWGNPPGELFVHRGGILIPGIINGNIFIGLQPPRGFLENAAAIY
FT                   HSPDLPIPHHYYAYYRWIRDIFRADLIMHIGKHGSLEWLPGKSVGLSDSCFPDIAISDL
FT                   PNIYPYIINNPGEGTQAKRRSYCCIIDHLVPVMHRANLYDHLAELEVMLRDYHHAASED
FT                   PGKLESMKRIVWEKVVQARLDRDLGIDENTALSDFDQLLVRLHDYLNEIADTQIRDGLH
FT                   VLGVPPKDTRLDEFLVSLTRLQNGEVPSLRETLALIMGYDYSSLMAGRGRYFGMKTGGE
FT                   LLEDIDELSLHLVAKLRENGFDPESIPKVEDEILGRRDARLELVLNYIIKLSQKITSTE
FT                   DELNNLLAASEGCYVPSGPSGAPTRGMADILPTGRNFYSVDPQAIPTPAAWNVGVANAD
FT                   ALLRRYIREEGRYPEAIGMVIWGSSTMRTKGDDIAEALYLIGVRPIWDRRNGRVQGLEV
FT                   IPLEELKRPRIDVLIRISGLFRDAFPNIVHLIDEAVEMVASLDEPHDMNYLARHVAEDV
FT                   NEKLDDGIDPKLARIEASYRIFGCRPGAYGAGVCEAVDSKNWRDLKDLAEIYVTWGGYA
FT                   YTRQEYGTIVPESFKKCLCRLELTVKNEDTREYDMLDSDDFYSYHGGMIAAVRAFRGDR
FT                   PRSYCGDSSDPERVKVRSISEETMHIFRARILNPKWIESMKRHGYKGAGDLSRTVDVVF
FT                   GWDATSEVIEEWMYEELANRYALDKDMQEWLKEVNPHALQNIVERLLEAIERGMWRATE
FT                   SMREKLRSIYLDVEGTLEE"
FT   gene            complement(448202..449290)
FT                   /locus_tag="Mthe_0435"
FT   CDS_pept        complement(448202..449290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0435"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mhu:Mhun_0286 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14227"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A3"
FT                   /protein_id="ABK14227.1"
FT                   /translation="MKLKSVLQVALLACILVSTAHADEGYPRTIIDSAGREVEIKMPVE
FT                   RIIVQNGGAARALMALDAADKVVGVADFIPKNPELYPLLTDKQVVGTWKSFDYELVGEI
FT                   AKRGDTITPDIIVLCYYYKGMSFSIDSFEKGFAPFENITLIALDFTNPENLTDSLYKLG
FT                   VILGKEEKAREINEWRQKQIELVKSAVEGQPMPRVYIESGASKGLGELTAFGPESGMGT
FT                   LVKIAGGDNIAGSLGEVFPKVSWEWVVSQNPDVILVWYSADSVGWEPSPSEDTVELERK
FT                   LNEVLDRPGGASISAVNAERVFLCHSMMLSGLENVVGLAYIAKLLHPDADLDPHEIWEE
FT                   YQRITGLDYPDDRIFVYPEVPK"
FT   sig_peptide     complement(449222..449290)
FT                   /locus_tag="Mthe_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            450381..450548
FT                   /locus_tag="Mthe_0436"
FT   CDS_pept        450381..450548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0436"
FT                   /product="putative transcriptional regulator, CopG/Arc/MetJ
FT                   family"
FT                   /note="KEGG: mba:Mbar_A1024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14228"
FT                   /db_xref="GOA:A0B6A4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A4"
FT                   /protein_id="ABK14228.1"
FT                   /translation="MPKVTVEIPQHIIDDVNRHVGNGKKFVSFSDAVRTALRKMLDQLD
FT                   EIDRMRGRLE"
FT   gene            450545..450907
FT                   /locus_tag="Mthe_0437"
FT   CDS_pept        450545..450907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0437"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: mma:MM0756
FT                   6-pyruvoyltetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14229"
FT                   /db_xref="GOA:A0B6A5"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A5"
FT                   /protein_id="ABK14229.1"
FT                   /translation="MRMGLSMEFDAAHHLPMHDGKCSRIHGHTYRVEVVLQGDPGDDGM
FT                   IIDFYMLKKIVGRVIQELDHNNLNTVLQNPTAEMIASHIHRRLHEELKMTGLSDKATLL
FT                   SVRLWEGRDKWVMVDG"
FT   gene            450900..451574
FT                   /locus_tag="Mthe_0438"
FT   CDS_pept        450900..451574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0438"
FT                   /product="preQ(0) biosynthesis protein QueC"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: mmp:MMP0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14230"
FT                   /db_xref="GOA:A0B6A6"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6A6"
FT                   /protein_id="ABK14230.1"
FT                   /translation="MGRAVCLCSGGLDSTVAATIARRSGMDVYLIHVSYGQQAERREIE
FT                   AIERIADAIGASDLMCSRIDLFRNISALTTQGARIPRGEEVSLDSESTPPTWVYCRNTV
FT                   LLSMAAAYAEYLGAHSIYVGFNAEEAMSYPDNRPEFVEQFNALLEKAVASFSRPPKVVA
FT                   PLVDMRKKDIVRLGADIKAPLELTWSCYLNGEIHCGTCESCQHRRRGFVEAGIPDPTEY
FT                   QH"
FT   gene            451579..452316
FT                   /pseudo
FT                   /locus_tag="Mthe_0439"
FT   gene            complement(452426..452800)
FT                   /locus_tag="Mthe_0440"
FT   CDS_pept        complement(452426..452800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14231"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A7"
FT                   /protein_id="ABK14231.1"
FT                   /translation="MESGKKDLEGLYDLAIPPGIPVSVIRELVEKFEVDLVKRRARVDV
FT                   IGEVDEREILVLRGDLDTIKQAEKYMFEALDRKLEEWKRDERGEKYRKMYKPLSKEERE
FT                   KKAAEDVGGSALDSSTGMMR"
FT   gene            complement(452993..456571)
FT                   /locus_tag="Mthe_0441"
FT   CDS_pept        complement(452993..456571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0441"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: CobN/magnesium chelatase; KEGG: mhu:Mhun_0292
FT                   CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14232"
FT                   /db_xref="GOA:A0B6A8"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A8"
FT                   /protein_id="ABK14232.1"
FT                   /translation="MRVRALTWASDKALLVQAGAELGIDLRVWSVQELFDSETLEECRR
FT                   SLNEADVILVHPTHDGRFDELLETDKPVIAFGFDPALWSFSRNVSQKVVAAVNAYVVYG
FT                   GLENIKNMLLYIGREVLGLDLPCREPQETLWQGIYHPDSRKAFSTIEEYLEWRPFRHEH
FT                   TVGILFFRTYWANGDLEIVDRLIRSLEREFNVIAAFGLGSVGSKQTDAKPIDQVVRDFL
FT                   SGRVDLIINLQSVFHAGSVEVSLRSLEEIDVPVLHPLTLYHKTEEEWREDIKGMDPGEI
FT                   GWSVALPEFEGLIENIPIGVAYRKEMWGDEVEVHHPIEERIEKLVRRIRAWIRLRSKPR
FT                   SERRIAFILHNSPCASVEATVGAAAHLDSLESVARIMSRLAELGYTLDSFPGNGKELIE
FT                   DILNHKAISEFRWTTVQEIVSRGGALALVDQEKYSEWFNELTEESRSKICSAWGMPPGE
FT                   PREGAPAPMVYQGKIVVTGRRYGNVVVCVQPKRGCAGARCDGQACRILHDPEIPPPHQY
FT                   LATYRYLQKDFGADIIIHVGTHGNLEFLPGKSVALSQNCLPDIAIGDTPHLYIYNSDNP
FT                   PEGTVAKRRSCAVIVDHMQTVMTTAGLYGELKELDDRIAEYRKAEDHGRKHALKHIILE
FT                   LLERSNLAGELGAGHDHDNFEEILERAHAKLSEIYSSYIPDGMHIFGEVPEGEKRVEMI
FT                   SAIAKPLVNSSADLKDAVRAVLSGGDADPEIGELVLDISRRMDESDEMGSLMHAIDGGF
FT                   VRPGPSGLITRGKPEVLPTGRNMYSLDPGNVPTQAAALIGKQLAEKLLERYRSEHKRWP
FT                   ENVAMYWMASDIMWSDGEQLAQMFYLLGVEPVWRGGRVSGYRIMPLEDLKRPRIDLTVR
FT                   VSGITRDCFMGCIELLDSAIQDVASLDEPPEMNYVRKHMIESGDGRALRIFASPPGTYG
FT                   SGVNLAVYASAWKDEKDLTDVFMQWNSYAYGKDIFGDPAPGALKKMLSSVDVAFNKTVT
FT                   DEYDLLGCCCYFGTYGGLTNAAESLSGHKISTYYGDTRDSERIEIRTLADEIRRVVRTK
FT                   LLNPKWIEGIKRHGYKGAGDISKRVGRVYGWEATTREVDDWIFDDIARTFVLDEDMRRF
FT                   FEDSNPWALEEIGRRLLEAHQRGLWDADPEVLDSLRSAYLEIEGWIEEKVGDGGFQGGS
FT                   IDVMTMKDIAEWREKASKILREAGIE"
FT   gene            complement(456562..457347)
FT                   /locus_tag="Mthe_0442"
FT   CDS_pept        complement(456562..457347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0442"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_0187 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14233"
FT                   /db_xref="GOA:A0B6A9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6A9"
FT                   /protein_id="ABK14233.1"
FT                   /translation="MVKITIQNVSFSYGSNLILNDLNLVVGDSEILGLVGPNGSGKTTL
FT                   IKCIDRILKPRGSILLDGRDLSSMEGSEIAREIGYVPQSGSSAMGTTVFETILMGRRPH
FT                   ISWRVSDRDLEIVTEVIELLHLEDLAMRDFGQLSGGQKQKVLIARALAQEPSVLLLDEP
FT                   TSNLDMKHQLEVMEIIREMVQRKSISAVMAVHDLNLAARFVDKLAVLKNGRIWAAGDAS
FT                   SLLTPDIIREVYSVEAVVMQLERPFVIPIRSLNGGMACE"
FT   gene            complement(457341..458408)
FT                   /locus_tag="Mthe_0443"
FT   CDS_pept        complement(457341..458408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0443"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   mac:MA1847 iron(III) ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14234"
FT                   /db_xref="GOA:A0B6B0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B0"
FT                   /protein_id="ABK14234.1"
FT                   /translation="MDCMESRIALKEEYTRFVGRKLLFMAALSLSIVIIAGISATLGSA
FT                   NLSVFEVYSAILARAFPGYFETTWFADTIVWGLRLHRILMGVVAGAGLGVAGAAMQGIL
FT                   KNPLASPFTLGISSAASFGAALAIILGAGFAGGEYLIIGNAFVFTLLATFAVYGLAKYK
FT                   GITPETMILAGIAIMYFFSAMTSFLQYVGRAEQVQEVVFWMMGSLGRSSWDKVYASALM
FT                   IIICLPYLILKSWDINAIGAGDETAKSLGVNVERIRVLSMIFASLITASVICFTGTIGF
FT                   IGLVAPHMTRMVIGGDHRFLIPGSALMGSVILLAADTLARTVLAPVILPVGIMTSFLGV
FT                   PFFVYLFMKRRKEFW"
FT   sig_peptide     complement(458271..458408)
FT                   /locus_tag="Mthe_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.733) with cleavage site probability 0.527 at
FT                   residue 46"
FT   gene            complement(458428..459498)
FT                   /locus_tag="Mthe_0444"
FT   CDS_pept        complement(458428..459498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0444"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mac:MA3922
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14235"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B1"
FT                   /protein_id="ABK14235.1"
FT                   /translation="MIKWLTYSVLLLLIATSCCAAAEYPMTITDSAGREVTIQMPVERI
FT                   IVLNSDAAEAVTILGAADKIVGISDSVKNKAYYFPALKNRQSVGKWNEPDYEMIGEIAR
FT                   SGDEIVPNIIVISYTYPDKPYGIVEVAKRLEPFTGITAIGLDFYKPENMTREIELLGRI
FT                   LGKEAEAQRFIEWYEEKQADVENAVANRNVPKVYVEWTSKGGELTTMGTGSGAAQLVSM
FT                   ARGYSVANDLKDAYPKIGWEWVISKNPDVIIKRSTSTQLGWEKPPSLDSTNLENTLNEV
FT                   LSRSGAAAVNAVKNDRVYIVNWEIMAGLDDVVGLTYLAKILHPDVNLDPESVYREYLQF
FT                   LGVDYPEDRIFVYPEV"
FT   sig_peptide     complement(459430..459498)
FT                   /locus_tag="Mthe_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.581 at
FT                   residue 23"
FT   gene            complement(459620..460606)
FT                   /locus_tag="Mthe_0445"
FT   CDS_pept        complement(459620..460606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14236"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B2"
FT                   /protein_id="ABK14236.1"
FT                   /translation="MRSLKKNVLMASLVVILVVGSSYAGPWDLNPGKEALKHTHHSEGD
FT                   VTGEGFVMVYQNINTNNLSAVEYMHGSGSFDVADIIDSAQKTTHGSYYYYQSLSTGKIV
FT                   PEWKQQWTGANSEIKLTRQSDMTQSPMTFAYGTGWYASHPITYNSLLKDRTVAKSYQEG
FT                   SMMLHQLEYARGFVGDVAVELNCTGPTETKNGYGLASMNLEDKVIQGTVHVAELLTNPQ
FT                   TYKSDGKKLSKSSKVLGVKGALIEIDENYIGNFDIQRNMKLEVTKSKAVTMDDWLPCCM
FT                   GGFFDVPDYSKANKGQIGIFDCTCRETSLSTFKPAWNGTTAQFTTGK"
FT   sig_peptide     complement(460532..460606)
FT                   /locus_tag="Mthe_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.950 at
FT                   residue 25"
FT   gene            complement(461220..462020)
FT                   /locus_tag="Mthe_0446"
FT   CDS_pept        complement(461220..462020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0446"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mac:MA4606 iron(III) ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14237"
FT                   /db_xref="GOA:A0B6B3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B3"
FT                   /protein_id="ABK14237.1"
FT                   /translation="MISGKGILIDGVSLSYNGRAVLNNICMEIERGRVITLLGPNGCGK
FT                   TTLLKIINGLLPPTSGRVYVDCRDTRSMKPGEMARRMGHVPQAQRSTFPFTVLDVVLTG
FT                   RFSYISPLSKPGERDVEKAYRALEMVGALHIADRPYNHVSGGERQLAMIARALAQEPSF
FT                   LLLDEPTSYLDFRNQIRILKTVRGFAESGLMTVVMSLHDPNHALMFSDRVVLLQKIDCE
FT                   SSDMNNIVAMGEPVSVMTPENIRKAYGIDVEMLEIKGRRLLFPL"
FT   gene            complement(462017..463039)
FT                   /locus_tag="Mthe_0447"
FT   CDS_pept        complement(462017..463039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0447"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: mac:MA4605 iron(III) ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14238"
FT                   /db_xref="GOA:A0B6B4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B4"
FT                   /protein_id="ABK14238.1"
FT                   /translation="MTVGSLMPYKKYLYIFLILSPLIVMVLSLFIGKFTISPDDIIQLV
FT                   IFNLMGAETPHPSVYKTVVFEVRLPRILLGMLVGASLSVAGAAFQGIFRNPLVSPYILG
FT                   LSSGAAFGAALSLAVAPQFPVQLSALFFSLLAVGFAYYIATSRGSTPVISLLLSGVIVS
FT                   AVFDSLLSIIQMAVNERALQSIVYWLMGSLATASWSKIHSTLPLALAGCAVIFLLRWRL
FT                   NVLAMGDEEARSVGMNPELYKAVFVVAASLAASSVVSVVGIIGFVGLVIPHMMRMIFGP
FT                   DHTHLIPLCITFGAAFMVLVDDIARAGMGFEVPVGVITTLIGAPFFAYLLRSTRSGGWE
FT                   "
FT   gene            complement(463036..464073)
FT                   /locus_tag="Mthe_0448"
FT   CDS_pept        complement(463036..464073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0448"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mac:MA4604
FT                   iron(III) ABC transporter, solute-binding protein HemV2"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14239"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B5"
FT                   /protein_id="ABK14239.1"
FT                   /translation="MHKISVVAAFVCFVLAVSAGCCGEVTIKDDLGRDVTINSPSERVV
FT                   FMMENALKTYYAVGDPENIVALKDDRWMRKLLDDIFPVIDPDFEKKLTVSVSGDRVDLE
FT                   SLARANPDLVVLWATTPDDANLKAIEETLGVPVFAIFVRSVDDVLHQVDTMGTISDRME
FT                   RAAEVKEIMHDYMNTTTNVTSNIPESERPKVYWMWTDVLGTAGVNSGINDLIELAGGVN
FT                   VMKFAENETAMTMEHPVVNLETLIKLNPDVIYMWYNENLDPEDILTGDDFNGWKDINAV
FT                   KNGRVYEIRNPYLFDAFSPRMPLALLHVAVDLHPDRFKDVDMDKIIDDFHVDMWGVHYP
FT                   SMEKA"
FT   sig_peptide     complement(464017..464073)
FT                   /locus_tag="Mthe_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.762) with cleavage site probability 0.476 at
FT                   residue 19"
FT   gene            464390..466399
FT                   /locus_tag="Mthe_0449"
FT   CDS_pept        464390..466399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0449"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: mhu:Mhun_0291 magnesium chelatase, ChlI
FT                   subunit; PFAM: magnesium chelatase, ChlI subunit; von
FT                   Willebrand factor, type A; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14240"
FT                   /db_xref="GOA:A0B6B6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012804"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B6"
FT                   /protein_id="ABK14240.1"
FT                   /translation="MHHLKRRTIPFTSIVGQDLMKLALVLNAINPRIGGVLIRGDKGTA
FT                   KSTAVRALADLLDEIPVVDGCPFNCNPFSEDEMCDICYQKSQNGDLQVLMRRMPVVDLP
FT                   LGATEDRVVGSLDVERAIKEGIKALEPGILAAANRGILYIDEVNLLDDHVADVLLDAAA
FT                   MGVNIVEREGVSVAHPSRFMLVGTMNPEEGEIRPQLLDRFGLQVNVEVISDVDLRVEIA
FT                   KRAERFESDPEAFISEWSDEQNLLRERIRRAKQMLPGVVMDDSLLRLIARTCIEMGVRT
FT                   HRAEIVTARTARTIAAFEGRNDVTEEDVRRAMILALPHRMRSKPFEPPSMAQEKLEQAM
FT                   AKHQEQKHQHKHQHEHHEERRPQEESSDAPSEQSESTPEESVFGIGSPIDVKQLRDTLR
FT                   RDRVLRRMPRGRRVSSLSMRRSGRYLRSKLPVDGRDIAFDATIRAAAPHQHMRERRFAV
FT                   TILPQDIREKERVRKTSATVLFVVDASGSMGAMRRMESAKGAVLSLLMDSYQKRDRIGM
FT                   VAFRGNDADLLLPPCSSVDLAMKRLAELPTGGRTPLSAGLSKALRVIQGELIKNKETRP
FT                   MIVLVSDGRANVSISSDPKKEIVQIAEEARRLGVHTVVIDTEVVGSSFMEMRLGYCRDI
FT                   AEAAGGRYYPISDITPESLSRIVEQEHMGLFHGS"
FT   gene            466506..467420
FT                   /locus_tag="Mthe_0450"
FT   CDS_pept        466506..467420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0450"
FT                   /product="dihydroorotate oxidase B, catalytic subunit"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate dehydrogenase; KEGG:
FT                   mba:Mbar_A1466 dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14241"
FT                   /db_xref="GOA:A0B6B7"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B7"
FT                   /protein_id="ABK14241.1"
FT                   /translation="MSSLSGDVGGLRLENPLILAAGILGTTGASMRRVALAGAGAVVTK
FT                   SVGLEPRNGHPGPTVVRLGVGLINAMGLPNPSYRAFQDEIDIAREGGVPVVASIFGSCP
FT                   EEFAEIASALDVDGFELNLSCPHAGGYGMEIGCDPANVEEITRAVRRAVNVPVWVKLTP
FT                   NVTDIRVLGIAAQRGGANAVVAINTLKAMAIDVESGYPILGNVIGGLSGPAIKPVALRC
FT                   VYELSGVLEIPVIGVGGVSCWQDAVEMIMAGAAGVQIGTALMGGLEVIRDITSGIIRFL
FT                   DRKGWSLEEIRGIARRRGSTPSS"
FT   gene            467441..468214
FT                   /locus_tag="Mthe_0451"
FT   CDS_pept        467441..468214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0451"
FT                   /product="dihydroorotate oxidase B, electron transfer
FT                   subunit"
FT                   /EC_number="1.3.98.1"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   mbu:Mbur_1224 oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14242"
FT                   /db_xref="GOA:A0B6B8"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B8"
FT                   /protein_id="ABK14242.1"
FT                   /translation="MRFRPANLVIKDVMRETASVSTIRFDRPLDPIPGQYIMVWVRGVD
FT                   EIPMSFSAPDSITVHAVGEATRALCDLRPGDSVGIRGPFGNGFRLVGERILLIGGGVGV
FT                   APLAFLGEDVKKRGIDVTSLIGFRCREDIIFLDRFRRLGDVILTTDDGSAGIEGRASAG
FT                   LSEIDPEDYSQIYLCGPEMMMIDIIRRCREHASRIQASINRYFKCAVGICGSCCLDPDG
FT                   IRVCVEGPVITGDRLLESEFGRYRRGPSGMRESCY"
FT   gene            468225..468947
FT                   /locus_tag="Mthe_0452"
FT   CDS_pept        468225..468947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0452"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   mac:MA0585 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14243"
FT                   /db_xref="GOA:A0B6B9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6B9"
FT                   /protein_id="ABK14243.1"
FT                   /translation="MIARFRYGDRVFDGDVDGDRIVSDGVSYELEEVKLLPPSVPTKVV
FT                   CVGLNYLEHARELRMDLPDEPIIFLKPPSAVVGHDDEIILPEMSRRVDYEGELAVVISR
FT                   RCRRISADEADDYILGYTCFNDVTARDLQQKDGQWTRSKSFDTFAPVGPWVAQMSVEDA
FT                   EDLSISTRVNGETRQRSNTSDLIFGVAELVEFVSSIMTLEPGDVIATGTPPGVGRLESG
FT                   DIVEVEIEGIGLLRNRAV"
FT   gene            469167..470111
FT                   /locus_tag="Mthe_0453"
FT   CDS_pept        469167..470111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0453"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: mpa:MAP0645c
FT                   thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14244"
FT                   /db_xref="GOA:A0B6C0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6C0"
FT                   /protein_id="ABK14244.1"
FT                   /translation="MRLITSVLILLLLPALFGALAGTEDGSFCPTCPDWTNLDGWYRQK
FT                   EAYSQSQLPPALRTAQQNETLQVKSAEKRYEVEEIAADAGDLAGAVPVDSRSPEEYAAG
FT                   HIPGARNIWWRSVRSGESINASALVEALRENGVNTTDRIVVYGEEGDASYLFWALEYIG
FT                   HRNVSLLNGGVDAWAKTGRALVRNSPSMPRSDYSGNISEDLLIKPEDLEDVIGAAQIID
FT                   TRESFADFGRSRIQGAIQIPISTVIADNSVRDAASLESIFSGRGLDGGRLQIVYGDMPD
FT                   ASIMYYCLRLMGYRAALMDGNWRASGAVVGNIR"
FT   sig_peptide     469167..469247
FT                   /locus_tag="Mthe_0453"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.430 at
FT                   residue 27"
FT   gene            complement(470142..470981)
FT                   /locus_tag="Mthe_0454"
FT   CDS_pept        complement(470142..470981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0454"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: mhu:Mhun_2316
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14245"
FT                   /db_xref="GOA:A0B6C1"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6C1"
FT                   /protein_id="ABK14245.1"
FT                   /translation="MNQLEFVKLHGNGNDFILIDELNGERIPEDEKSEASRILCHRNFG
FT                   IGGDGVLFLVPSERADIGMRLFQPDGSEAEMCGNGIRCLAKHAWESGYVGERFSVETLA
FT                   GVIPIQVRRDRKGFWARVEMGIPRFERSEIPADGEGTFLKVPLHGFEVSAVNTGVPHAV
FT                   IFVENLDIPVEQIAPKIRHSSCFPEGANVNFVRLGNHLEVRTFERGVEAETLSCGTGSV
FT                   AAAAVARRLGLVGETVEVMTKGGPLRISFAGEKAFMEGPAVTVCRGVVSDEILQTLQ"
FT   gene            471040..472326
FT                   /locus_tag="Mthe_0455"
FT   CDS_pept        471040..472326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0455"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.43"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase;
FT                   Dimethylmenaquinone methyltransferase; putative
FT                   N-acetylmannosamine-6-phosphate epimerase; protein of
FT                   unknown function DUF561; KEGG: mac:MA4504 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14246"
FT                   /db_xref="GOA:A0B6C2"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017120"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6C2"
FT                   /protein_id="ABK14246.1"
FT                   /translation="MDIRPILQVALDLLEIDRAVEIAKEAIAGGADWIEAGTPLIKSEG
FT                   MDAVRELRRTLPGVRIVADMKTVDTGAMEVEMAAKAGADIVALLAISDDSTIQDAIRAA
FT                   RKYGVEIMVDLLSAPDPVKRARELEELGVDYICVHVGIDQQMVGKSTIDLLREVVQVVS
FT                   IPVAAAGGIDASSGKDAIFYGASIVIVGGNITRSADVTGSARRIREAIDHVEGAGTSRR
FT                   SLEEEMISIFREVSTPNITDAMHRKGAMRDILPIIPGTKIVGTAITVQTFEGDWAKTVE
FT                   AIDEAGPGKVIVIYNGSRYVAPWGGLATLSCMQKGVEGVVIDGAVRDVDEIRRLNYPVF
FT                   ASAIAPTAGEPKGMGEINVEIVCGGQVVRPGDYIVGDDCGVVVIPKERAYEIARRAKEV
FT                   EKNESRLFEEIRRGRTLSEVAKLKKWEKL"
FT   gene            472773..473150
FT                   /locus_tag="Mthe_0456"
FT   CDS_pept        472773..473150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0456"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14247"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6C3"
FT                   /protein_id="ABK14247.1"
FT                   /translation="MLAAIMVDAMSYKEKILRAIQDSKDGLTTVEVARQAGVSKTTVIK
FT                   YLSVLRSEGKCEYVEVGPSKLWRAVTPKKEICKRDIEPCEVESVSVKPPDDSGMVSISF
FT                   KIRADQLSALLRQIQSINDKC"
FT   gene            473227..474591
FT                   /locus_tag="Mthe_0457"
FT   CDS_pept        473227..474591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0457"
FT                   /product="GvpD gas vesicle"
FT                   /note="PFAM: GvpD gas vesicle; SMART: AAA ATPase; KEGG:
FT                   hal:VNG6240G GvpD protein, cluster B"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14248"
FT                   /db_xref="GOA:A0B6C4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6C4"
FT                   /protein_id="ABK14248.1"
FT                   /translation="MRIPTEIHRFFEIGEGQTLLIKGLPGTGKTTLAFEILNVMCEKRN
FT                   GMYISTRVDPDRLYRTFPWIKEIVPPRNVVNATQSKLLQTLRNIAGGIPTYDTVLDFFR
FT                   VLFEDVEDMESPIIVFDSWDALMNYISPIIKEQQSFEQNICEFARDMGIHIIFVSESAD
FT                   LMPLDYIVDGVVYMEHYRIAGTPSSAVRDSGMRTRYAREIRLEKLRGVEILQRTFTATL
FT                   HGGRFQCFTPCVEDGDARIGGDHVRISDPKEDCASTGIPQLDEITGGLKYGSCNVLEIN
FT                   HGVGKRYYHILTALASNALKNGRAVCIIPSIGYQLSPREIFVPTNVRVVQPYGDDIVSW
FT                   GKELIGIWDELRERSGRPILNIIGMDAMEFAFGYRQLLNIANRLINQWKETNDINLLVV
FT                   KTGQESINMAIHVADTYFVVNELNGGLCIYGVIPRTELYNMSFEGGSRICLTPIV"
FT   gene            complement(474697..475911)
FT                   /locus_tag="Mthe_0458"
FT   CDS_pept        complement(474697..475911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0458"
FT                   /product="Proteasome-activating nucleotidase"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: afu:AF1976 26S protease regulatory subunit 4;
FT                   TIGRFAM: 26S proteasome subunit P45 family; PFAM: AAA
FT                   ATPase, central domain protein; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14249"
FT                   /db_xref="GOA:A0B6C5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6C5"
FT                   /protein_id="ABK14249.1"
FT                   /translation="MNEPQSGPDFSKYILDRMKQLEERNLALREQKDRAEGEKRLIENQ
FT                   KLKYEREARKLRSELERLRVGPMIVGTVVEVLDESRVIVKSSTGPRLVVSVSQFIEEEL
FT                   RPGVQVGLNQQTFAVMCVLPSPRDPMVFGMEVEEVPDVTFASIGGLDSQIAELREIVEL
FT                   PLKRPELFHAVGIEPPKGVLLYGPPGTGKTLLAKAVANSTEATFLRVVGSEFVQKYIGE
FT                   GARLVRELFDLAKSRAPAIIFIDELDAIGSRRIDGATSGDREVQRTLMQLLAEMDGFDP
FT                   RGEVKIIGATNRPDMLDPALLRPGRFDRAIYVPLPNREGRYAILLIHTKGMSLGPDVDL
FT                   RSIADLTENASGADLKAIVTEAGMSAIREERTQVLQRDFERAIAKVLQAERHGAGDELD
FT                   LPNYA"
FT   gene            475961..476458
FT                   /locus_tag="Mthe_0459"
FT   CDS_pept        475961..476458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0459"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mma:MM1005 zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14250"
FT                   /db_xref="GOA:A0B6C6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6C6"
FT                   /protein_id="ABK14250.1"
FT                   /translation="MREMSDRQCEICGADISGSPERIVIDGSVLEVCKSCARFGKPEDK
FT                   WSPVPRKIVPVERSFRVQKPKPRDHFRDLVEVVPDYGNIIKNARESMNLSLEDLALRIK
FT                   EKASLLRKIEREELVPEDDVRKKLEKELKIKLTEETTEEKLKSRGGSKVLTLGDIANIR
FT                   KR"
FT   gene            476460..477056
FT                   /locus_tag="Mthe_0460"
FT   CDS_pept        476460..477056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0460"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC, N-terminal domain; KEGG: hal:VNG2312C
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14251"
FT                   /db_xref="GOA:A0B6C7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6C7"
FT                   /protein_id="ABK14251.1"
FT                   /translation="MQMAVVGGTDEAARCILSGGIVVYPTETVYGIGANALDESSIVRV
FT                   YAIKRRPLDKPISIAVSSFEMLCDVAHVRPEDLDMMRKLLPGPVTFLVRKRSIVPDMLT
FT                   AGSPLVGVRYPDHEMALRLIEMTGPITSTSANITGAPPPSDPKEIDPEILSRVDMLIDG
FT                   GRCRYAVPSTLVDLSTRRILRMGAMADRVLEVIGR"
FT   gene            477053..477988
FT                   /locus_tag="Mthe_0461"
FT   CDS_pept        477053..477988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0461"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: mma:MM2229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14252"
FT                   /db_xref="GOA:A0B6C8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6C8"
FT                   /protein_id="ABK14252.1"
FT                   /translation="MRARIRDFLESREGWIFSVVDYVHIDGVRSLLRYIPDESGGRIAG
FT                   GRRYRKLDFDEAFDFLRVRRPDYVRDVHVVPFDDVKRFFRPADELPRVRAEDERVGRIA
FT                   EILEEHGIPERCIGITGSMLLGLHSRSSDIDLVVYGNAWWKARDVIADAKRSGSIQELD
FT                   SATWMKIYMKRKPSIPFDEFVAHEMRKGNRGMIDGTYFDLLFTRDWDEIEPVPPGRPLC
FT                   RSRIVAEVVDARYSFDSPGIFRLDHEIGELLCYSHTYAGQAFEGEMIEASGVVEETPNG
FT                   LRMVVGTTREAKGEWIRSLTLMSSLSRGCG"
FT   gene            478003..479541
FT                   /locus_tag="Mthe_0462"
FT   CDS_pept        478003..479541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0462"
FT                   /product="AMP phosphorylase"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: putative thymidine phosphorylase; PFAM:
FT                   glycosyl transferase, family 3; Pyrimidine nucleoside
FT                   phosphorylase, C-terminal domain; KEGG: mba:Mbar_A3188
FT                   pyrimidine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14253"
FT                   /db_xref="GOA:A0B6C9"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017713"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6C9"
FT                   /protein_id="ABK14253.1"
FT                   /translation="MFEVVPFDIEIGQYKVMLNIADARAMGLNPGDRVRVRTRGASLTA
FT                   ILDVTGQMIGQGQVGIFTEAFRDLKEAKSVEISPAPRPASISYIKMLMDRQKLSEDQIR
FT                   SIVRDIVYNNLSEIELSAYITASYIHNLDPQETEWLTRAMIETGERIYFDKHPVVDKHS
FT                   IGGVPGNKVSMLVVPIVAASGLLIPKTSSRAITGAGGTADLMEVLAPVEFTADEIKEIT
FT                   ETVGGVIAWGGATNIAPADDRLIKAEYALAIDPYSQMLASIMAKKGAVGADAVVVDMPT
FT                   GPGTKLETPEKARVLAKDLTDLGERLGIRVECAMTFGGSPVGRTVGPALEVREALKMLE
FT                   TGEGPNSLREKSLALAGILLEMGGVAARGEGYRAAEEILVSGKAHRKLMEIVEAQGGDP
FT                   KIRSEDIQIGEHQKQILSPTNGYVVAFYNKRIIEIARAAGAPGDKRAGVIIHKKMGEIV
FT                   KKGEPLLTICSSTDWELECAVKMCSMRDALEQPPIVVEGMLLERYPTERYPRTI"
FT   gene            479642..480496
FT                   /locus_tag="Mthe_0463"
FT   CDS_pept        479642..480496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0463"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   sat:SYN_01017 deacetylase family protrein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14254"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D0"
FT                   /protein_id="ABK14254.1"
FT                   /translation="MEKMKVAVVYHEDFPVHGYSVLKDRIRPSFDALMNSGLVDGVEVQ
FT                   VFRPQPAPVELVAEAHTENHMQNMRHDPHWNVALLSAGSVLMAAELVVSGKAESAFAYT
FT                   GTAGHHASRGSCWGFCYFNDVAITILKLRKMGLKRFLIIDVDPHFGDGTRDFFGNDPDV
FT                   FHINFHSGSQKEFDHERNNYDFGIGWNANDETFLREMENALKLAEGFDYEVCFVIFGHD
FT                   SHTDDYGGFDLTLNAYPKMASMIKKAVDGKPLVFVLSGGSNPDVARRAIPDVIAVLAGR
FT                   WPY"
FT   gene            480499..481353
FT                   /locus_tag="Mthe_0464"
FT   CDS_pept        480499..481353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0464"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   afu:AF1104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14255"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D1"
FT                   /protein_id="ABK14255.1"
FT                   /translation="MASSCYICILERAGFECELLSLPEDRRLELVEGLLQFMAEHMRDV
FT                   PATVGTEREIMLKRISGVADPYSKLKEESNDVARELLPVAERFYDLSEDKMEALVRIAA
FT                   AANSMEFGVRGHEFDNRSFSSVFEDTLREDLVGDLDALKKLLARSSRIFYLTDNAGEVV
FT                   FDLFVMEKLREMGKRVIIGPKAEPVLNDVTADELEGMTDAEIVPTGGVVGISLDRINPE
FT                   ARRLLFDPEWLVIAKGMGNFETISEFEEALRGRLIYIFRAKCEPVARANCVRQGSLVAR
FT                   AYL"
FT   gene            complement(481344..482081)
FT                   /locus_tag="Mthe_0465"
FT   CDS_pept        complement(481344..482081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0465"
FT                   /product="protein of unknown function DUF75"
FT                   /note="PFAM: protein of unknown function DUF75; KEGG:
FT                   afu:AF0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14256"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D2"
FT                   /protein_id="ABK14256.1"
FT                   /translation="MPLFLSKPCYITTSNPEAMLFERKVAVVSFPGIGSVGKVAVDYLI
FT                   SCTNSRMIMTLPFSGFPPQVLIQDGVARLFTVDVFSPEGREDILLLTSDAQPLEVLGMN
FT                   RLAGEILSDMREMDVRDVVTLAAYVGAVHENVVGTATDADGVELLKSAGIAVMPSSIIG
FT                   GMNGIIAGMAPLYGLRGFCILGTTSGERLVDLNAARNLLLSIKNLLQMEIDVSQLEIEE
FT                   EEEAEEIEAPEDEGYADEDMLYR"
FT   gene            complement(482267..482845)
FT                   /locus_tag="Mthe_0466"
FT   CDS_pept        complement(482267..482845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14257"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D3"
FT                   /protein_id="ABK14257.1"
FT                   /translation="MSKQIVFAALFCVTVLLFTGIVAAEPVLLRADSGKNVTEMNTTLH
FT                   FFDLGVGKAVKLTAPSQNWKVQAVLIPGTDGWNETQTELPAARTIAVEIRDSDFNLLYH
FT                   WSDIQLEYFTFPAGLGVARIEVPSVAVNGDFYVVLYERGAVMTFAELDNVKDQSFIFDR
FT                   STGNLYRGVLPVGDNKTIPVNWVIWAVGE"
FT   sig_peptide     complement(482771..482845)
FT                   /locus_tag="Mthe_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.851 at
FT                   residue 25"
FT   gene            complement(483198..484349)
FT                   /locus_tag="Mthe_0467"
FT   CDS_pept        complement(483198..484349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0467"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: mac:MA3317
FT                   arylsulfatase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14258"
FT                   /db_xref="GOA:A0B6D4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024018"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D4"
FT                   /protein_id="ABK14258.1"
FT                   /translation="MQRKRPFHVMIIPTLGCPSKCSYCWSSEEGSPVMSIDTVKEIVEW
FT                   LKLFRDDPVTFTFHGGEPLLAGVEFYRKALPLLADGLSHLTPSFALQTNLWRLTPELAE
FT                   VLKEYDVPIGSSLDGPKEINDLQRSEGYYDRTMRGYGIARDHGLSVQFICTFTSHSIKY
FT                   KQEIFDFFMSNGLTLKLHPALPSLRSDEPERWALDPSEYGELLVYLLDRYLENMDRIEV
FT                   RNINDLCRCVFSGRGTVCTFVDCMDNTFAVGPDGSIYPCYRFVGMPDYVMGDVRDHPSM
FT                   DDLKRSEAWRRMNRFRECVEVHCRKCRHLRYCRGGCPYNAISHTDGEIRGVDPYCIAYK
FT                   RIFDEITERFNREMLSSFGLQSSKPGIIALIRKIASKEEPKGL"
FT   gene            complement(484494..486080)
FT                   /locus_tag="Mthe_0468"
FT   CDS_pept        complement(484494..486080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0468"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: mmp:MMP1700
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14259"
FT                   /db_xref="GOA:A0B6D5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D5"
FT                   /protein_id="ABK14259.1"
FT                   /translation="MNLLLLNVLVVVYLLVTLYLGYRGWVTTRDTEGYMVAGRKIHPYI
FT                   MAMSYGATFISTSAIVGFGGMAGLFGMGLLWLTFLNIFVGIFIAFIIYGKRTRRMGYNL
FT                   GAMTLPELMGRRFDSQFIQWFSGLVIFLGMPLYASVVLIGAARFMETTLSIDFNLALLI
FT                   YSLIIAAYVVWGGLKGVMYTDAMQGTVMFLGMIFLLIMTYLHLGGVTAAHQALTDMANL
FT                   VPQSLAAQGHRGWTSMPALGSAWWWTLVSTVVLGVGIGVLAMPQLAVRFMTVRSGRELN
FT                   RGVLIGGVFILAMTGVAFDVGALSNVFFHATQGKIAIEVAKGNADSIIPVYINAAMPEW
FT                   FVYLFMLTLLAAAMSTSSSQFHAQGTAIGRDIYETLTGKKGTGSILVTRAGIIVAVVIA
FT                   VVLGYILPENIIARGTSIFFGLCAAAFLPMYTCALFWRRATRAGAIAGLVTGTFSSVLW
FT                   MVFVHKKEAEALGISRFIFGRDVLITQMPWPVVDPIVVALPLAFLVTIVVSILTRPPDT
FT                   AHLDRCFKGIK"
FT   gene            complement(486086..486274)
FT                   /locus_tag="Mthe_0469"
FT   CDS_pept        complement(486086..486274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mth:MTH1857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14260"
FT                   /db_xref="GOA:A0B6D6"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D6"
FT                   /protein_id="ABK14260.1"
FT                   /translation="MLGIDDPWIWGVYLLCILSTVLCVSYGIANWNKGEEIEKQEIVEE
FT                   AAWEAQELEMQEKELGM"
FT   gene            complement(486679..488082)
FT                   /locus_tag="Mthe_0470"
FT   CDS_pept        complement(486679..488082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0470"
FT                   /product="replication factor C large subunit"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mma:MM0253 replication factor C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14261"
FT                   /db_xref="GOA:A0B6D7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR023935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6D7"
FT                   /protein_id="ABK14261.1"
FT                   /translation="MTSWAEKYRPKNLDGILGNAKAVSELRAWAMAWEKGRPEVKCLIL
FT                   YGPPGVGKTSAALALASEMDWDYIELNASDQRTAEIIKSIAGPASQVSTFSGRRRLVIL
FT                   DEADNLHGTYDRGGAAAILRVIKNATQPVILIANEYYNIEKPLRDACRGVQFRSIRAQT
FT                   IASLLREICRSEGIECEPEAVMHIAAMSGGDLRSAINDLEAAARGLKHLRLEDVATSER
FT                   DVKASIFRVLDSIFKGEDSRSALEATYQLDESPEDLIHWIDENLPIVYKDRELAKGFEC
FT                   LSRADIFLGRVRRRQNYTLWRYAAFLMTGGVRAVSSKVRRGYTQFRPPSLWKRLGQTRK
FT                   ARSVRDSAARKIAAHCHVSTSYARSELLNFVGALLRSKKTGAAVAASLGLNIEEIALLT
FT                   GSSPTTKKVQKLFEDAQKIIEAEQIAMIDRGLKIVDREIEKPEDKAMKYASVSKEIVQE
FT                   KRQRSLFDF"
FT   gene            complement(488087..488515)
FT                   /locus_tag="Mthe_0471"
FT   CDS_pept        complement(488087..488515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0471"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mma:MM2842 5-nitroimidazole antibiotic
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14262"
FT                   /db_xref="GOA:A0B6D8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D8"
FT                   /protein_id="ABK14262.1"
FT                   /translation="MNVREMSMDECEDLLRRCRYGRLALSYEDRPYVIPMSYVYVDNTV
FT                   ILHSRPSGKKIEIARRNSNVCFEVDELEGQRWRSVIVYGRAELSGSQESKRRMFDAFMK
FT                   SGIGGHGGKIFTWEMLERMEMCVWEIKAFEMTGREGIW"
FT   gene            complement(488667..489650)
FT                   /locus_tag="Mthe_0472"
FT   CDS_pept        complement(488667..489650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0472"
FT                   /product="farnesyl-diphosphate synthase /
FT                   geranylgeranyl-diphosphate synthase"
FT                   /EC_number="2.5.1.29"
FT                   /EC_number="2.5.1.10"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: mba:Mbar_A1417
FT                   dimethylallyltranstransferase / geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14263"
FT                   /db_xref="GOA:A0B6D9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6D9"
FT                   /protein_id="ABK14263.1"
FT                   /translation="MKTLEGGDLEAELRRRADLISKAIDELLPVSRPEGLYDAARHLLG
FT                   AGGKRLRPSLLLIAGESVGCDAARLVPAAVAIELVHNFTLIHDDIMDNASLRRGKPAVH
FT                   VIWGTSGAILAGDTLYSKAFEMLSMVDAPPERVLAAMDMLARTCTSICEGQWQDLEFER
FT                   AESVTEKEYLEMIEKKTGVLYGASAWIGATLGGAPPEVAGGLEEFGRLTGMGFQIHDDI
FT                   LDLTVPEDVLGKRLGGDILEGKKTMIIIDALSKGVKLEIFGKGQASQEQLREAISALRR
FT                   CGSIDYARRRAEEFVGRGKRALDVLDDSPAKKLLLELADYMIRRGY"
FT   gene            complement(489672..491012)
FT                   /locus_tag="Mthe_0473"
FT   CDS_pept        complement(489672..491012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0473"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   mba:Mbar_A1418 metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14264"
FT                   /db_xref="GOA:A0B6E0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030879"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6E0"
FT                   /protein_id="ABK14264.1"
FT                   /translation="MSSIGIMAVGGYDEIGRNMTAIRVGNDIIIMDMGIRLDRVQIHED
FT                   TDVESLHSSDLIAMGAIPDDSVLNGVASKVRAIVCTHGHLDHIGAVSKLAHKYRAPIIA
FT                   TPFTADLVNQEIKAERIFRVNNEVISLRAGERYQVTPDIELEFIRVQHSIVDCVFAALH
FT                   TKHGTILYANDFKIDRSPTLGEPPDFPRLRQLGREGVLALITETTNAGISGKTPSEQIA
FT                   KDLVWDVLMGTEETESGILVTTFSSHIARIKAIIEAARKMGRKPILLGRSMEKYWGTAV
FT                   RTGYAERGNGLAVCGRRKAVDKALKRMMVEGKDKYLPIMTGHQGEPGAILSRIANGETE
FT                   FRVESGDRVIFSAGIIPQPLNMSNRHTVETKLKMKGARIYDNVHVSGHACREDHWELLR
FT                   MINPEHVIPSHGNLNSHGQYLMLAEDTGYKLGYSIHLLRNGQELLLG"
FT   gene            complement(491027..492100)
FT                   /locus_tag="Mthe_0474"
FT   CDS_pept        complement(491027..492100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0474"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="KEGG: mbu:Mbur_2397 isopentenyl-diphosphate
FT                   delta-isomerase, FMN-dependent; TIGRFAM:
FT                   isopentenyl-diphosphate delta-isomerase, type 2; PFAM:
FT                   FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14265"
FT                   /db_xref="GOA:A0B6E1"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6E1"
FT                   /protein_id="ABK14265.1"
FT                   /translation="METVRRKLEHIEICLKKEVVSKYRPFDDLILLHRALPEIDESDVC
FT                   TECTFLNRRLSAPLIISAMTGGHPDAREINANLATAAQETGIAIGVGSQRAALEHPDLE
FT                   DTFSVVRELAPDVPVIGNIGAVQLHRYGPEVLDRVAEMVDADAVAVHLNFLQESVQPEG
FT                   ERHAAGVLGSLREARFRLPIIIKETGCGIPFEDARMLVDSGIQLIDVAGTGGTSWSMVE
FT                   SYRAELRGDPESKEIGMLFAEWGIPTPVSVIECSRAGAQVISSGGVRSGIDVARSIALG
FT                   AFMAGAALPLLAPATRGSVDVVRVLQRFVRELRISMFLTGSRSLQELSRAPVIITGRTR
FT                   EILEQRGIDTKIFSSKR"
FT   gene            complement(492102..492848)
FT                   /locus_tag="Mthe_0475"
FT   CDS_pept        complement(492102..492848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0475"
FT                   /product="isopentenyl phosphate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   mbu:Mbur_2396 aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14266"
FT                   /db_xref="GOA:A0B6E2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6E2"
FT                   /protein_id="ABK14266.1"
FT                   /translation="MLKILKLGGSIITDKSRLATARLDQISRIAHEISGIENLIVVHGA
FT                   GSFGHIHAKNFGLPERFSGEGLLKTHLSVSDLNRIVVEALHDAGVDALPLHPLSSVVLR
FT                   DGRIHHMSTEVITEMLRRDVVPVLHGDVAMDLSKGAGIVSGDQLVSYMARTLGAGMVAM
FT                   GTDVDGVMIDGRVLSCITPNDMHSLESHLLPAKGVDVTGGMRGKLAELVELAGIGIDSR
FT                   IFNAGVAGNVRRALSGESLGTLITGR"
FT   gene            complement(492852..493817)
FT                   /locus_tag="Mthe_0476"
FT   CDS_pept        complement(492852..493817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0476"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="TIGRFAM: mevalonate kinase; PFAM: GHMP kinase; GHMP
FT                   kinase, C terminal domain protein; KEGG: mac:MA0602
FT                   mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14267"
FT                   /db_xref="GOA:A0B6E3"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6E3"
FT                   /protein_id="ABK14267.1"
FT                   /translation="MTAASAPGKVILFGEHAVVSGAPALGTAIDLRARVLVEDLPGKTE
FT                   ISIHGLGLRLSGFSVDSDGRVVSLGSSDEAAAAARYVSAVVKALDVRDVRITVSSEIPV
FT                   ASGLGSSAAIVVATLAALSHHMGIDMEVKSIAAEAHRIEKTVQGGLGSPMDTALAAYGG
FT                   YIQISDGVTPLDLPQMDLVVGCTSVPHDTRAEVARVQELRSRYPEIVDPIFKAMGVISR
FT                   KAVPCIKDLDLKELGRLMNINHGLLEAIGVGTRELSELVYAARGAGMALGAKLTGAGGG
FT                   GCMIALPKEGMCSRAITAITQARGRAFVVRTGCNGVTVED"
FT   gene            complement(493825..494634)
FT                   /locus_tag="Mthe_0477"
FT   CDS_pept        complement(493825..494634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0477"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   mma:MM1761 conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14268"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6E4"
FT                   /protein_id="ABK14268.1"
FT                   /translation="MRPPAAAGMFYPARAEALLAELSSAFRGLKREPMPVIGAVVPHAG
FT                   YIYSGYVAAEVYARLPERETYVLIGPNHTGLGLPVAVSRETWRTPLGSVPVDLELADAL
FT                   EGTIVASDEMAHMEEHSIEVQLPFLQRCFSGFRILPICMGMQDQETAIEVGEAVANAIL
FT                   KLGRSCTVIASSDLTHYLRYETARQLDTSILESVIRMDIDDLYSKIEMLDSRYYGHGVC
FT                   GYGPMAATIAASRRLGASMGKLLRYATSGDVSGDRGQVVGYGAVIFT"
FT   gene            complement(494637..495257)
FT                   /locus_tag="Mthe_0478"
FT   CDS_pept        complement(494637..495257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0478"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="PFAM: ribosomal protein S2; KEGG: mbu:Mbur_2393
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14269"
FT                   /db_xref="GOA:A0B6E5"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023454"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6E5"
FT                   /protein_id="ABK14269.1"
FT                   /translation="MVEEETITVEGDYETLIPIDEYLAAGVHIGTQQKTSDMMKYIYRV
FT                   RTDGLYVLDVQATDKRIRLAGKFLANYEPSKILVVSARQYGQRPATMFAKAVGARANVG
FT                   RFIPNTLTNPHFAGYIEPDVLLVTDPAGDGQAVKEAVDIGIPVVALCDTNNMTSNVDLV
FT                   IPTNNKGRKALTLIYWLLARQVLRERGEEDRFKYTVSDFEMEF"
FT   gene            complement(495267..495449)
FT                   /locus_tag="Mthe_0479"
FT   CDS_pept        complement(495267..495449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0479"
FT                   /product="DNA-directed RNA polymerase, subunit K"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb6; KEGG: afu:AF1131
FT                   DNA-directed RNA polymerase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14270"
FT                   /db_xref="GOA:A0B6E6"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6E6"
FT                   /protein_id="ABK14270.1"
FT                   /translation="MKGEKYTRFERARIVGARALQIFMGAPVLIRTDSIDPLEIALEEM
FT                   RLGVIPITVKRDRKR"
FT   gene            complement(495474..495551)
FT                   /pseudo
FT                   /locus_tag="Mthe_R0010"
FT                   /note="tRNA-OTHER8"
FT   tRNA            complement(495474..495551)
FT                   /pseudo
FT                   /locus_tag="Mthe_R0010"
FT                   /product="tRNA-OTHER"
FT   gene            complement(495560..495745)
FT                   /locus_tag="Mthe_0480"
FT   CDS_pept        complement(495560..495745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0480"
FT                   /product="DNA-directed RNA polymerase, subunit N"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerases N/8 Kd subunits; KEGG:
FT                   mba:Mbar_A1425 DNA-directed RNA polymerase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14271"
FT                   /db_xref="GOA:A0B6E7"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6E7"
FT                   /protein_id="ABK14271.1"
FT                   /translation="MIPVRCFSCGKVISSVWEEYRERIKSEPPGKVMDDLGIERYCCRR
FT                   MLLSHVEVVEMLRRYQ"
FT   gene            complement(495752..496150)
FT                   /locus_tag="Mthe_0481"
FT   CDS_pept        complement(495752..496150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0481"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9; KEGG: mbu:Mbur_2390
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14272"
FT                   /db_xref="GOA:A0B6E8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6E8"
FT                   /protein_id="ABK14272.1"
FT                   /translation="MKVVNSSGKKKTAIARATFKEGKGRIRINNVPLEIIEPALARMKM
FT                   MEPVIMAAEAFSSVDVDVSVMGGGVMGQADAVRTALARGILEWTGDAALKEAYAEYDRN
FT                   LLVSDHRQKEKKKFGGLGARAKYQKSYR"
FT   gene            complement(496162..496572)
FT                   /locus_tag="Mthe_0482"
FT   CDS_pept        complement(496162..496572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0482"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="TIGRFAM: ribosomal protein L13; KEGG: mma:MM1756 LSU
FT                   ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14273"
FT                   /db_xref="GOA:A0B6E9"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6E9"
FT                   /protein_id="ABK14273.1"
FT                   /translation="MIFDATGLVMGRLASITAKCLLQGEEIRIVNAEKAIISGSKESVL
FT                   REYREMLERGTREKGPYYPKRPDRILKRTVRGMLPYKTSRGREAMARLRVYVGVPPDLS
FT                   GMAFEQPDKAKVKRTASYMELGELSRMLGSKF"
FT   gene            complement(496578..496940)
FT                   /locus_tag="Mthe_0483"
FT   CDS_pept        complement(496578..496940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0483"
FT                   /product="LSU ribosomal protein L18AE"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mba:Mbar_A1428
FT                   ribosomal protein L18e"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14274"
FT                   /db_xref="GOA:A0B6F0"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6F0"
FT                   /protein_id="ABK14274.1"
FT                   /translation="MKIIKKTNPRLVRLISDLKAASRESKAAIWRDVAERLEKPRRNYA
FT                   AVNLSKINRHTGDDDTVLVAGKVLGAGEIDHRVTVAALGFSEQAASKIISAGGRCMKIE
FT                   ELIRLHPKGTGIKILR"
FT   gene            complement(497444..497794)
FT                   /locus_tag="Mthe_0484"
FT   CDS_pept        complement(497444..497794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0484"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mbu:Mbur_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14275"
FT                   /db_xref="GOA:A0B6F1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6F1"
FT                   /protein_id="ABK14275.1"
FT                   /translation="MRSPCEEIVWEVLPGIRATIAQELVRRGVSQREVSRLMDVTPAAV
FT                   SQYVSGKRGYNIVFRDDIREEISRLAEDLMNGDADDLIKRICEICKKARGEELCPVEEI
FT                   RGRQETVHQDGS"
FT   gene            497882..498931
FT                   /locus_tag="Mthe_0485"
FT   CDS_pept        497882..498931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa12090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14276"
FT                   /db_xref="GOA:A0B6F2"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6F2"
FT                   /protein_id="ABK14276.1"
FT                   /translation="MNWRLPSLAPKPLVRSAEADRRLELLMVTSVATILCIRFLLHVTG
FT                   YPQLAVRGLHIAHVLLGGALMVLAIVILLAFIDRYSSDLAAVIGGIGFGAFIDELGKFV
FT                   TMDNNYFFQPTVALIYITFVLLYIFFQMINGKLLTHEECLLNVLELVKDAVIKDLDIQE
FT                   RKKALELLDGCDPSDPLVRVFKDMLAGMECIPAPYPGIYTRCREGARRLYHWFVSRKWF
FT                   VSAVIAFFVVDSVLTFFGAALLVMIKLADSLLHLQLISISMVSWLEILAASISSIMVLS
FT                   GVFIIRRNRLAAYYRFKSAMLIQILLVQTFAFYRDQLSALTMLAVNIVIFLTLRYMIAQ
FT                   ESAADRADL"
FT   gene            complement(498940..499344)
FT                   /locus_tag="Mthe_0486"
FT   CDS_pept        complement(498940..499344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14277"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6F3"
FT                   /protein_id="ABK14277.1"
FT                   /translation="MPADQRMECAKTLSEHPLFPLLVRAALRARVSRMQPGEVFQFEGE
FT                   EIYVEEDERSRSVVVQLVLSEERLIEMFRSAAGATGIPDARSSLGDILDLARDEIRRRY
FT                   GIELVLRRGVARAEAVAYKIERWSWRDGPL"
FT   gene            complement(499426..500073)
FT                   /locus_tag="Mthe_0487"
FT   CDS_pept        complement(499426..500073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0487"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mac:MA0535 LysM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14278"
FT                   /db_xref="GOA:A0B6F4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026113"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6F4"
FT                   /protein_id="ABK14278.1"
FT                   /translation="MFYRRMGRSWGGVTRDIPDLPCGSRVLELGCGSGKTIRGMIGKGW
FT                   RIVAIDISRRAVEISRSIKDGVTVASQLGNPSTNSSKGITEEVELLTADGRLLPFRDEV
FT                   FDAVFAFHVLGHLLETQRSVVTREIIRVTRSGGLVFFRGFSFDDFRAGGDEIERGTFIR
FT                   GDGTITHYFTEDEVLDLFKPLLNLSVNTVRWRMRVGGADLIRSEIRAAFRKE"
FT   gene            500286..501245
FT                   /locus_tag="Mthe_0488"
FT   CDS_pept        500286..501245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0488"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   afu:AF1724 dinitrogenase reductase activating
FT                   glycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14279"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6F5"
FT                   /protein_id="ABK14279.1"
FT                   /translation="MDLLDKFIGCLLGSALGDALGMPLEGLSALEIQRSFGRVVEMLPA
FT                   PDHHFHHGLQAGQYTDDTEETIILAESLLEAQGFSGDLFAERLVRWGSTWILDERLDRG
FT                   VGITTRSAIENMLSGKPWQDAGVDIETCGAAMRAAPIGLVYHWDLSMVSRYSELQSIVT
FT                   HRSRGARAGAVAVAVGVALSLLDLPRMKILEISTDIASRISPELGRKMDEVRIFLESDR
FT                   DPSDVLELLGTSPSVHDAVPSAFYCFVRLDPEDALVEAVNAGGDTDSVASMAGALAGAR
FT                   YGTSWMPERWLSHLENRDRIEELGRELGQLSLRISGRV"
FT   gene            501285..502310
FT                   /locus_tag="Mthe_0489"
FT   CDS_pept        501285..502310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0489"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: mac:MA3566 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   Semialdehyde dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14280"
FT                   /db_xref="GOA:A0B6F6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6F6"
FT                   /protein_id="ABK14280.1"
FT                   /translation="MIDIGIVGGSGYTGGELLRLLSVHPSANVVCVTSRKLAGKPVTSV
FT                   HQHLRGLLDLRFEAPSPAEIAQRCDVVFTAVPHGTAMDWVPELLDNGAKVIDLSADYRL
FT                   PVDVFEKTYGIKHRAPRDAVFGLPELHPEVAGASLVGNPGCYPTGATLAIAPLAKAGMV
FT                   DRVVFDSKSGISGAGAEPTETSHYPNLAENIRCYRVTNHRHVPEIKQELSRLQNDIRIS
FT                   FTPHVIPAVRGILTTAHVFVKDSFQDTIQDREFISKLYSDFYRNAKFVRLVEGVPMLGN
FT                   VRCSNFCDIGFEIEKNSDRIVVISAIDNLVKGASGQAIQNMNLMMGLDETAGLWFPGGA
FT                   P"
FT   gene            502418..502894
FT                   /locus_tag="Mthe_0490"
FT   CDS_pept        502418..502894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0490"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mba:Mbar_A2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14281"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6F7"
FT                   /protein_id="ABK14281.1"
FT                   /translation="MLVKDIMNRNPVSCQASDPIAEAARLLRENRISGMPVLDGDELVG
FT                   VISESDLLRLLSTEDDRGGLWLPSPFEIFEIPVRDVIRWERMKRSLDEITKMRVADVMS
FT                   RKPITVSPDASIEEAAAIMTKHRINRLPVVEGSRLVGIVTRGDIISGLGSGEDL"
FT   gene            502891..504057
FT                   /locus_tag="Mthe_0491"
FT   CDS_pept        502891..504057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0491"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: mbu:Mbur_1340 arginine biosynthesis
FT                   bifunctional protein ArgJ; TIGRFAM: arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14282"
FT                   /db_xref="GOA:A0B6F8"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6F8"
FT                   /protein_id="ABK14282.1"
FT                   /translation="MREIDGGICAVPGVRACGIKRGRYGVAMIACSGYAAGVFTRNRVR
FT                   AAPIEVTIDHLRRSGGRTEGIIANSGSANAYTGVRGIRDAERMAGIMAGILGCSPEMIS
FT                   VASTGVIGRYLDLDLISSLAKEVVPSLRTSPDASSDAARAIMTTDTRVKEIAVEHEGFH
FT                   MGGICKGAGMIEPDMATMLAFIYTDADVGPGLYPFLKEAVDVSFNMLTVDGDTSTNDTV
FT                   LLTSTRMVECDPDSFKEAMEYVCVSLARMIARDGEGATKAMEVEVTGAASSEDARRAAK
FT                   SIARSNLVKAALYGEDPNWGRIVCAAGRSGAEFDPTKISLSISSSIGSVLLVDRGIIVD
FT                   GVLEEAKKVMSSDEIFIHIDLGAGAGSARSFGCDLSHEYVNINAKYTT"
FT   gene            504262..505725
FT                   /locus_tag="Mthe_0492"
FT   CDS_pept        504262..505725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0492"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: mma:MM2307 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14283"
FT                   /db_xref="GOA:A0B6F9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6F9"
FT                   /protein_id="ABK14283.1"
FT                   /translation="MLLRGSRLGDISGEVLDFISSRDVDLWIAEADVLVDMAHLLMLYE
FT                   RGLIPREDCARILTALKELLAEGFGVLGEGEDIHEAIEAYVIERVGPAGGRMHTARSRN
FT                   DEVATCIRIALREQMLGLMDELIQMIDALVRIADETRERIIPGYTHLQHAQPTTLAHHL
FT                   LAHADALIRDLERFESTYERVNLSPLGAAAFASTGFDIDRYMTCELLGFSGLVENSMDA
FT                   VSSRDFALEVLSDTSILMINLSRIAEEIILWSTSEFGYVEVNDLFASTSSIMPQKKNPD
FT                   TAELVRAKSGTAIGSLVGALSICKALPMSYNRDLQELTPHIWRGIGAARSSLRVMRGCV
FT                   STLRFDFERLERSSTEGFTTATELADSMVRITGIPFRTAHQIVGRLARLPGKPSLEDLD
FT                   RAAMVVADLRLSQMGFTAEDLERALDPRTNISMRSKPGGPAPEEVSRMLDARKKYLESA
FT                   SSRLAEKRSKVDSAIRRLMEGVDRTVTAT"
FT   gene            complement(505802..506239)
FT                   /locus_tag="Mthe_0493"
FT   CDS_pept        complement(505802..506239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0493"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mbu:Mbur_1909 alkylhydroperoxidase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14284"
FT                   /db_xref="GOA:A0B6G0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G0"
FT                   /protein_id="ABK14284.1"
FT                   /translation="MLEDELKGILEKGVERSAEDMIKTIEEIYGEVPYIFHFMKDSPEL
FT                   LVTKILHNNAIVRNSKLDMKTIELISIAVSAAIRCSHCLEMHIRVASRMGISDEEIAAA
FT                   MFLAANLVNASVLATATRELDEEREVCRACQVGTCEVHEKK"
FT   gene            complement(506244..507167)
FT                   /locus_tag="Mthe_0494"
FT   CDS_pept        complement(506244..507167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14285"
FT                   /db_xref="InterPro:IPR011312"
FT                   /db_xref="InterPro:IPR026327"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G1"
FT                   /protein_id="ABK14285.1"
FT                   /translation="MLEPVMFTGGVYKHDLVIELVEDLGGYLLQKNVTQSEVILLLLVP
FT                   AEDLRILEDLTKELRGELTRAPLAGTEVAVVTPTLAIHHLPHTACDIAEYLRRNGAKSN
FT                   MIGLARGVGREIAQINEYETALINEHDAAVFIFGNFVKCIIKKEELYKGVNIPVVVTGG
FT                   PEIPKGEMPYAFEYVSSVGRIAHRSKKANEIGNLDRIVAAVGRALDKMRADIEKDPLTT
FT                   SPPRVMDVVREQVPDIERSYSPLPIALNLNGCRIKLPYDEYHDAIGNVMFDEGVMLKEI
FT                   ARILPSRMKNYTLVRILPESETGMVF"
FT   gene            complement(507160..507729)
FT                   /locus_tag="Mthe_0495"
FT   CDS_pept        complement(507160..507729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14286"
FT                   /db_xref="InterPro:IPR016762"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G2"
FT                   /protein_id="ABK14286.1"
FT                   /translation="MDPLEVYRVEAPGEEFGAAKYREIILDILQDLGLVRSIGRLYVYI
FT                   DMERPYFAVYGLLRGSLPPLRVGDVADVVRTQEGYQIKVNEEEHLADMLRVLWEKYGRD
FT                   RVEQPDRDLLTIASDVSPADLIVTDVDAEFRRDLTDALIRIAPEGFRNRRNEMTEDSFL
FT                   FIASEETITPELIEEVREKIRGMENA"
FT   gene            complement(507731..508957)
FT                   /locus_tag="Mthe_0496"
FT   CDS_pept        complement(507731..508957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0496"
FT                   /product="putative CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: putative CoA-substrate-specific enzyme
FT                   activase; PFAM: ATPase, BadF/BadG/BcrA/BcrD type; KEGG:
FT                   mhu:Mhun_2307 CoA enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14287"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR017676"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G3"
FT                   /protein_id="ABK14287.1"
FT                   /translation="MIRIAQLSCGAEYSGIQRELERAAEIVGAKMISPEVSLEDVMEVE
FT                   KRFGVSVPSGDLNLIMARATRLVQNPDLADAVFVATCFRCAEGAIIRGEVRRYIHEHSR
FT                   LPVLSYSFTERTTAETLLTRMEALVTTARMRGLLARERQTGLTAGIDSGSTTTKAVIMR
FT                   DNQIIGTGWVPTTEVIKSAEEAFQQALQESGVKREEIQGIGVTGYGRFLVGKHFDAKLI
FT                   QEEITVNSKGAVFLANAQKGPATVIDIGGMDNKAISVQDGVPGSFTMGGICAGASGRFL
FT                   ELTARRLGVNITDLGKLALRGSYKSVPMNSYCIVFGTQSLVNSLSKGARPEDVAMAACH
FT                   SVAEQVFEQQLQEVEVKQPVIMVGGTSLIEGLPRAMEDLLGIKVIVPNHAQYIGAVGAA
FT                   LLVSGMLEV"
FT   gene            complement(508954..509391)
FT                   /locus_tag="Mthe_0497"
FT   CDS_pept        complement(508954..509391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14288"
FT                   /db_xref="InterPro:IPR012356"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G4"
FT                   /protein_id="ABK14288.1"
FT                   /translation="MVKVIVYPPTSTILADLVDRMGHTPLVMANEIRKKIDTPSLESPP
FT                   LNITPEDPKKGLKYAAVDVPSGVRGRMSLIGPMIDEAEAAIIVEDNNCLVGCTGCARTN
FT                   ELTRLLIKIKGIPFIELKYPRDDGEARRFVHEIRMFLEGLK"
FT   gene            complement(509401..509826)
FT                   /locus_tag="Mthe_0498"
FT   CDS_pept        complement(509401..509826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14289"
FT                   /db_xref="InterPro:IPR012025"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G5"
FT                   /protein_id="ABK14289.1"
FT                   /translation="MRVTKYVITSPESEILPSDIAMHIYGSKRDVHVKETCFGVIINGE
FT                   KDEIEDLVREIRAMDPNGIFIKDRGFPPGDPRRCRGHRGGGPRPGFFMLECESKMLPMI
FT                   SRALEAESRNAPLPEAAPEKTPVSMERLVEIIKDEFA"
FT   gene            complement(509823..511352)
FT                   /locus_tag="Mthe_0499"
FT   CDS_pept        complement(509823..511352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM0912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14290"
FT                   /db_xref="InterPro:IPR016466"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G6"
FT                   /protein_id="ABK14290.1"
FT                   /translation="MRVRVDGSEVSLRDGATLGEALEAANAAVSPGAVIGIIKGRGEKA
FT                   KATDSYWLVTTKGRIRIDLLDTGLKDAWHEAVERIEGLEGRWSDSGAVAFGNFPSSISP
FT                   GRGVHEYSRFDVLLGASGFESEKSQLIFIKRRHSAVYGVPSESRGIFARVVGGKNILDR
FT                   LEKSDSILKVEPIVEWEDLTEKLVTSDMSFPLADGMEIYSRFEVELIQDAPKGAEFFLA
FT                   ATKDGALRVDAISSSYISSHILKGEPIDFEHREPRLEGAVTVRTSGRGLGHIFIYKADR
FT                   TSNPGHSVVGRVTAGLDLLKLASPGQRLTAKVRPERFMVLGMPLSDAMELARSRGIEPS
FT                   VDGYTGDDAVVIEQNPPTTMEVLKAGKVSLKAIQSSRLVRIELYDDLAPKTLDYFRHVV
FT                   GLKERPVGPLPVFFVYENTVLFKPLIDALRYKELLPENKPTGPVPAGSIGVTNQVAKRT
FT                   GLIGVKFVEDRRYGPSGEKFEGTNIIGRVIDLDKLRDVKEGEIVYVMEEKR"
FT   gene            complement(511395..512996)
FT                   /locus_tag="Mthe_0500"
FT   CDS_pept        complement(511395..512996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0500"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mma:MM0911 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14291"
FT                   /db_xref="GOA:A0B6G7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017669"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G7"
FT                   /protein_id="ABK14291.1"
FT                   /translation="MAPFIEIKDLTVRFGDLEVLSNVNLEIEEGESVGILGRSGAGKSV
FT                   LMHVLRGVEEFPGISGSVIYHIAICDRCGHVEPPSRVGGQCRCGGTFKASEADFAKLGI
FT                   NDPLRRAVARRIAIMLQRTFALYGDERVIVNVMRAVEDAGETISVHKAADLLDEVNLSH
FT                   RMMHVARELSGGEKQRVVLARQLAKSPMLLLADEPTGTLDPATAAVVHDSIKRAVRDFK
FT                   MTMVITSHWQDVMVDLADRAILLDHGKIQAVGDPRTIADQFIAMAGEVGKREPVAVGEP
FT                   IIRATNLSKRYISIDRGVVKAVDNVSFEVYEREIFGIVGVSGGGKTTLSKIISGLITPT
FT                   SGFAFVRVGDEWVDMTLLGADGRGRATKYIGVLHQEYTLYPYRTVIENLTEAIGLSLPY
FT                   ELGERKAIHTLTTVGFTEDEAEMILNKYPDELSEGERHRVAMAQVLIKEPRIVVLDEPT
FT                   GTMDPITKIEVSKSILSAREELEETFVIVSHDMDFVSNVCDRAMLMRNGRVVSIGAPAD
FT                   VLKLLTEEEEREMLGS"
FT   gene            complement(513323..513913)
FT                   /locus_tag="Mthe_0501"
FT   CDS_pept        complement(513323..513913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0501"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: mba:Mbar_A1628
FT                   phenylacrylic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14292"
FT                   /db_xref="GOA:A0B6G8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G8"
FT                   /protein_id="ABK14292.1"
FT                   /translation="MEIVLGISGASGVVYGTRLLEVLRERCFVNLIVTEAARKILEIEC
FT                   DRSYKDIISLADRVFEPGDLTAPIASGSYLFDAMVVAPCSMRTMAAIAYGMSDTLITRV
FT                   ADVCLKQRRPLVLVPRESPLSLIHLRNMVAVSEAGGIVLPASPSFYSRPLKVGDLVDTV
FT                   VCRILDILGIDNSISPRWGGFGGNAYNDTGEEQ"
FT   gene            complement(514240..515403)
FT                   /locus_tag="Mthe_0502"
FT   CDS_pept        complement(514240..515403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0502"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mhu:Mhun_2873 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14293"
FT                   /db_xref="GOA:A0B6G9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6G9"
FT                   /protein_id="ABK14293.1"
FT                   /translation="MADLPKSIFPLYLSVFVSVLGFAVVAPIFPLYVLDMGATHLMLGM
FT                   IISIYGAVQLLTQMPAGRLSDQRGRKPVLLIGLLTFTIMPLLYIYASNAYQLLLIRIFG
FT                   GIGASMVWPVTMALIVDCVDPSHRGLAMGWYNASFYSAVAVGPVIGSLLYGSFGINAPF
FT                   IFWSLFAVASLIMVTFVVREPPVRGEVLSTNTPRTPKARLIVDGSMITFIICCSVVMVP
FT                   GIIGGFNMTLLPELALSVGVGVSQLGILYMAYAGSNALANIYFGRVADLGHRRLLISGG
FT                   SLGCVLGFLVLGHGQGILPQLIALTILGLSSGICTPAATVVVSYITSPERRGEIFGIFN
FT                   TSRMLGVVIGPIIAGLTADLGGLAGAITAFLAVSLLISAMTLSLREI"
FT   gene            complement(515404..515637)
FT                   /locus_tag="Mthe_0503"
FT   CDS_pept        complement(515404..515637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0503"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   mac:MA1588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14294"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H0"
FT                   /protein_id="ABK14294.1"
FT                   /translation="MKGFIMINVEPGSEKEVFDSLQKIRDIKEVVPVYGEYDFIAIADV
FT                   EAISDLNRMVLSVREIPSVTNTRTILGMELKF"
FT   gene            complement(515674..516183)
FT                   /locus_tag="Mthe_0504"
FT   CDS_pept        complement(515674..516183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0504"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mth:MTH83 O-linked
FT                   GlcNAc transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14295"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H1"
FT                   /protein_id="ABK14295.1"
FT                   /translation="MHTKEKILIHKGIDMVKRGMYEKAVEYCDRALEINPDSSDAWNNK
FT                   GVALYNLDRIDEALECYNRALEIDPGNLDAMRNIAFVHRDLGELEKALELYETIIERGG
FT                   DAYDLEAKATILVALGRFQDAIECIGRAYEMTPDPRFEVEMAAIIGKVQAMEDLAHENM
FT                   GSEESG"
FT   gene            complement(516195..516536)
FT                   /locus_tag="Mthe_0505"
FT   CDS_pept        complement(516195..516536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14296"
FT                   /db_xref="InterPro:IPR021857"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H2"
FT                   /protein_id="ABK14296.1"
FT                   /translation="MFYPITMEVSIEVTRSPAFRQVYAIGAIGGHSPYDFRISFYNDSP
FT                   RAFIEGGKQLSTVERSMEVEVILSPLAAKELAEWLMNHIKEYEKLFGEIKRPGKAKETE
FT                   RSSQLQGYM"
FT   gene            517428..517760
FT                   /locus_tag="Mthe_0506"
FT   CDS_pept        517428..517760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14297"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H3"
FT                   /protein_id="ABK14297.1"
FT                   /translation="MNYGYTGYVATQGSDEVDIAEFLRSLGFLEDEVFSVVYELNSYRT
FT                   IPGTTLERYINRVVSSIVDEERISFLKGLLVGIAIRQVVDTIQDDDEPPLSDEEARLLE
FT                   ELGRLS"
FT   gene            complement(517925..518344)
FT                   /locus_tag="Mthe_0507"
FT   CDS_pept        complement(517925..518344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0507"
FT                   /product="protein of unknown function DUF123"
FT                   /note="PFAM: protein of unknown function DUF123; KEGG:
FT                   hma:rrnAC2648 endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14298"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H4"
FT                   /protein_id="ABK14298.1"
FT                   /translation="MRGIYTLILGLEHVIRIRVGSIGEILFPEGYYAYTGSARGPGGFK
FT                   RISRHVAVMNGDNSTRRWHIDYLLPHATLRDVITTATDMDLECEAAKRIGAYCISVPRF
FT                   GCTDCRCPSHLHYSSSYTEMLSACRKAHRDLLRDL"
FT   gene            complement(518367..519608)
FT                   /locus_tag="Mthe_0508"
FT   CDS_pept        complement(518367..519608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0508"
FT                   /product="protein of unknown function DUF512"
FT                   /note="PFAM: Radical SAM domain protein; protein of unknown
FT                   function DUF512; KEGG: mma:MM1245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14299"
FT                   /db_xref="GOA:A0B6H5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017672"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H5"
FT                   /protein_id="ABK14299.1"
FT                   /translation="MFLDRLASMEILADVGGRPGIDCGGFCTYCYFRGVKPVPPFGCKH
FT                   CLPFRKGCDYCTRAIIEGYPGFKPLDAVVFDVAQASYGATPEKVTISGGGDLSCYPNLL
FT                   KLVRILGQKNVPIHLGYTSGKGFKRGDEADELVDAGVREVSFTVFATDPELRRKYMHDK
FT                   HPEAALSNLRIFCERCDVYAAAVLLKGVNDGEVLERTCQDLEDMGAKGLILMRFANHPE
FT                   QGLILGNAPIIPGQDVHTVEEFRCIVTEMNQRYSIRITGTPLWDPETKAPFSLAHNTDR
FT                   LRSLPELKRSATIVTGSIAAPLLERIFSALGRDVNVVATKKDVACLMTIDDLRDIDLSR
FT                   VKRTVVIPGRMLAHEREVKKELSRDGIDRLIVRGPDRLTVDGEMSISMTEEEVIELELE
FT                   AFAELIDEINALGV"
FT   gene            520069..521160
FT                   /locus_tag="Mthe_0509"
FT   CDS_pept        520069..521160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14300"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H6"
FT                   /protein_id="ABK14300.1"
FT                   /translation="MMRYVLSSICITLVLISCAFADDAMIQEIGVKAAEKAMSELSFQK
FT                   GDENILVLTNAGYAIVSGMTTQKALKGITETAGCSHGDGNLFQVLRPHWKPLWFYFFDK
FT                   NSKEALYLEVKPEALSMSLEELKAASDDAVFSKISKANVDLDYLLNNTDEGNRTFNEKL
FT                   FNGNEFSLVGISNVWARNASFDFIQATSFHDHLCPGVTSGYMIAKYVERELPINSSAES
FT                   YKVIAVPPWCKDDALQILWDATVGKSGIFVMALTDTEKNALKAKYNQSDVAGIFVRWND
FT                   TAKQGDALVLSFNWTRMYELTETKDWKGPSWAPKLVMDVRMMDYWDEPEIAVSVIKRFQ
FT                   VDQNMLAQLQNAGMHPLKVAGVM"
FT   sig_peptide     520069..520134
FT                   /locus_tag="Mthe_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.846 at
FT                   residue 22"
FT   gene            521350..522882
FT                   /locus_tag="Mthe_0510"
FT   CDS_pept        521350..522882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0510"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: wsu:WS1160 oligopeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14301"
FT                   /db_xref="GOA:A0B6H7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H7"
FT                   /protein_id="ABK14301.1"
FT                   /translation="MSRLVKILCTAMLISLLLPAVAEEIPVYTIADTTGDWGYPSPYLH
FT                   YSRGPGYVRMSFIFDTLVWKDQNGFVPALAESWEYLKDENAYIFNLNPNAKWHDGEPFT
FT                   ADDVVFTINYIKEHPYQWVDSSTVDRAEKIDDHTVKIYLAKPYAPFLDQVAGTLPILPE
FT                   HIYIDVTKPEDFQDAKALTGTGPFKLVDYNKAQGTYLYEANEDYYQGAPKVKQLKFVKL
FT                   SEEMAGPALKRGEVDAAAVPPEVAEGLRGSFVVLEGAHDWLAKLMINHKKEPFSDVRFR
FT                   QALAYSIDREKLVEIAQRGYGVPASPGLFAPDSEWYNPDVEQYAHDPEKAGELLKELGY
FT                   EKKGVFFEKDGKTLEVELLVTSSNERAGELIKRDLEEAGIKVNMRSVDSKTLDNAVNEW
FT                   NFDLALSGHGGMGGDPAILNKVITGSGFNSARYDNQELSDLLKREISEMDPEKRRELVN
FT                   EIQEVYARELPALPLYYPTNYWAHDGKVDLFYTKNGVGSGVPIPLNKMAFLA"
FT   sig_peptide     521350..521418
FT                   /locus_tag="Mthe_0510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.891 at
FT                   residue 23"
FT   gene            522903..523652
FT                   /locus_tag="Mthe_0511"
FT   CDS_pept        522903..523652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0511"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   mac:MA3449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14302"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H8"
FT                   /protein_id="ABK14302.1"
FT                   /translation="MKILICGKGGSGKSTVSALLAREIAGRGTRVLVVDADESNFGIYR
FT                   MLGFDQPKDFMESLGGKRALSERLMRFIRSERREALSIIPEEFQIKDIPPEVVVGDEMV
FT                   KLVAIGKIHNFGEGCACPMGALAREFLEKLRTNGEYVIVDTDAGIEHFGRGVETGCDKI
FT                   VAVIDPCYESVQLSEKIAEMGEKIGKDVFFIVNRIDEDSEDILDMIDRDRVIGVIPKRK
FT                   DLFRASLTGGALPEIAIMGEIADRLIR"
FT   gene            523730..524185
FT                   /locus_tag="Mthe_0512"
FT   CDS_pept        523730..524185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0512"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   afu:AF0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14303"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6H9"
FT                   /protein_id="ABK14303.1"
FT                   /translation="MESEMVLRPIGVIHTPFTSRAEAPHQGRVSREICEIEIFPEFEDG
FT                   LMDIEKCTHLIVLYWLDRADRTKLRAVPPHDGRVHGVFATRSPDRPNPVAFSVAELLSV
FT                   EGRKLRVRGLDALDGTPLIDIKPYSAGIDCVPDARIGWWDEKEGVSA"
FT   gene            complement(524198..525355)
FT                   /locus_tag="Mthe_0513"
FT   CDS_pept        complement(524198..525355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0513"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mba:Mbar_A1090 bacteriochlorophyll synthase 43 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14304"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6I0"
FT                   /protein_id="ABK14304.1"
FT                   /translation="MKFDVAVVGASPAGLSAAASSARTDARTVLIDRDLTSVPNANTIF
FT                   EGMASAACLNVEPFSIHQVRGMRLISPSGHSLEIDAGGHFLDRKGFYAHYLNSAADYGA
FT                   EIIESEVRSVSRSADGMELFLSTGDVIDARIVIDAAGVDSQLASSLGIKTMRHPDDVAW
FT                   AIEVDVRHPGIGEEDRFEYWVGSIAPGWKATFSPAGEDMATLGVFVRRHGRDVQRFLET
FT                   FLKKFISRRAGSHPGLERMRILGTRRGGDPIAVLPGRIVDDGIMVTGGAAAQSGLAYSM
FT                   RAGEICGDVAGRAALERDPSRERLSEYSRRWWRELGFEYILGRASLERLRSMSDDEIDR
FT                   LFISLSGRNLLVPGGLWRKSANAAFQLTKAMPSMLPRFLLNLLRF"
FT   sig_peptide     complement(525287..525355)
FT                   /locus_tag="Mthe_0513"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.405 at
FT                   residue 23"
FT   gene            complement(525636..525708)
FT                   /pseudo
FT                   /locus_tag="Mthe_R0011"
FT                   /note="tRNA-OTHER7"
FT   tRNA            complement(525636..525708)
FT                   /pseudo
FT                   /locus_tag="Mthe_R0011"
FT                   /product="tRNA-OTHER"
FT   gene            526073..526972
FT                   /locus_tag="Mthe_0514"
FT   CDS_pept        526073..526972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14305"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6I1"
FT                   /protein_id="ABK14305.1"
FT                   /translation="MAILLISLSATSSAITGLVKEQADVTAAQSLEAGTNYPIPVDIVI
FT                   DLYYTDARESPGSVYHAGTPNYTRRSGNIYSFAFHPGVPEKLYFVNANENKIYRTHMRS
FT                   DGYYFPEETVYTHDTYVRDIAFALDDSGDLRLYFSEATGAGANGMIYRLETNGTAAPFY
FT                   VVRLSDVGGSWAGDFAFDTEGNLYLSSGNRIPASIYRVRSGTGVVEVVYTDNTEPIKGL
FT                   VVKDGAIYYANWRNTIYKLNLTDGSKIDIYTDSDRTWLSDVGFRRVLSADEMPRAGTYE
FT                   RLPLRDFTRTMTRAAIHK"
FT   sig_peptide     526073..526144
FT                   /locus_tag="Mthe_0514"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.874) with cleavage site probability 0.442 at
FT                   residue 24"
FT   gene            528052..529308
FT                   /locus_tag="Mthe_0515"
FT   CDS_pept        528052..529308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0515"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mhu:Mhun_1720 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14306"
FT                   /db_xref="GOA:A0B6I2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6I2"
FT                   /protein_id="ABK14306.1"
FT                   /translation="MAENVEFKEPPGGRWVLVILGMIINLCLGSVYSWSVFVKPLTDHF
FT                   QAMGQVVSANDVLLPFSIFLAVFAIAMPLSGKYIEKYGPRKVTMVGGVLCGLGWLLAST
FT                   ASSVQMLYPTYGIIGGLGVGIAYGCPVAVAARWFPDRRGLAVGLTVLGFGFSAFFTANI
FT                   AGYLIAAQGVMNTFRVFGVAFIIIIVLLSMPLVFPPAGYKPPGWTPPAPKPGAAVTHEF
FT                   RREEMLKTPTFYGLWLCYFIGCLAGLMAISVSKPVGTEIVQIDPELATFLVGFFAIFNG
FT                   GGRPLFGYLTDKLTPRNAAIVSFVLIFIACMMMATMAKPTASEIYVVAFAALWLCLGGW
FT                   LAIAPTSTATFFGTTDYPRNYGVVFLAYGAGAIVGPQLAGFIKTSTGSYMGVFNYVAAL
FT                   AIIGIIIAYVLMRPPKKPE"
FT   gene            complement(529479..530468)
FT                   /locus_tag="Mthe_0516"
FT   CDS_pept        complement(529479..530468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14307"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6I3"
FT                   /protein_id="ABK14307.1"
FT                   /translation="MRTLIMVMLIACMIAGTATPITPEDLFGDENYSYLDMPFPGFSSN
FT                   TTFSMMDHFDNASMSFFSQFYFSSSSVSSSVSMTSGLSQPRRIEIRGHEPQLVYLFGAE
FT                   PIPYREFVSRASLLGTNQLWIAGSGTWTQYVVCPVNTLLRLIADSTTDGVADIYEIYPN
FT                   NTINRRQYPIFPGPNEMNFRADAVGRNMVFFIANSIPSNIVIIDVVPAIQTTPQQTPQQ
FT                   AVPAVSAVSSLYTPPAMPAAPSQAGDTVVIIKSTGMIGYDVYLDDVYVGTDGKGGDPLD
FT                   GSFTLRVVGNMEHFIKVWDGQFFYGKPKYYSRGVTTTLWVEPGYALYI"
FT   sig_peptide     complement(530382..530468)
FT                   /locus_tag="Mthe_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.992 at
FT                   residue 29"
FT   gene            530915..531712
FT                   /locus_tag="Mthe_0517"
FT   CDS_pept        530915..531712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0517"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   sat:SYN_02220 NAD/FAD binding domain, oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14308"
FT                   /db_xref="GOA:A0B6I4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6I4"
FT                   /protein_id="ABK14308.1"
FT                   /translation="MSEYIPLQAEIVDIDRVTHDSYLISLQILDRDVSFTYRPGQFVMV
FT                   SLFGMGECPISIASSPTRNVLQLCIRRAGRITNGIMDSMIGDVLGIRGPLGNGFPIDKM
FT                   HKSIVIAGGGSGFATLRSLINYIVDRRDEFEEVFVAYGARTRQDLYFMQEYKSWKMEGI
FT                   EIELTVDVGDESWRGNVGMVPELLDRMDISPPASAAICGPLPMIRAVANRLLENGFRGS
FT                   DILLSMERHMKCGIGKCEHCTIGPYRVCKEGPVFPYNTIRDLL"
FT   gene            complement(531715..533289)
FT                   /locus_tag="Mthe_0518"
FT   CDS_pept        complement(531715..533289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0518"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: mbu:Mbur_1309 K+
FT                   transporter trk"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14309"
FT                   /db_xref="GOA:A0B6I5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6I5"
FT                   /protein_id="ABK14309.1"
FT                   /translation="MNVKILLYSFGDLLRIIGIAMVFPGIAAACYREPHGVVAFAFTSM
FT                   IAMMIGSFFRRHGEIGDLSIKDGFALVAFGWLAAAMIGAIPYMMLGMGSIDSLFESMSG
FT                   FTTTGASVLTDSNSEGYWIIDGELANQSVAFIVAGSVEYLLWATTNTTVSAMIPEHPTY
FT                   YGLLFWRSFSQWLGGMGIILLFIAILPRLGVAGRQLYRAEVPGPEKESLTPRIRQTAEL
FT                   LWGIYLSLSIIEVILLKVAGMPLYDALCNTFATVATGGFSPQSMSIEAYGSPMIEYIIV
FT                   LFMFLAGANFALHYMTIHQDRRCLIRDPEFRFYSFIIVVSTLFIAATAGMMSPLPDRIR
FT                   CALFQVVSIMTTTGFSTTNFDTWYPAAKIVLLLLMFVGACAGSTGGAIKVVRVLVILKY
FT                   VHRELMLAMHPKAVIQVKLHDITVKEEIVRSTISFFGVYMLTFALASIVLAAISYSDQA
FT                   MNLEAIISAVASCLGNVGPGFGPVGPYMNFAEIHPLGKLVLILCMWMGRLEIMTVLVLL
FT                   LPDFWKK"
FT   gene            533761..533838
FT                   /locus_tag="Mthe_R0012"
FT                   /note="tRNA-Glu1"
FT   tRNA            533761..533838
FT                   /locus_tag="Mthe_R0012"
FT                   /product="tRNA-Glu"
FT   gene            534472..535341
FT                   /locus_tag="Mthe_0519"
FT   CDS_pept        534472..535341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0519"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sso:SSO3220 transposase ISC1058"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14310"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0B5M1"
FT                   /protein_id="ABK14310.1"
FT                   /translation="MAYEDNRNWREYNEKLVRRGWFYLSTDFVNNWDEELLKMNKNKNG
FT                   RPYRYPETFIQFCGLAYAFLHLPYRQLEGFIQALSGFVPGLLAADYSTLWQRITNLELN
FT                   IPIPDNDLVVAVDSTGMKVTNRGDWMRESHGVERRGWIKVHIAVDVETRKPVTFEITDE
FT                   TVTDHEMVKPLLEDVKLEDSLMDGAYDKEGVFDFMKEKGVDMPGIKIRKNAIVKAGSSR
FT                   AEPVLEFMKYGYHSWKIVHGYGRRWAAESVFSAIKRIFGETVRATSKEGMIREVRRMFT
FT                   FYTIILSV"
FT   gene            535529..536500
FT                   /locus_tag="Mthe_0520"
FT   CDS_pept        535529..536500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0520"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; KEGG:
FT                   mma:MM1362 putative aliphatic sulfonate binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14311"
FT                   /db_xref="GOA:A0B6I7"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6I7"
FT                   /protein_id="ABK14311.1"
FT                   /translation="MPVFLIVGMVVVASLGCITKTPSENITLRIGYQPSTHQIAEMVAM
FT                   EKGWWLEDLKPFGVTAVEEYEFPSGPPEMQAMLAGSLDVAYVGTAPPISAISGGLDAKI
FT                   VAGVNTNGSALVLAPDKEYSGPESLKGMSIATFPPGSIQDTVLKKWLRENGVDTSEVKV
FT                   LPMGPGDAVTAMFAGQVDGTFLPEPSPSVIEMSNKGKVVVYSGEMWPNHACCSLVVSGK
FT                   LIREHPELVEQIVKTHIKATEYVYAHPDEAARIYANRTKQDLSVVEYSMKNWDGRWISD
FT                   PHVQIPSTMEYARVNYELNYISRMPSEEELFDVSFYDKARGE"
FT   gene            536562..537281
FT                   /locus_tag="Mthe_0521"
FT   CDS_pept        536562..537281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0521"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mma:MM1361 ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14312"
FT                   /db_xref="GOA:A0B6I8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6I8"
FT                   /protein_id="ABK14312.1"
FT                   /translation="MLAVWQISAMLVNDSLVLPSFLDVVNAFGSSWRDIFFQDLPVSLL
FT                   HFFLGIFAGMIIAMPLGMGMGWSRSLDKIIDPIVEVVRPIPPLAWIPFAIVWFGLTHES
FT                   AGFIVFIGAVFPILINTYVGFRNLPRVYVESAMVLGATRDRDLIRYVALPYALPSIAAG
FT                   IRIAMGIAWMCLVAAEMFGVSTSGLGYRIWSYYYLHKMEHVLLYMIVLGMLGLFIDKAF
FT                   RSIIEDRLLKWRVGLTQ"
FT   gene            537587..539290
FT                   /locus_tag="Mthe_0522"
FT   CDS_pept        537587..539290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0522"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="KEGG: chy:CHY_0699 adenine deaminase; TIGRFAM:
FT                   adenine deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14313"
FT                   /db_xref="GOA:A0B6I9"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6I9"
FT                   /protein_id="ABK14313.1"
FT                   /translation="MRIEDLIAAARGELEADLLLEGGKLVNVFSGEIHRADISIYGGFV
FT                   AGFDCPSARRVISVEDHLIAPGSIDAHVHIESSMLMPSEYARAVVPRGTLTVIADPHEI
FT                   ANVLGVDGISYLLRCAEGIPMRFLVTAPSCVPATHLETSGAALGVSEIASLLDDHRVVG
FT                   LGEMMNYPGVIHRDKPVLAKLKVAASKNKTICGHAPGLGGRDLHAYAAALIEDDHECTR
FT                   AEEAMEQLRAGICIMIREGSAARNLDELVKIIREYNTPNIMLCTDDLDPRDIVHRHIDH
FT                   MIRRIIEAGTDPVAAIQMATINPARHFGLRRTGAVAPGYRADIIVMDHDFNVRRVIFEG
FT                   EEVARDGRLTASFESKRLPVQTSMNVRLPITRESFRIPATGRIVRVIGVAPNQILTETI
FT                   AARPEVRNGEVISDTRNDILKVAVVERHRATGNVGLGLVSGFGLKRGAIASSVSHDSHN
FT                   IIVVGEDEESMVRAVESLISMGGGWVSVDGTTIASLPLPIAGLLSERRVEDVVEEAENV
FT                   IAASHSLGSELEDSFMTLSFLALPVIPELRITDRGLVDVREFGHVPLFME"
FT   gene            539300..540415
FT                   /locus_tag="Mthe_0523"
FT   CDS_pept        539300..540415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0523"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mac:MA0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14314"
FT                   /db_xref="GOA:A0B6J0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J0"
FT                   /protein_id="ABK14314.1"
FT                   /translation="MSGPDIWFRWNRKNRYTIAALLPLVSGARLVDRPRPGIMLYSIAT
FT                   PQAEEVYREVDAARNSGMKSVFIAGGPHPSARPEEVLRHFDYVVIGEGEETLPELIDAL
FT                   RTGRDPGSVKGIAYMKEGELIITERRGFVDLDRFPSFSRPLLAPIEITRGCPWGCAYCQ
FT                   TPRLCGSVMRHRSIPSILSHARMHMDLRFTSPNAFAYGSDGLKPRLERVELLLRTLSEL
FT                   GRPIYFGTFPSEVRPDFISGKALELITTYCTNRTLSIGGQSGSDRILRDINRGHCVHDI
FT                   EMACEICLDHEIVPNVDLILCLPGETEEDQMLTVELAEQIVRMGGRVRVHRFMPLPGTP
FT                   LESQEPSPLMREAELRLGRLALAGKLKGRLH"
FT   gene            complement(540412..540747)
FT                   /locus_tag="Mthe_0524"
FT   CDS_pept        complement(540412..540747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14315"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J1"
FT                   /protein_id="ABK14315.1"
FT                   /translation="MSEMRELVINEEEIRDFLLERLRLEGKCGEALDKLSLPFLFASGS
FT                   ELLRTYILNASGFASTLPDKYKIPQRGYIWYLFSQAVREIEVRPKEILIRYELQDSYML
FT                   PFRQFYL"
FT   gene            complement(540971..541858)
FT                   /locus_tag="Mthe_0525"
FT   CDS_pept        complement(540971..541858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0525"
FT                   /product="tungsten formylmethanofuran dehydrogenase,
FT                   subunit C-like protein"
FT                   /note="KEGG: mth:MTH238 tungsten formylmethanofuran
FT                   dehydrogenase, subunit C homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14316"
FT                   /db_xref="GOA:A0B6J2"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J2"
FT                   /protein_id="ABK14316.1"
FT                   /translation="MITIRTSGEKCLCDFTFDFYWQHRGSRFDPDAEIDGWSYRALVDA
FT                   LRRGETVRILGDVGSRLCSSMGVDLMRLGGSGGAVDGGKVIVDGDVGPRMGISMIRGAI
FT                   YVSGRVEEPLGNVIEVESDLSGYRKFVSITELLEKGYSPLHPNELSDGVLRICDGVSRE
FT                   TIGARNESPGRIEVFGNAGMSAGILMRSGDLEIHGCSGRNTGVLLSGGTVIVHGDTEDF
FT                   TATEMRSGEIFVKGSAGGFACSRMRGGCVFARECRPVPPARLSSPTSEDLRRISKIFGI
FT                   SSIHAMMYRKILTV"
FT   gene            complement(542013..543104)
FT                   /locus_tag="Mthe_0526"
FT   CDS_pept        complement(542013..543104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0526"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   tko:TK1733 glycosyltransferase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14317"
FT                   /db_xref="GOA:A0B6J3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J3"
FT                   /protein_id="ABK14317.1"
FT                   /translation="MRIAYVYDAVYPWIKGGAERRVYELSQRLARRGHDVHCYGARWWD
FT                   GEREIKLGDVWHHGVCPPHPLYNKNKRSVKQALLFALGVLRNLEGGFDVIDCQEFPYLS
FT                   CFSTRLRSGGASFFITWHEIWGDYWIEYLGVSGYLGMAVEKATATLTGNNIAVSEMTRR
FT                   ELLKLGAGSIVVPNGIDYSHIQSIRPADSEHDLVFAGRLISHKNLHMLLEAIALLSDVS
FT                   LLIIGEGPEASRLHSLARSLGVDNRVRFSGFLKYEDTIALIKSSRAFVLPSTREGFGMA
FT                   ALEAMACGVPVVAVRHRMNAACDLLTPETGVISELSPASMADAIQAALDLSRKAGQKCR
FT                   EIASRYDWDVICGEIERVYAERV"
FT   gene            complement(543140..544264)
FT                   /locus_tag="Mthe_0527"
FT   CDS_pept        complement(543140..544264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0527"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mac:MA1187 dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14318"
FT                   /db_xref="GOA:A0B6J4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J4"
FT                   /protein_id="ABK14318.1"
FT                   /translation="MRSVSLIIPTLNEADTIGECIRRSRAVLQSVASVWEIIVIDSSDD
FT                   ETPRIAESHGARVVRSEALGYGRAYLKGFEVASGDYIVLMDGDLTYAPEDIPKLLKLLD
FT                   DGADLAMGSRLRGRIHPGAMPALHRYIGNPALTWILNHLYSIRVSDAHCGLRAIRRDAL
FT                   KKMRLRTAGMEFASEMLVEASRRGLRIAESPIDYYPRRRGGSKLRSFSDGWRHLRFMML
FT                   YQPIPFLVAPGALVMSLGMMLTVGVLLVSRSSELRMHSLILGIMMLFIGYQTFLAGVHF
FT                   SIFGATHGIASSWLAERLLSYHSLEKEILLGMAFIIAGIAIGGKVLMSWISAGFGSLAE
FT                   VQSAMIAMVLSMIGIQTIFSGMLISLFLLTDGRD"
FT   gene            544755..545840
FT                   /locus_tag="Mthe_0528"
FT   CDS_pept        544755..545840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0528"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mhu:Mhun_0286 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14319"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J5"
FT                   /protein_id="ABK14319.1"
FT                   /translation="MRNLIIILTLILSIVLCAAENSSEYPITITDSMGRNVTIDVPIER
FT                   IVVLNSDAAEAVAILGCADEIVGVSDTVKNKEYYFPQLKGAQLVGTWKEPDYEMIAEIA
FT                   KVGDEVVPNILVITYTSPGKLYGVEEAAAKLEPFGIKVVGLDLNKPETMISEILTLGKI
FT                   LDREEEASRYVEWYKSVQEEVEDAVKDESVPKVYVESTSKGGSYTTHGPGSGVDQLVSI
FT                   ARGHNIAADLREAYPVVDWEWVISKNPDIIIKKVSYTDRTPYPFGWEIPPSQDSVKLEN
FT                   ILNEIISRPGSESISAIKNSRVYLMNWEITAGLDDVVGLAYMAKILHPEIDLDPENVYR
FT                   EYLQMLGVDYPKNRTFVYPEI"
FT   sig_peptide     544755..544811
FT                   /locus_tag="Mthe_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.554 at
FT                   residue 19"
FT   gene            545974..546897
FT                   /locus_tag="Mthe_0529"
FT   CDS_pept        545974..546897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0529"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: syf:Synpcc7942_0427 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14320"
FT                   /db_xref="GOA:A0B6J6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J6"
FT                   /protein_id="ABK14320.1"
FT                   /translation="MCIIFPRKIDGDQHCCLNSFETNSMISITALTKEYSGRCVVDDLN
FT                   LHVARGELFGFLGPNGAGKTTTIRIITTLTKPSSGRVLINGIDVVRHPSRVKAEFGVVQ
FT                   QHMSLNRDLTIEENLELHARLHHIPRSERRERISELLEYVGLEEHADYLIDDVSGGMKR
FT                   RAMIARALLHRPRLLILDEPTVGLDVQTRRRVWDLIRRVNSDGATVFLTTHYIEEAEAL
FT                   CNRVGIMHHGRLIALGTPLELRRMTGMVTVEVQNNSNGTRYRYFPDRDAAAEYVKALPD
FT                   STKVVMRESNLEDVFVELTGEKVRET"
FT   gene            546894..547649
FT                   /locus_tag="Mthe_0530"
FT   CDS_pept        546894..547649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0530"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ava:Ava_0687
FT                   ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14321"
FT                   /db_xref="GOA:A0B6J7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J7"
FT                   /protein_id="ABK14321.1"
FT                   /translation="MNPVMVITDICSILWSDLVTLKRRWARYLITTLMSPLLYLMAFGW
FT                   GLGRGINMNGMSYLEFVIPGIIALTAMNASFNGAGIRLNVDRLYFRSFDESLMAPVSDV
FT                   SLLIGRSMIGMVRGLISSSVFVMLALAIAPSMHIEPVFLLILLITCMTFASMGVLAALL
FT                   ARSHEDMATFSSLILMPMTFLGGTFFSLSQVPEWLRLVLYILPLTHSSACLRAAALGQP
FT                   VPWSSFIAIIMFMSVFLVTGRMALRRISE"
FT   gene            548299..550458
FT                   /locus_tag="Mthe_0531"
FT   CDS_pept        548299..550458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0531"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: afu:AF1297 cell division control protein 48,
FT                   AAA family (cdc48-1); TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily; PFAM: AAA ATPase VAT domain protein domain
FT                   protein; AAA ATPase, central domain protein; cell division
FT                   protein 48, CDC48, domain 2; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14322"
FT                   /db_xref="GOA:A0B6J8"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J8"
FT                   /protein_id="ABK14322.1"
FT                   /translation="MTEEVILKVGEARASDVGRGIARVDPAVIKERGWQAGDVISIRGK
FT                   KQTAALLWPGYPEDTGTGIIRMDGTLRRNAGVTIDERVPVRIVQAAQAETVVFAPTVPL
FT                   RITGGEEYLKRYMEGRVISRGDVIELNVMGRKIDLVAVRITPPRDALVIGDRTKIEISE
FT                   KPAKEEKMIQRVTYEDIGGLSAEIKKVREMIELPMKHPELFERLGVEAPKGVLLHGPPG
FT                   TGKTLLARALASETNAHFETLSGPEIMSKYYGESEERLRQLFKTAEENAPSIILIDEID
FT                   SIAPKREEVTGEVERRVVAQLLALMDGLESRGKVVIIGATNRPDALDPALRRPGRFDRE
FT                   IEIGVPNRDARLEILQIHTRGMPLSSDVDLGKLADITHGFVGADLAALAREAGMRALRR
FT                   VLPELDLEVESIPAEILNKIEVTMADFMDALRDLEPSAMREVLVESPNVHWSDIGGLAQ
FT                   AKQELMEAVEWPLTYPKLFEHMKASPPKGILLYGPPGTGKTLLAKAVATESQANFISVK
FT                   GPEFLSKWVGESERAVRETFRKAKQAAPAVVFFDEIDAIAPMRSSGAADSHVTERVISQ
FT                   ILSEMDGLEPLHNVIVIAATNRPDIIDPALLRPGRFDRMIEIGPPDEESRLEILKIHTA
FT                   NRPLAEDVDLAEIAKRTENYSGADLAAVCSEAVMLAIREYVLAGKPQDEEAIKNLRVER
FT                   RHFEEALKKVRPSLKDVRMQYTLPR"
FT   gene            550630..551427
FT                   /locus_tag="Mthe_0532"
FT   CDS_pept        550630..551427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0532"
FT                   /product="2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate
FT                   synthase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: mbu:Mbur_0917 predicted
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; TIGRFAM:
FT                   predicted phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14323"
FT                   /db_xref="GOA:A0B6J9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR010210"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6J9"
FT                   /protein_id="ABK14323.1"
FT                   /translation="MSKIGKSIRLERIIDRKTRKTVIVPMDHGLTVGPIPGLIDLAAAV
FT                   DKVAEGGANAVLGHMGLPLYGHRGYGKDVGLIIHLSASTSLGPDANHKVLVTRVEDAIR
FT                   VGADGVSIHVNVGAEDEAEMLRDLGMVARRCDLWGMPLLAMMYPRGAKVRSEHSVEYVK
FT                   HAARVGAELGVDIVKTNYTGSPETFREVVRGCPAPVVIAGGPKMDTEADLLQMVYDAMQ
FT                   AGAAGISIGRNIFQAENPTLLTRKLSKIVHEGYTPEEAARLKL"
FT   gene            complement(551669..551741)
FT                   /locus_tag="Mthe_R0013"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(551669..551741)
FT                   /locus_tag="Mthe_R0013"
FT                   /product="tRNA-Asp"
FT   gene            552096..554708
FT                   /locus_tag="Mthe_0533"
FT   CDS_pept        552096..554708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0533"
FT                   /product="ATP dependent helicase, Lhr family"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: mmp:MMP1141 Lhr-like
FT                   RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14324"
FT                   /db_xref="GOA:A0B6K0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6K0"
FT                   /protein_id="ABK14324.1"
FT                   /translation="MDHSDYDILSLFDDTVREWWIRSFGGREKLFTPPQRLAVPLIHAG
FT                   RSVLISSPTGSGKTLSAFISIINSLFILSRTDGLENSVYCLYVSPLRSLANDIHRNLER
FT                   PLTEIQEIAAERRIESVEIRHAIRHGDVSSSERAKMLRKTPHILNTTPESLALLLNSPR
FT                   FREKLRTIRWVVVDEIHSLAGSKRGVHLSLSLERLEELKRETGGESFVRIGCSATIEPL
FT                   REVAAFLGGAGRDVEIIDTRFSRKFDLRLICPVPDLISTTPGELSRALYETLDELIQEH
FT                   RNTLVFTNTRNGAERILYNLRARYPDRYNESNSGCHHGSMGKTSRLDVEERLKSGDLKV
FT                   VTSSTSLELGIDMPHLDLVLQIGSPKSVAALLQRIGRAGHSLDQIVKGRVVVLDRDELI
FT                   ECAVMLGCAREGFVDRIHIPRNCLDVLCQHIMGMALERRWRIDDALRIIRRSYCYKDLS
FT                   EDDLRSVMTYLSGAYADLEERNIYAKIWYDPETGEFGKRGRNSRMIYMLNLGTIPDEFS
FT                   CDVVTRDGRWVGNLDEKYLERLSKGDVFVLGGRSYAFRYRRGGKIYVDPTGERPTIPSW
FT                   FSEKLPLSFDLGLRVLQFRAHMLDIMRRAGEDEVVHHLLEMLPIDENSARSIYQIFKQQ
FT                   IRYLGEDSISTDRRIVVEETRDTKGKMVYYFLTNYGLRFNDGFSRMVAYLLSREGRSNV
FT                   LVSIADTGFMLSIPEKSKADPIAALKSIRPEMCEDLLRRAVENTNLLKRVFRINATRFF
FT                   MILRNYMGHRKSARRQQVSADMLIGLAKRLEDFAVLKESYREIIEDKFELDNIKSVVEA
FT                   ISTGDIEIVKKRSPSPGPMAFGIASIGTPDVVLAQDRLALLKEFQRRVMERIAGESAA"
FT   gene            554705..555412
FT                   /locus_tag="Mthe_0534"
FT   CDS_pept        554705..555412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0534"
FT                   /product="phosphoesterase, putative"
FT                   /note="TIGRFAM: phosphoesterase, putative; KEGG:
FT                   mmp:MMP1142
FT                   metallo-phosphoesterase:serine/threonine-specific protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14325"
FT                   /db_xref="InterPro:IPR004376"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6K1"
FT                   /protein_id="ABK14325.1"
FT                   /translation="MIIEDLRDHLMKRFDFLLGSLYIKETETCVLSDIHIGLEEELLAQ
FT                   GLVFPLREKEELLRRIEIILAKLNPKRFVLAGDVVHSFGRADQRIRRKLDAILNTIRSR
FT                   CDLVLISGTHDGMLPYMGFTAQSRYDEGGYTVSHGDEDLRDHGHLIMGHEHPVLDVEMM
FT                   RIPCYLFGRGPMDGMDIMVLPAFNPLCQGVAVNHLEAPDLLSPLLRRLDIGKLHPVVEM
FT                   EGEVMVFPEIRHL"
FT   gene            complement(555431..556642)
FT                   /locus_tag="Mthe_0535"
FT   CDS_pept        complement(555431..556642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0535"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: deh:cbdb_A794
FT                   iron-regulated ABC transporter, subunit SufB-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14326"
FT                   /db_xref="GOA:A0B6K2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6K2"
FT                   /protein_id="ABK14326.1"
FT                   /translation="MSDIAERARKALGKKATYGPDVDLEEYEVEAKPHDEVQSIEEVPE
FT                   EVRRAALGVGVSLEDEVGGAYIQMDQTPVVASSSTEGIEVLDIATALKKYDGLKDYWWK
FT                   LVPVDQDKYTADVALHPPAGYFLRARRGAKTIFPLKSCLYLGQTNLNQRVHNIIIAEEG
FT                   SELHVITGCTTPSHVQRGLHLGVSEFFIKKGAHVSFTMIHNWGREVEVRPRTAIYMEGG
FT                   ATLSNNYICLTPAKTLQTYPKAILDGPGAVASFNTVLYAKEGHLDTGSEVVLRAPGCSA
FT                   DSITRAVSVGGEIITRGKMVGEVPDVKAHLECVGLILSEKGRIDSIPELDGRCGGLDMS
FT                   HEAAVGKISEQELEYLMARGLTKDQATGVIVRGFLDVEIKGLPESLRDELRRIMQLQEL
FT                   HGGA"
FT   gene            complement(556630..557367)
FT                   /locus_tag="Mthe_0536"
FT   CDS_pept        complement(556630..557367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0536"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmp:MMP1168 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14327"
FT                   /db_xref="GOA:A0B6K3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6K3"
FT                   /protein_id="ABK14327.1"
FT                   /translation="MFGLLEIEDLHVSIGGRMVLKGINLKINRGENHALFGPNGCGKTT
FT                   LLNTIAGVPRYIVERGRILFKGNDITHLSMDERARMGIGIAFQSPPAIRGLKLKDLIKL
FT                   CNPEVNPEKVLKEVNFLEFADREVNRGFSGGEIKRSELAQLLAQRPELVMLDEPDSGVD
FT                   LENIKLIGRAINKLTEKDTKPSKRIRSGIVITHFGHILDYISVDKAHVMMEGTIVCTGS
FT                   PREILEQIKTRGYEGCVRCLCPT"
FT   gene            complement(557498..557851)
FT                   /locus_tag="Mthe_0537"
FT   CDS_pept        complement(557498..557851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14328"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6K4"
FT                   /protein_id="ABK14328.1"
FT                   /translation="MRILAVVVVLIIVLASGCLEREESQTNTGSTELAAKIISPKAGAV
FT                   LSGGPVVMEASASGGRGPYTYEWWSSMNRYLGSGSKIKVDSSGLKKGEHLIVVKVRDST
FT                   GKEVQGSVIVDVV"
FT   sig_peptide     complement(557777..557851)
FT                   /locus_tag="Mthe_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.864) with cleavage site probability 0.637 at
FT                   residue 25"
FT   gene            complement(558131..558694)
FT                   /locus_tag="Mthe_0538"
FT   CDS_pept        complement(558131..558694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14329"
FT                   /db_xref="GOA:A0B6K5"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6K5"
FT                   /protein_id="ABK14329.1"
FT                   /translation="MISKIYVSHCHSDADLAGDLCTALYRICIESLTSQFRYTCGISRT
FT                   AWASFGIRSSECIVPIVTSNSIFSRTVNMEIGFAKAIDHLIIPIAEDGVEMPFFIEDVV
FT                   PITFSSGGFANAVADLIRIVRSLTRLEWLRVRCPICGEEMTQYLTPQENVDRAIRENRY
FT                   LETACSFCEAEISLDPRTFSPITD"
FT   gene            559426..560604
FT                   /locus_tag="Mthe_0539"
FT   CDS_pept        559426..560604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0539"
FT                   /product="3-dehydroquinate synthase II"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: mbu:Mbur_2000
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14330"
FT                   /db_xref="GOA:A0B6K6"
FT                   /db_xref="InterPro:IPR002812"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6K6"
FT                   /protein_id="ABK14330.1"
FT                   /translation="MWLSSIPSLLRACACLSGWNTNSLLRLGGIMKEKWLMALASEWDD
FT                   VKPLITTALESGFDCVVVSRDHIELVRELGSIRIACFGRERGSEDLLIMDTSVPRENQI
FT                   KSVEKIGRPIGGYVEIRSKEDELFATELGKHVDYLLVVGTDWKVIPLENMIAALQGYDC
FT                   KIISCVRSSEEAEVALSTLEHGADGVLLDTRDPSEIKRVQAAAERLGMSRIDLKTATVV
FT                   AVKPVGMGDRVCVDTCSLMRRGEGMLVGSQSRAFFLVQSEAEESPYVAARPFRVNAGAV
FT                   HAYIRVGDKTRYLSELKSGDEVTIVDKDGMTRSAVVGRVKIERRPMILVEAEVDGERVS
FT                   TLLQNAETIKLVSHDGTPISVAELKPGDKVLVHVETSARHFGMSIEETIIER"
FT   gene            560643..561323
FT                   /locus_tag="Mthe_0540"
FT   CDS_pept        560643..561323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0540"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: mbu:Mbur_1999 3-dehydroquinate dehydratase,
FT                   type I; TIGRFAM: 3-dehydroquinate dehydratase, type I;
FT                   PFAM: dehydroquinase class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14331"
FT                   /db_xref="GOA:A0B6K7"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6K7"
FT                   /protein_id="ABK14331.1"
FT                   /translation="MCLRELDLNGLRIKTPAIVASLGADAERVASRAESEGADIIEVRL
FT                   DLLADPDVIRDIRSTVSLPLIATNRIASEGGSFRGSEERRISILRDASRFSDIIDIELM
FT                   APGRDMLLKNISCPALISYHDFSGVPDNLKSIIEDAMRAGADLVKIAVTPHSMQEALAI
FT                   LRILLDVDCPLCIIGMGAVGRHLRAVAPLYGSLLTYGYVTGPTAPGQMSVRELDTALRC
FT                   LGAR"
FT   gene            562328..562798
FT                   /locus_tag="Mthe_0541"
FT   CDS_pept        562328..562798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA1383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14332"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6K8"
FT                   /protein_id="ABK14332.1"
FT                   /translation="MPEPQKTQDLVSVEVSGLSASLLITHGSISIWFGRSATPSLVSRV
FT                   IRTIARIDCATEHERVILCDFNEISDFEGRGYVLTSYARSGDMYRAIFVVPFSREDALD
FT                   LFIDSILDAISKGDISVSLRWRGGPVRMRALCEELKRLNYFTRFISNYRTDE"
FT   gene            562804..563907
FT                   /locus_tag="Mthe_0542"
FT   CDS_pept        562804..563907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0542"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase, class I and II;
FT                   KEGG: mbu:Mbur_1888 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14333"
FT                   /db_xref="GOA:A0B6K9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6K9"
FT                   /protein_id="ABK14333.1"
FT                   /translation="MRFAKHITEIESSGIRKCFDGVGPGAVNLSIGQPDFDTPGHIKEA
FT                   AIKAIEQGMTGYTPNLGIPELRAAICEKLRRENGLTFSPDQIMVTSGASEALFLAIAAV
FT                   TSPGDEVLMPDPGFVSYRPLVQAANGRPVGVHLDHELKLSVDTVAEHITPKTSAIIVNS
FT                   PANPTGAVQSESEIRGLAELADDKGIALISDEVYEHFIYEGEHVSPARYGENVITVNAV
FT                   SKTYAMTGWRLGYLAAPPEAIDVMLKIHQYIQACASSISQAAALAAITGPQDCVREMRE
FT                   SFRRRRDMMIRGLRDLGLDLVVPKGAFYIFPRVGDGDEFAARLGAAGVITVPGSAFGVN
FT                   GKPHIRISYAVSEDNLRLALERMKEVV"
FT   gene            complement(564073..564615)
FT                   /locus_tag="Mthe_0543"
FT   CDS_pept        complement(564073..564615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0543"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: afu:AF1745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14334"
FT                   /db_xref="GOA:A0B6L0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L0"
FT                   /protein_id="ABK14334.1"
FT                   /translation="MKAPERITISMDEETARLFRKLRDELGVSQSEMMREALRFYSRHR
FT                   GIFATVEDKKLYTHAEMLSAGEHVILDIDHWLLFLSFIDSHPDAEAFWEKHRDVCRAHA
FT                   EQFRHRLYNADVILRRLEACNLFKLSRTSDTEYTLILSSDLSKKFVRTEVEEILRGMGF
FT                   AVEIKEDFGKIRVKLLH"
FT   gene            complement(564637..565377)
FT                   /locus_tag="Mthe_0544"
FT   CDS_pept        complement(564637..565377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0544"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: mac:MA0255
FT                   4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate
FT                   synthesis protein ThiF"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14335"
FT                   /db_xref="GOA:A0B6L1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L1"
FT                   /protein_id="ABK14335.1"
FT                   /translation="MLTEAEVARYSRQIPLLGIEGQERLRRSGVLIAGAGGLGSVSSYY
FT                   LAAAGVGRIRIVDSDIVDLSNLNRQILHRIPGVRKAVSAEETLRSLNPTIEVEGVDICI
FT                   SESSIDDLVDDIDLIVDAMDSFEVRYILNSAALKHGLPLVHGAVSGLDGQVTTIIPGRT
FT                   ACLRCVFPRPPPRDAPPVIGATCGIIGSIQATEAIKMLTGVGELLLNRLLIWDGRCAQM
FT                   DEISIERDAGCPDCNGRSMPDNEV"
FT   gene            complement(565413..566591)
FT                   /locus_tag="Mthe_0545"
FT   CDS_pept        complement(565413..566591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0545"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: mma:MM1418 3-phosphonopyruvate decarboxylase;
FT                   TIGRFAM: phosphonopyruvate decarboxylase-related protein;
FT                   proposed homoserine kinase; PFAM: metalloenzyme domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14336"
FT                   /db_xref="GOA:A0B6L2"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6L2"
FT                   /protein_id="ABK14336.1"
FT                   /translation="MKYVVLLGDGMADWPMEALGGRTPLQVARKPNMDSIARIGRCGLA
FT                   RTVPEGMTPGSDVANLSIMGYDPRRYYTGRAPLEAAAMRIPLGEKEVAFRCNFVTVMDG
FT                   IMDDYSAGHITSEEGAEIAESLKKVIPGGRIYPGVSYRNIVVLKVCRDAVCTPPHDIMG
FT                   KPISDHLPRGDDAHILIDIMERARPLLEEHPVNRRRVSMGLKPANMIWLWGQGPAPSMP
FT                   RFHEIYGLKGAVISAVDLLKGLGVCAGWRVIDVPGATGTIDTNYAGKVRAALEALGSVD
FT                   LVYLHIEAPDEAAHSGDVEQKIRAIELFDERVVGPMIHGLERSGEAWRVLLLPDHPTPI
FT                   EIRTHSTDPVPFAIAGSGVCVDSVDAFDEISASEGGYGMIEGNDLIRLLIAG"
FT   gene            complement(566598..567227)
FT                   /locus_tag="Mthe_0546"
FT   CDS_pept        complement(566598..567227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0546"
FT                   /product="Methyl-coenzyme M reductase operon protein C"
FT                   /note="PFAM: Methyl-coenzyme M reductase operon protein C;
FT                   KEGG: mac:MA4548 methyl coenzyme M reductase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14337"
FT                   /db_xref="GOA:A0B6L3"
FT                   /db_xref="InterPro:IPR007687"
FT                   /db_xref="InterPro:IPR026327"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L3"
FT                   /protein_id="ABK14337.1"
FT                   /translation="MIGRQTQVVDCRESMGLAKGGGLAQRGTLSEAARPDVIAIAMSPG
FT                   RRHITKPVCEITYGLRREGIQTSVLVLEAGTGVPDSFPQASRGYGPTFGLTPKEIEQIQ
FT                   RHKIAVIHLGNVKSHVIYKTRDILAYVDIPAVVVSQCPVDFEDFAKEGVKTRVVMPPKS
FT                   KQATMGTVVDIVTGVTRGATCGRSKLNTLAKVLNKHLAEMESKRSE"
FT   gene            complement(567539..569503)
FT                   /locus_tag="Mthe_0547"
FT   CDS_pept        complement(567539..569503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0547"
FT                   /product="Protein of unknown function DUF460"
FT                   /note="PFAM: Protein of unknown function DUF460; KEGG:
FT                   mba:Mbar_A3698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14338"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L4"
FT                   /protein_id="ABK14338.1"
FT                   /translation="MENRIFGVDIASGSPRSRSQPSYALFVIEGESSYCYEMVSRQKLI
FT                   RFIREKKPDIIAVDNIFELASDRNELTALMRLFPPGTRIVQVTGGDHPEPLVKVARWHG
FT                   IAFDRLNPMHEAEACARLAAKGIGCAVSVFENRTWIKVSRRRSPGRGGWSQNRYSRKIH
FT                   GNVKLISRDIEQRLKESGLEFTMKAVEGLGGYIRCEFMVEAPRERVPVHSSSRGDVQIR
FT                   VAPIPRQRLQFVPLQQRRDYLIVGMDPGTTTGIAALNLRGELVDLISARTMSSSDVIEW
FT                   IAARGRPLIVATDVSPAPGAVEKIKRAFNAVLYSPGEDLAAEDKIMLARPFDYRNDHER
FT                   DALAAAMSAFKKYRNKFSQVEKKVSRDVNPDEVKALVVRGYSIEKAMAELLESDEMPVA
FT                   SAEEPPQIPPPRPEELRLLTEQVRNLREYVEDLRAEISSKDKEISELKGQLEKLQDRAY
FT                   REMKRDHEIRIRDKEIERLRNLLRAERKRMRRLRSEAKRIRKAERIEAMAGYRKLKPVP
FT                   VFSKEAILSARSKWSIGRGDLILLQDPSGGGPNTADLIADLEVEAVVVLKEMPQRMMEY
FT                   FMEKSLPVLSADELSIKTIDGISFVDPEMLKAAKERWAEQRRAYEAEKRAERLRSIIEE
FT                   YRAERLREERLEAKRRSML"
FT   gene            complement(569493..570359)
FT                   /locus_tag="Mthe_0548"
FT   CDS_pept        complement(569493..570359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0548"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; KEGG:
FT                   mba:Mbar_A2841 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14339"
FT                   /db_xref="GOA:A0B6L5"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L5"
FT                   /protein_id="ABK14339.1"
FT                   /translation="MIQLAERFLSLRSEDVTLLRAIEAGMRRREWVPIEEISAISGIPA
FT                   SKADYYLRLLSDRKLVAHTNVPYEGYQIEFAAYDLLALHDLVRRGFVASLGDRLGVGKE
FT                   SVVYEALDDIPLVIKFHREGRTSFSRVRRVRDYLRDRPKVAWIYAAALAARTEFDVMRK
FT                   LYPHVSVPKPIARSRHAVVMERVPGVLLTKTDLDDPAFYLNRILEEIGKAYRLGVIHAD
FT                   MSEYNVIVADDIIIIDWPQAVGSDHESAEELLNRDISNILKYFKRRYKIDLEPEEVIRK
FT                   IKVDDGE"
FT   gene            complement(570383..571510)
FT                   /locus_tag="Mthe_0549"
FT   CDS_pept        complement(570383..571510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0549"
FT                   /product="Isocitrate dehydrogenase (NAD(+))"
FT                   /EC_number="1.1.1.41"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: chy:CHY_1107 putative isocitrate dehydrogenase,
FT                   NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14340"
FT                   /db_xref="GOA:A0B6L6"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L6"
FT                   /protein_id="ABK14340.1"
FT                   /translation="MKAAGDWIDYSSLKPLVIGYVDGDGIGPYITGEAIRVLQSLLRDE
FT                   LERGDVEFRKIEGLSIEERARAMKALPDDALDALKKCHVILKGPLTTPKKGDPWPNLES
FT                   ANVAMRRELDLFANVRPVSIPSEGIDWVFFRENTEGEYVLGSKGFNVTDDLAVDFKVIT
FT                   TQGSERIIRLAFDYARRNNINRVSVVTKANVVKTTDGKFLEIARAISKEYPEITFDDWF
FT                   VDIMAAKLVDTKRRRDFRVIVLPNLYGDILTDEAAEFQGGVGTAGSANIGKRYAMFEAI
FT                   HGSAPRMVQEGRAQYADPSSIMRASTMLLRHVGMIDKARKLEMALDICGQFEKKLVMTG
FT                   RPGGATGREFADYVIETMNSDDLESRWLSYTGKGI"
FT   gene            571799..572530
FT                   /locus_tag="Mthe_0550"
FT   CDS_pept        571799..572530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0550"
FT                   /product="Protein of unknown function DUF166"
FT                   /note="PFAM: Protein of unknown function DUF166; KEGG:
FT                   mac:MA4432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14341"
FT                   /db_xref="InterPro:IPR003745"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L7"
FT                   /protein_id="ABK14341.1"
FT                   /translation="MRVGVITRGKYGERLIDTILRHTDFDVVHAAVPETLPGFIEDPDE
FT                   FLRSIDLNEDVFSSDLIVMYTLHPDLTPAIARIAGERGVKALLIPGGIGRAGSIEELRS
FT                   ISERYNVYIEVDEICCTLEKVGVDAVDQFAEHLGRPELRVELNSGRIGRVDVVRGSPCG
FT                   STWHVARELIGKSVAEAPSLAGLACQQYPCRAVRGTPGGIHTSGDLHKNAMERALGMQS
FT                   ELILPKQSRPIRIRGGVVETL"
FT   gene            572532..573347
FT                   /locus_tag="Mthe_0551"
FT   CDS_pept        572532..573347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0551"
FT                   /product="fumarase alpha subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; PFAM: Fe-S type hydro-lyases
FT                   tartrate/fumarate alpha region; KEGG: mbu:Mbur_0250
FT                   hydro-lyases, Fe-S type, tartrate/fumarate subfamily, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14342"
FT                   /db_xref="GOA:A0B6L8"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L8"
FT                   /protein_id="ABK14342.1"
FT                   /translation="MVKATEAVACKSQISLPGWVVRLIENALRSERSEIARYHLNAILN
FT                   NIRIAEADARPVCQDTGLPVFHVEIGEGCSFDFNLWEAIAEGVTIATRKGMLRSNVVDP
FT                   LSRLNTGDNTGPGMPYLIVDHVTGDSLRITAFPKGAGSENMSFLGMLNPADDPFEYILE
FT                   NLAERVSNACPPVFVGIGIGGTFDQAAALAKRAIIGLPGESKEELLLLKRINDLGIGPM
FT                   GLGGDTTALGVKIERAFCHTASLPVAVNLQCWANRRATARVTEDGWSIE"
FT   gene            573332..573862
FT                   /locus_tag="Mthe_0552"
FT   CDS_pept        573332..573862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0552"
FT                   /product="fumarase beta subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit; PFAM: Fe-S type hydro-lyases
FT                   tartrate/fumarate beta region; KEGG: mba:Mbar_A2417
FT                   fumarate hydratase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14343"
FT                   /db_xref="GOA:A0B6L9"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6L9"
FT                   /protein_id="ABK14343.1"
FT                   /translation="MEHRVRSPLSEGDVSKLSAGDIVWLSGVIYTARDKAHQRLGEVKF
FT                   DLRGGVIYHCGPLIRDTTVVSAGPTSSVRLARYTPQVLDLGVRCIIGKGGMPGAAELMR
FT                   GRAVYLAYPGGCGAAAARSLSVRGVCLSELGMAEAVWEFEATDLGPMVVAIDSHGRDLY
FT                   REVRESAKKHLKR"
FT   gene            573931..574491
FT                   /locus_tag="Mthe_0553"
FT   CDS_pept        573931..574491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA3253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14344"
FT                   /db_xref="InterPro:IPR007368"
FT                   /db_xref="InterPro:IPR041652"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M0"
FT                   /protein_id="ABK14344.1"
FT                   /translation="MADHYRIDKEYRNILSRAVLSDDVARSRRLKAIGLENLMGGVLHI
FT                   DGYNVLITIESIITGEDIFLCDDGFIRDMRCLFRKYRRSGATDEAVQLMIDVISRARPS
FT                   DVLLLLDKQISRSGELASDIGEAFSAAGIPGTARTARDVDRGLKSSSAVVATSDGIIID
FT                   HVSSALDIPALIARRMMVKPIRI"
FT   gene            complement(574659..576728)
FT                   /locus_tag="Mthe_0554"
FT   CDS_pept        complement(574659..576728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0554"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   sat:SYN_01949 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14345"
FT                   /db_xref="GOA:A0B6M1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M1"
FT                   /protein_id="ABK14345.1"
FT                   /translation="MAGNFDEIAAQALEEGRTYLMEHESKRILMDVGLETTGAHLASSA
FT                   DDAVRIANQLGYPVVLKVLSKEVIHKSDAGGVRLNLQGAEAVRSAYHEMEKIFRERGMI
FT                   GVSVQRMASPGIEVIIGVTRDPTFGPVLMFGLGGVFVEILRDVSFRSIPISEEDAESMI
FT                   REIRGYPLLRGYRGISGDIDAIKSILLRVSDLVEKHSIIKEMDLNPVFVYPMGYTIADA
FT                   RIILDSSSPSPAAMHPQSAGDLKGLFYPQSIAVIGASNTKGKLGWNVFYNLLTHGYRGR
FT                   LYPVNPNAAEVQGVKAYPSIRDVPEPVDVAVVLVPAGMTPQVVQDCCAAGVKYIVVESA
FT                   GFAELGDEGKRIEREILSIVRRHGCRLLGPNCSGIINTNCGVVESIGVVDELNRGNVGL
FT                   IAQAGVYAAGYLWGLRKVLDFGIIATIGNKLDLNETDMLEAIGMDENIDVVCMYLEDVK
FT                   GGRRFIDVAREVSKRKPIVVLKTGRTEAGKKAVSSHTASLAGNDQIYSAVFKQAGLIRA
FT                   RDNDHMFALARAFSKQPLPINDGVFVISYAGSLGVAAADAIVMNGMRLAELSPDLKEEL
FT                   RSVLPKYVSGMNPVDFTFDQTPDQVRRTIEIAVKSEDVGSFIVIIQTEMLGAYIDTLRS
FT                   IDYRGRPILAVVASKEFVIEDTIKMERAGIPVYSTPEQAAEVLGAMWMYRKERR"
FT   gene            complement(577616..577906)
FT                   /locus_tag="Mthe_0555"
FT   CDS_pept        complement(577616..577906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14346"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M2"
FT                   /protein_id="ABK14346.1"
FT                   /translation="MRRMHGHIGIFVFTLLVLLTPAVCMDSELMGLLNSYEDPLMTSLD
FT                   LAFLLVTHGLDATPANGYVVVVAGNATYTLIPNGDKPGLAEVYIDAPDAMG"
FT   gene            complement(578133..578516)
FT                   /locus_tag="Mthe_0556"
FT   CDS_pept        complement(578133..578516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0556"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; KEGG:
FT                   mac:MA4245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14347"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M3"
FT                   /protein_id="ABK14347.1"
FT                   /translation="MRCFLPESGENASVVLTLEELEALRLVDLLDLEQEEAALYMGVSR
FT                   KALWNDLVSARRKVAAALVYGMGIRIEGGSYILRDAMEVEQKIPAGDDIALVERELEIL
FT                   KRRLDQLSRRIGEKKVGEKAEEK"
FT   gene            578727..579572
FT                   /locus_tag="Mthe_0557"
FT   CDS_pept        578727..579572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0557"
FT                   /product="MRP/NBP35 family ATP-binding protein"
FT                   /note="KEGG: tvo:TVN0088 MRP/NBP35 family ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14348"
FT                   /db_xref="GOA:A0B6M4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M4"
FT                   /protein_id="ABK14348.1"
FT                   /translation="MEKACEKDPKAENDSPRSGKHKESDRLKRIKHKIVIGSGKGGTGK
FT                   STVSANLAVSLKRRGYSVGILDADITGPDIPKLLGIEDEKLTASSEGIEPADARGIKVV
FT                   SMALLLESRDSAVVWRGPVKMAALKQFVFDVNWGDLDFLVVDLPPGTSDEPISAVQLLS
FT                   GMDGAIVVTTPQDVALLDTRKAVNMFLMMGVRVLGIIENMSGFRCPNCGTVVNIFSKGG
FT                   GEKAARDLGVDFLGYLPIDPRIVSMCDMGKAFVENSDAGGAFEKIVDKLLEKISEKSSA
FT                   "
FT   gene            complement(579640..580932)
FT                   /locus_tag="Mthe_0558"
FT   CDS_pept        complement(579640..580932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0558"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mja:MJ0865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14349"
FT                   /db_xref="GOA:A0B6M5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023979"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M5"
FT                   /protein_id="ABK14349.1"
FT                   /translation="MKIQIISPGVYTYGSMVLGGILRDRGHSVNISKDLRHDGDVIILS
FT                   LFSTLQLLDPAIREFVSKAGPPVYCGGPVGICPEMVLGELDVDAVAMCEGEGIIARLVE
FT                   AGPEGVPGVAYREGEEIIRSEPLRMEVIDHTMPLFPPDLSEQSVRGANVYIETHRGCLG
FT                   GCTFCQVPRFFGRNIRSRSLENIVEEVRELRRMGVKRVAVSGGTASLFGYRNALDKDAF
FT                   IRMLQELSGILGRKNLSVPDMRVDLVDDEILEAIREYTIGWLFFGIESGSDRMLKLMRK
FT                   GVTVLDNIRAVELARSHGVKVGGSFIVGYPGESREDFEQTLDFMEEAMLDDVFVSIAEP
FT                   IPGTPLARVALNTPPADNPLFCEHSGAFRALRLSEAEARCFEMMLHGENCKPVPRAISE
FT                   ALYNTYLNEARSQGKDIREVYGLLNKYREFV"
FT   gene            complement(581110..581469)
FT                   /locus_tag="Mthe_0559"
FT   CDS_pept        complement(581110..581469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0559"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis; KEGG: mbu:Mbur_0620 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14350"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M6"
FT                   /protein_id="ABK14350.1"
FT                   /translation="MRICVPSMGTAGLDEYISQHFGRSPTFTIVDTETGAIEIIGNNST
FT                   HMGGNGLPVDALHGKGVQVVIAGGLGPKAISAFQQLGIRVFVGAAGTVKDAIDDWMNGL
FT                   LTEASMDNACREHRH"
FT   gene            complement(581473..581898)
FT                   /locus_tag="Mthe_0560"
FT   CDS_pept        complement(581473..581898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0560"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis; KEGG: mbu:Mbur_0621 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14351"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M7"
FT                   /protein_id="ABK14351.1"
FT                   /translation="MKICVTAGAAGLDAPVDPRFGRCPFFVVVDLDSMSESSMQNTAAG
FT                   AAGGAGIQAAQLVSQLGASVLITGNVGPNAMQVLSSAGIEIYQSQGGTVRDAVERFRRG
FT                   ELAKVSGPTAPPHGGMGRGMGPGGMGGGMGAGRGRRW"
FT   gene            582170..583054
FT                   /locus_tag="Mthe_0561"
FT   CDS_pept        582170..583054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0561"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pho:PH0874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14352"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M8"
FT                   /protein_id="ABK14352.1"
FT                   /translation="MREHASLWIHMVEGLQLKIVIENTTSHHKPGLRGQHGLSVLIEAD
FT                   LGSESMCILMDTGASSDVLLHNMDVLGIDSDDIDLIFLSHGHYDHTGGLMGLLKHMKRH
FT                   VPILAHPGIFAPKLRSEPFLRSIGIPFTRCEAEGAGAVLLLSRTPVTLAPGIMTTGEVE
FT                   RRTSFERVEGFWTIVDGTYREDRIDDDQALVISIENRGLVVISGCAHSGIVNIVDQARR
FT                   LTDSNAICAVIGGFHLMGSEDERIRRTAGALLDLDPEIVRPGHCTGSRAISQLQEILGD
FT                   RCRPLFTGDVIEI"
FT   gene            583051..583986
FT                   /locus_tag="Mthe_0562"
FT   CDS_pept        583051..583986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0562"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pho:PH0981
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14353"
FT                   /db_xref="GOA:A0B6M9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6M9"
FT                   /protein_id="ABK14353.1"
FT                   /translation="MIAFGPVPSRRLGMSLGVNNIPPKICTYSCIYCQVGRTLGLSVER
FT                   RGFYPPARVLNEVERKISDAGDVRVDYITFVPDGEPTLDLNIGKEIDLLRTLGLRVAVI
FT                   SNASLLWRPDVREDLMSADLVSIKIDAADDGMWRRINRPHHSLKLRTILDGIREFAADY
FT                   SGRLITESMLIKDMNDCDESLRGIAEFLSEISPATTYLSAPIRPPAERWVLPPVEERLN
FT                   AAYQIMSEFLDHVELLVSPESDLFVSSGDVGSDILSITAVHPMREVALRDLLARRGEDW
FT                   MLVERLLKSGTLMETTYRGEKFYIRRIESS"
FT   gene            complement(584008..584625)
FT                   /locus_tag="Mthe_0563"
FT   CDS_pept        complement(584008..584625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14354"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N0"
FT                   /protein_id="ABK14354.1"
FT                   /translation="MSHMKAELLSDRSSNMTAVRGMYVKILLAWGLAILCITLIAHSQS
FT                   DVIDLRRTSSLGNGTTLEVLKPDPLGIDVLMRPPDIEHTWEYLETLQRWGYTRGYVPGV
FT                   QTLRMDGSWHLVLSEGYTADLTLFHNRDAVFGRGTLAPAQRSAYATGQVVGSVVYLDLL
FT                   TEDLALYRCMLTIRGDNLQGSYYGYSPQGLIWSGQARMERSS"
FT   gene            complement(584635..585495)
FT                   /locus_tag="Mthe_0564"
FT   CDS_pept        complement(584635..585495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0564"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   mbu:Mbur_0615 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14355"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N1"
FT                   /protein_id="ABK14355.1"
FT                   /translation="MKQIVVISGKGGTGKTSIVASFAACASGRAVIADCDVDAPDLHII
FT                   LNPVVRERREFFGLRRAFIDKERCTECGACIERCRFDAINNFEVDQSACEGCGVCTLVC
FT                   GSDAVRMVEHLSGYAYISDTRYGPLVHAEMFPAEEASGKLVTMVREIARNLAESLRMEM
FT                   VLIDGSPGIGCPVISSLAGADLALVVTEPTISGVHDLDRILDLAEHFRIRAMVCINRYD
FT                   INEDISKNIERACDGRGTEMVGRIPFDMNVIDAMVRGVPVVELNTPASYSIKQIWSRLM
FT                   TSEIM"
FT   gene            complement(585492..586325)
FT                   /locus_tag="Mthe_0565"
FT   CDS_pept        complement(585492..586325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0565"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   dps:DP0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14356"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N2"
FT                   /protein_id="ABK14356.1"
FT                   /translation="MIVSVASGKGGTGKTLVATSITASVKGAQLLDCDVEEPNAFLFFP
FT                   EMKLLDRKECTVPVPQIDEKLCVHCGRCAEVCAFNAIAVIPTRAVVFPELCHGCGACMI
FT                   SCPEKAISEVLRRIGWISRARSEDHEIVWGELEPGEARPTPLIRDVRRHANADTVIVDC
FT                   PPGASCSVVESVRDTDFCLLVAEPTPFGLYDLDLALKLLERLSIPRGVLVNKSGIGTRE
FT                   IYSYLEKRDVPVLMEIPMSREIAELYSRGVIFVNMLGEWRERFTNLAERIREMSE"
FT   gene            complement(586384..586635)
FT                   /locus_tag="Mthe_0566"
FT   CDS_pept        complement(586384..586635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afu:AF2392 A. fulgidus predicted coding region
FT                   AF2392"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14357"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N3"
FT                   /protein_id="ABK14357.1"
FT                   /translation="MPWGDCTGPWWLPGRGYRAPGFWNPWCRARWFWRGFGMAGYPYAP
FT                   FREPTPDEEVRYLEDVAADLEEELKAIRERLERLRSSK"
FT   gene            complement(586810..588018)
FT                   /locus_tag="Mthe_0567"
FT   CDS_pept        complement(586810..588018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0567"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   sat:SYN_01172 Co/Zn/Cd cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14358"
FT                   /db_xref="GOA:A0B6N4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N4"
FT                   /protein_id="ABK14358.1"
FT                   /translation="MTGVRMPDDPVQRTAIYSLLLNIFLVGAKLVLSELSGSLSLRADA
FT                   IHSMVDVLASLALIVGLVISTRKSENFPYGLYKVENVVSVAISILLFLSAYEIVMAALR
FT                   GEQIFLTYSGWQLLAVMALVPIPFIFGRYQIRIGERFGSPSMIADGAQHQADVLTSSIV
FT                   LIAFLGQMAGVQLDRVAAVVIALFVIRAGWDILESGMRVLLDASVDRETLERIRSIIEE
FT                   APEVVSVKEVVARNSGRYLFVEANLVFRLRDLQRAHASATRIEESIKREVPAVDRIIIH
FT                   YEPMARSFVRYAVPLADPAGDVGTHFGESPYFAILDIDNVERKVKRQEIVANPYLGLEK
FT                   GKGIKVAELLLKHKPDIVLTKESLRGRGPGYAFAEAGVETLQIQTDSLKELIDDLLRGQ
FT                   QLA"
FT   gene            complement(588071..588829)
FT                   /locus_tag="Mthe_0568"
FT   CDS_pept        complement(588071..588829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0568"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: mma:MM1599 integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14359"
FT                   /db_xref="GOA:A0B6N5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N5"
FT                   /protein_id="ABK14359.1"
FT                   /translation="MSENLAAALLLTLLAGSATGIGSLISYIVPRPDMRYLSLSLGFAS
FT                   GVMIYVAFVDLFCGSREVAGLAYSNLFFITGVLLMYILDHAVPHIHINGQADAHCSTLY
FT                   RSSIMSAIGIAIHNLPEGMAVALVSLSDIHLGVPIALAIAIHNIPEGIACSVPFYCATN
FT                   KRGRSCLISFAAGMTEPLGAVLALLLLYPFLNQWILSAALALVSGIMVFICIDELIPIA
FT                   NRYGSEHLTNLGIIAGFAVMMIGLVLMEVP"
FT   sig_peptide     complement(588749..588829)
FT                   /locus_tag="Mthe_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.822) with cleavage site probability 0.395 at
FT                   residue 27"
FT   gene            complement(588882..590561)
FT                   /locus_tag="Mthe_0569"
FT   CDS_pept        complement(588882..590561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0569"
FT                   /product="methyl-coenzyme M reductase, alpha subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: methyl-coenzyme M reductase, alpha subunit
FT                   domain protein; KEGG: mja:MJ0846 methyl-coenzyme M
FT                   reductase II alpha subunit (mcr II alpha)"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14360"
FT                   /db_xref="GOA:A0B6N6"
FT                   /db_xref="InterPro:IPR003183"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR015811"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR016212"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N6"
FT                   /protein_id="ABK14360.1"
FT                   /translation="MAKLHTKKLFVRALTKKFGKDFDLSSQKTEYKRLGPEQSARKREF
FT                   MEYSKKLEGKRGISFYNPYLHCGGVPLGQRQLVPYKLSNTEYIVEGDDLHFVNNPAMQQ
FT                   MWDDIRRTVVVGLDMAHEVLEKRLGKEVTPETINNYLEILNHAMPGAAVVQEHMVETHP
FT                   GLVEDCNVRVFTGDDDLADEIDPQYLIDINKLFPADQAEQLKAAIGKTTWQAIHIPTIV
FT                   VRSCDGGTTSRWSAMQLSMTFIDAYNMCAGEAAVADLAYAAKHAAVLQMSDMLPARRAR
FT                   GPNNPGGLSFGFMADMVQTSRVKPWDPTQVSLNVVAAGTMLYDQIWLGSYMSGGVGFTQ
FT                   YATAAYTNDVLDDFSYYGVDYAVEKYGGFAKAPANLEVVKDLATEVTLYALEQYESFPT
FT                   LLEDHFGGSQRAGVTAAASGITCAIATGNSQAGLAGWYLSQLLHKEAHGRLGFFGYDLQ
FT                   DQCGPTNVFSYQSDEGNPLELRGANYPNYAMNVGHQGEYAGISSAAHAGRGDAFACNPL
FT                   IKVTFANPALVFDWTDIRLCFGKGGAREFRAAGERSLVMPAV"
FT   gene            complement(590575..591342)
FT                   /locus_tag="Mthe_0570"
FT   CDS_pept        complement(590575..591342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0570"
FT                   /product="methyl-coenzyme M reductase, gamma subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: Methyl-coenzyme M reductase, gamma subunit;
FT                   KEGG: mac:MA4547 methyl coenzyme M reductase, subunit
FT                   gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14361"
FT                   /db_xref="GOA:A0B6N7"
FT                   /db_xref="InterPro:IPR003178"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR036994"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N7"
FT                   /protein_id="ABK14361.1"
FT                   /translation="MAYTPQYYPGNTSVGANRRKHMSGNLEKLRDIPEADVVAIMGHRA
FT                   PGADYPSTHPPLKEMGEPDCPIRQLVEPTPGAAAGDRVRYSQFADSMYFAPSIPYWRSY
FT                   WAAINCRGADPGTLSGRQIIEARERDIEAYTKKLMDSEMTDVARCSMRGCTVHGHSLRL
FT                   EENGLMFDMLARTELGADGNVYYVKDQVGIPLDKKINVGKPMSEDELKKRTTIFRYDNV
FT                   SFGGKVGARKFDEALEALHHMWEYRTKWGFRPE"
FT   gene            complement(591344..591856)
FT                   /locus_tag="Mthe_0571"
FT   CDS_pept        complement(591344..591856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0571"
FT                   /product="Methyl-coenzyme M reductase, protein D"
FT                   /note="PFAM: Methyl-coenzyme M reductase, protein D; KEGG:
FT                   mma:MM1243 methyl-coenzyme M reductase operon protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14362"
FT                   /db_xref="GOA:A0B6N8"
FT                   /db_xref="InterPro:IPR003901"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N8"
FT                   /protein_id="ABK14362.1"
FT                   /translation="MVTIKSDTDSEPVQVEIFPSRFLSPETTQKLLNELYKSGGIVRMM
FT                   IQGPNLPRTVTYGPGKGLPIEEHRNLLVEVGGEVLELRVKVGRIRLELEGEEFLPGIEA
FT                   ACERALPFSFQIKRGKFFRDISTISDYAKYGKDADKRILGLVDPRAKKESALAILSEKD
FT                   SDEKEER"
FT   gene            complement(591871..593175)
FT                   /locus_tag="Mthe_0572"
FT   CDS_pept        complement(591871..593175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0572"
FT                   /product="methyl-coenzyme M reductase, beta subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: Methyl-coenzyme M reductase, beta subunit;
FT                   KEGG: mma:MM1244 methyl-coenzyme M reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14363"
FT                   /db_xref="GOA:A0B6N9"
FT                   /db_xref="InterPro:IPR003179"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR022679"
FT                   /db_xref="InterPro:IPR022680"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6N9"
FT                   /protein_id="ABK14363.1"
FT                   /translation="MSDKIDIYSDRGVLLKSDVDLSAISPLRNAAIQKLAKLTRRTVAV
FT                   NLAGIENALKTGRVGGGRRQIKGRELNYDIVANASALAEKIKALLQVTPGDDTNVQVLG
FT                   GGKQLLVQIPSARAEIASEFVVGMTAAAAATVEAIIQHFKAGLFDAPMIHAAVWGEYPQ
FT                   TVGMNGGNVASVLNIPQNDEGLGFAYRNVMANHIAAITKRNAMNAASLAAILEQMGEFE
FT                   MGNAIGIFERHQLLALAFQGLNANNMVYDLVKKNGKTGTIGTVVHSVVERALEDKVIKP
FT                   GKKFPSGYVMYEANDVSMWNAYNAAGVLAATMVNCGALRGAQAVSSTLLYYNDLVEKET
FT                   ALPGCDFGRVMGTAVGFSFFSHSIYGGGGPGVFNGNHIVTRHSRGMAIPCVAAAVALDA
FT                   GTQMFTPEMTSGLVGAIYGEIKEFREPIVSVAEAI"
FT   gene            complement(594162..595253)
FT                   /locus_tag="Mthe_0573"
FT   CDS_pept        complement(594162..595253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0573"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mbu:Mbur_1425 Fe-S protein,
FT                   radical SAM family"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14364"
FT                   /db_xref="GOA:A0B6P0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P0"
FT                   /protein_id="ABK14364.1"
FT                   /translation="MTQLLKTAALTVDFIDEARRIEAHGALSLMVQPILKKINERLAEE
FT                   KPALVRSDAIIPSTWLPPIPSGPFRRLIMNEARIAIGREVPQTVSIEVTRRCGCSCEHC
FT                   TLQEAEDELSSDAIRNVIDQALDMGACIITFTEGDPLLRPDIIELVKYVDKEKAVVNLF
FT                   TPGLEMTPEIADALREAGLYNLIIGIYSADPRIHDQIRGVVGAYERAVNAIRMGLKAGL
FT                   LVTMSTHVNSERVNTLPELYELARELGVHELSVWEAIPRSEDERLTRIDREKIIRFYRK
FT                   MNASQDGPRVFASTYFEGEMLGCMAGRRWLHVGVDGGIRGCPYLSRVYGNVLDTPLPEI
FT                   WRAMRRSGDFSGFKSECPAQDIT"
FT   gene            595579..596388
FT                   /locus_tag="Mthe_0574"
FT   CDS_pept        595579..596388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0574"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   mma:MM2656 peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14365"
FT                   /db_xref="GOA:A0B6P1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P1"
FT                   /protein_id="ABK14365.1"
FT                   /translation="MSLNKGDIIKLEYTGIVDGSVFTSTSADVAKENGIYDENVTYGPR
FT                   IVILGAGQIVPGLEEELIGKEPGQSGSVELPPEKAYGVRDPEKIETVMLNRFKDEKPYP
FT                   GMRVSVDGKIGTVTRIVGRKATIDFNHPFADKTVRFDYKILERIEDREEKLRAMIKIFS
FT                   DIELESRITDDVAEITVPWEISYFKDWLMIRRWLADMALRTLGLKEVRFVERHTPEDRL
FT                   RAELISPPEKHPEGSESTDSDDTEKTAQKSGGEGSGEGSGGESQPGA"
FT   gene            596412..597392
FT                   /locus_tag="Mthe_0575"
FT   CDS_pept        596412..597392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0575"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mbu:Mbur_0991
FT                   protein of unknown function UPF0021"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14366"
FT                   /db_xref="GOA:A0B6P2"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P2"
FT                   /protein_id="ABK14366.1"
FT                   /translation="MVPCSRCGRPSVIHQRYSGLNLCAEHFEEDVQRKIRETLRTYRIF
FT                   SRGGRVAVALSGGKDSSVLLYTLKRIFSHRRDIELIALMVDEGISGYREDTLQNAAALA
FT                   DRLDVPHITLSFREEFGITIDEIAERDLHQAPCTYCGVMRKHLLNKRARELNAIALATG
FT                   HNLDDEAQTILLNYLRGDVDRLFRLLPKRPKEGLVYRIKPLRRIPEREVAIYAMIHGIF
FT                   PRGHGSCPNVPRAMRLEVKNILNEIEARHPGTKYSILRGFDKIRELAPDIHVDLHRCER
FT                   CGEPAGGSVCKTCQLLEGFRAKPLSHKSKNSCPDVRLGSSAGQSE"
FT   gene            597361..597434
FT                   /locus_tag="Mthe_R0014"
FT                   /note="tRNA-Thr1"
FT   tRNA            597361..597434
FT                   /locus_tag="Mthe_R0014"
FT                   /product="tRNA-Thr"
FT   gene            597452..597829
FT                   /locus_tag="Mthe_0576"
FT   CDS_pept        597452..597829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14367"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P3"
FT                   /protein_id="ABK14367.1"
FT                   /translation="MQRLMMLVIVASLVLSPALSIPKVVEKDISKSELEELEELFSGSQ
FT                   VGQNATEAAPSAEIPEYSDYVSTDETSINMIYSPPYISDLVNNTLFSELSMLMNVSISP
FT                   PYISLNMSVPRTAYKIRHVIS"
FT   sig_peptide     597452..597514
FT                   /locus_tag="Mthe_0576"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.924) with cleavage site probability 0.851 at
FT                   residue 21"
FT   gene            complement(598294..599481)
FT                   /locus_tag="Mthe_0577"
FT   CDS_pept        complement(598294..599481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0577"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="KEGG: mma:MM0462 cobalt transport ATP-binding
FT                   protein; TIGRFAM: cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14368"
FT                   /db_xref="GOA:A0B6P4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P4"
FT                   /protein_id="ABK14368.1"
FT                   /translation="MSEILGLRDVCYIYGDGHAALRNVTLSIESGSKVALVGPNGAGKS
FT                   TLLLMLNGTLRPSSGTVLFKGEPMRYDSRSLRDIRKSVGVVFQNSDDQLFAPTVEQDIA
FT                   FGPLNLGYPREKIERYVGYALSYVGLDEHRNRPPHHLSGGEKKRVAIAGILVMEPEVLV
FT                   LDEPTSNLDPATSEEIMEMLDELNLYGKTVVISTHDVELAYRWADEVVLMDGGNVVRTG
FT                   TPERVFADPDVVRKARLKLPAVLEIYREMLGRGILVPVDEMPRNIVDLMHLIESAAGRS
FT                   GRKPGRIYICDISATPPSRIRDILSSGAVRYIGAMGTKAKMIASEELLELDFSYGVVDK
FT                   CVLKAIAGKSSLIITSGGMVEHAERRIRSYAEEFGIEIEVIILPRAHVSTLADNR"
FT   gene            complement(599478..600242)
FT                   /locus_tag="Mthe_0578"
FT   CDS_pept        complement(599478..600242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0578"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   mma:MM0463 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14369"
FT                   /db_xref="GOA:A0B6P5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P5"
FT                   /protein_id="ABK14369.1"
FT                   /translation="MHRLLDDHAHDNGLRDVSPKLKLAIGAFSIMACIASPTPAVPLAV
FT                   SACLSAAVILLARIPWRLYIGIIAIPLSFALLSASVVALLSPGEEIMSLGALSLSREGL
FT                   WLGMLLVSRTIGGTSSLFFIALTTPMTEIFSILRSMGLPETLVELSMLIYRYIFVLLEE
FT                   AMLVHSAQEMRMGYTSIRGSISSFAMLASVLFIRAWERGERLMVAMDSRCYSGRMPVGD
FT                   DHSVRPAHLVVSAIYILSITAFLLAVIRSGLA"
FT   gene            complement(600246..600530)
FT                   /locus_tag="Mthe_0579"
FT   CDS_pept        complement(600246..600530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0579"
FT                   /product="Cobalt transport protein CbiN"
FT                   /note="PFAM: Cobalt transport protein CbiN; KEGG:
FT                   mba:Mbar_A2146 cobalt ABC transporter, solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14370"
FT                   /db_xref="GOA:A0B6P6"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P6"
FT                   /protein_id="ABK14370.1"
FT                   /translation="MKGEVIALASILVFFVAFLWTSQSGLHEWEGADAKAEGVIEEITG
FT                   GSYTPWLQPLWEPPSSEIESLFFSLQAAIGGLIIGYFLGYYRRKAGEGN"
FT   sig_peptide     complement(600420..600530)
FT                   /locus_tag="Mthe_0579"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.466 at
FT                   residue 37"
FT   gene            complement(600527..601216)
FT                   /locus_tag="Mthe_0580"
FT   CDS_pept        complement(600527..601216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0580"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein; KEGG:
FT                   mba:Mbar_A2145 cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14371"
FT                   /db_xref="GOA:A0B6P7"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P7"
FT                   /protein_id="ABK14371.1"
FT                   /translation="MHIMEGFLPHPWWEIWFAASLPFVAYGVSRISRMAREQRETLPLL
FT                   AVAGAFIFVLSSLKLPSVTGSCSHPTGTGIGAILFGPWITSVLSTIVLLYQALFLAHGG
FT                   LSTLGANVFSMGIAGPVVGYLIYRATQRFNLYFAVFLAAALADLATYLVTSLQLALAFP
FT                   AADGGVLLSLKAFAAVFAITQVPLAGIEGVISALMFKYILQARSDVLIRLNVISKPDLL
FT                   RLQGGAT"
FT   gene            601556..601780
FT                   /locus_tag="Mthe_0581"
FT   CDS_pept        601556..601780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0581"
FT                   /product="deoxyribonuclease/rho motif-related TRAM"
FT                   /note="PFAM: deoxyribonuclease/rho motif-related TRAM;
FT                   KEGG: mbu:Mbur_0304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14372"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P8"
FT                   /protein_id="ABK14372.1"
FT                   /translation="MFRRDEGFSHGAAPSAPVAVGTEYNVKIEDIAREGDGIARVEGFV
FT                   IFVPDTKVGDQVRIQVDRVMRRFAIGHLV"
FT   gene            complement(602182..602682)
FT                   /locus_tag="Mthe_0582"
FT   CDS_pept        complement(602182..602682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14373"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6P9"
FT                   /protein_id="ABK14373.1"
FT                   /translation="MQEGCVIPMLHYRGIALRENASSVLSIWIEGMREVDPAKVRELLS
FT                   SNMSLEEIQAEINRGNITYRGVLRLAQDVYQLRGIALMRSENITTIDAELARIRFRDAR
FT                   VGDEADGGEVVGNISLTIDDDLQLGKGSMRINAGSARGSYSIILEMVPDEMRRGWHHLA
FT                   PRG"
FT   gene            complement(603004..603690)
FT                   /locus_tag="Mthe_0583"
FT   CDS_pept        complement(603004..603690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14374"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q0"
FT                   /protein_id="ABK14374.1"
FT                   /translation="MSRLKIMGVLVLTALLAVPAMSMHDGVRGRFDDRGWGPEMRPGGV
FT                   WLLMDDITQEDLENMTLAEIRELRESKRAELENMTLAEIRALKEKRLAEMENTTLAEMR
FT                   GKGYTECPYWPMGGAQGLRGVGPCDADICMKGLGGMWLLMDDITQEDLENMTLAEIREL
FT                   RESKRAELENMTLAEIRELKEKRLAEMENTTLAEMRGKGYTECPYWPMGGAQGPMGGPG
FT                   YGKMHR"
FT   sig_peptide     complement(603622..603690)
FT                   /locus_tag="Mthe_0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.687 at
FT                   residue 23"
FT   gene            complement(603795..604862)
FT                   /locus_tag="Mthe_0584"
FT   CDS_pept        complement(603795..604862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0584"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mbu:Mbur_1199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14375"
FT                   /db_xref="GOA:A0B6Q1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q1"
FT                   /protein_id="ABK14375.1"
FT                   /translation="MNRTPRLSIRAAKALWLCILFSLVMSPAAISADDNRSLVLNVYLD
FT                   WTGKALITGYADSLEGLSFLTSSQYSYDNSTSQLYALTNTLTSKAGDAWTLQIHSYGSY
FT                   ERYSMVLFLPGDAMLSSINPSEGLSYLVSSTNQSLAVDLQGYDLMDPSVVVEYRQPLLT
FT                   SSNVSSVNASMQPAKKSQTYFAMAASLVLIACLSAFWILRRRVGMHSRMTSRSEPQEIG
FT                   RQDAPGRESDESLHSDSVCGEDMHEGAQDIDQHAEESPRTPFIPGSEPIEITREMAAVI
FT                   ETLTNRERTVIETLLRKSGRMTQADLRYETGIPKSSLSGILNSLERRKLIKKREWGRTN
FT                   VIEIAEWFVSRKERS"
FT   sig_peptide     complement(604764..604862)
FT                   /locus_tag="Mthe_0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.906 at
FT                   residue 33"
FT   gene            complement(605138..606346)
FT                   /locus_tag="Mthe_0585"
FT   CDS_pept        complement(605138..606346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0585"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   lmf:LMOf2365_0206 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14376"
FT                   /db_xref="GOA:A0B6Q2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q2"
FT                   /protein_id="ABK14376.1"
FT                   /translation="MKLYDLLDLISIGFKADRFKTMMSSLGIIIGVMAIVVMLSVGEGL
FT                   YSGVSSQFSALDLDVIHVSPGRFTFGGPPTRSPEEPAKFTDKDTKLLENIPGVRNVAPQ
FT                   TSTGVIVSFRNTNASATLIGVDPEKEHDLKSKISQGRFLTESDYTSIVIGSGVADGIFR
FT                   MRISPGNRIRIYYEDNYMDLKVVGVLREEESSGMRAGNINTQMYVTHKAMKELLGRENY
FT                   YYGTFQVTVDDPETVDEVVDRIKLDLERYHKDEAYDATTARDMLTSLMSILSMIKYALA
FT                   GIGAISLVVGGIGIANVMMLTVKERIREIGVMKALGATTQDIRIQYLLEAGLLGVVSSI
FT                   IGIVLGIILSFAIGSLAGLPSAIKIQSMLIGLLFGAISTIIAGVYPANKAAMLDPIEAL
FT                   RSE"
FT   gene            complement(606360..607220)
FT                   /locus_tag="Mthe_0586"
FT   CDS_pept        complement(606360..607220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM0949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14377"
FT                   /db_xref="GOA:A0B6Q3"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q3"
FT                   /protein_id="ABK14377.1"
FT                   /translation="MRSLLWIKSLLLIISVACAYIYHMPVNIQSTVDPAVLMPGDEAII
FT                   AIELENGAAEYGAGGESVAGTTAHSALISTPLNATKLKGTDMIDVLTEDYHNLGMIGPT
FT                   DRITIYYKIRASENATRGTHLLDFEVQGGYDSITIHRTIPVKVDPAAVTLTRAEDTTMG
FT                   SINLNVANPRENTVNAVTIIPSARGVRFSPEEYYIGTMDPDEVFTISFKVDPIGQTELN
FT                   APTNLSFVARFKNGETWHESEVYETRYSPPRVEPKRNNLLFAGIAVLLLIPAAYIYRRK
FT                   RLKVQ"
FT   gene            complement(607217..607909)
FT                   /locus_tag="Mthe_0587"
FT   CDS_pept        complement(607217..607909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0587"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: btk:BT9727_4936 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14378"
FT                   /db_xref="GOA:A0B6Q4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q4"
FT                   /protein_id="ABK14378.1"
FT                   /translation="MRVISLSDIRKTYITGDVELPVLKGINLSIDSGDFLALMGPSGSG
FT                   KSTLMNIIGCLDRPTAGTYILLDRDVSRASEEELAMIRRDRIGFIFQAFNLIGRISVLK
FT                   NVELPMMLKGMPRDERRDRALELLKSVGVAHRADFSPLNISGGERQRVAIARALANNPE
FT                   IIIADEPTGNLDLKSTEEVMDILSGLNREGRTIIMVTHNPEITKYCNRVIGMRDGRILD
FT                   QSSMEESS"
FT   gene            608662..609105
FT                   /locus_tag="Mthe_0588"
FT   CDS_pept        608662..609105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14379"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q5"
FT                   /protein_id="ABK14379.1"
FT                   /translation="MKIVACTLMLALVLFLGAAYAEDTAENVTAENVTAEEAIAENVTA
FT                   EAAPLYIADVNIEEGYVEIANDGNASQSLENYTLKIDENEPVTLGAIEVQPASSVKLFL
FT                   GAGENTETEIYLNTTIEFAETGTVSLMDPEGNEVSTFAYPVTE"
FT   sig_peptide     608662..608727
FT                   /locus_tag="Mthe_0588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 22"
FT   gene            609492..610286
FT                   /locus_tag="Mthe_0589"
FT   CDS_pept        609492..610286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0589"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: mba:Mbar_A0263
FT                   di-trans-poly-cis-decaprenylcistransferase; TIGRFAM:
FT                   undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14380"
FT                   /db_xref="GOA:A0B6Q6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q6"
FT                   /protein_id="ABK14380.1"
FT                   /translation="MKCRGLLLSSAYAVYERLLKQQLARGPRVEHVAVIQDGNRRYANR
FT                   HNMPVSNGHRLGAKTTEKISDWCLELGIKHLTVYAFSTENFSRSEPEKRYIFNLITEKL
FT                   LELCSSEKIHKNRVRVRAIGRIDMLPEYLQNAIKEVEAATEGYSQMYLNVALAYGGQYE
FT                   LIDATRAMARDLRAGVIRISDLDEDLVGRYLYPTTETPVPKVDLIIRTGGEIRTSNFLP
FT                   WQANGSECAAYFCAPYWPEFRKIDFLRAIRTAQSYAFRSTGL"
FT   gene            610315..610400
FT                   /pseudo
FT                   /locus_tag="Mthe_R0015"
FT                   /note="tRNA-OTHER1"
FT   tRNA            610315..610400
FT                   /pseudo
FT                   /locus_tag="Mthe_R0015"
FT                   /product="tRNA-OTHER"
FT   gene            610792..611142
FT                   /locus_tag="Mthe_0590"
FT   CDS_pept        610792..611142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0590"
FT                   /product="Nascent polypeptide associated complex NAC"
FT                   /note="TIGRFAM: alpha-NAC related protein; PFAM:
FT                   ubiquitin-associated- domain-containing protein; nascent
FT                   polypeptide-associated complex NAC; KEGG: mma:MM2015
FT                   transcription factor homologous to NACalpha-BTF3"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14381"
FT                   /db_xref="GOA:A0B6Q7"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR005231"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q7"
FT                   /protein_id="ABK14381.1"
FT                   /translation="MFPGLGGRGMSPKKMKGMLKSMGINIDEIEGVEEVVIRTSDREIV
FT                   IKNASVAVMEAQGNRSYQISGDVTELPRVSPSDVELVASQTGASPEEARAALMDCGGDL
FT                   AEAIIKLSSKTS"
FT   gene            complement(611296..612009)
FT                   /locus_tag="Mthe_0591"
FT   CDS_pept        complement(611296..612009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14382"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q8"
FT                   /protein_id="ABK14382.1"
FT                   /translation="MSESVQKSKESGREADELMFIVRGLQSTNNSSAQIIDMLEILEGL
FT                   APFLDKAKVIELKCKNCDSYAPCFFPLEDDYDVIDTHAYCHKKGQPLHHLTFLSIAKCR
FT                   DFSRKAQMELVDLAKRLMEELRYALRDRKIYDHNEFANYPIAFELSQDSDKVTIQLGHM
FT                   SEDGTFVMGDAHVILVRRPDPRLGSKASRIGRALHDSDLVILVEASRSAMRHLGLKDAV
FT                   DKIAASHGIPVIYDP"
FT   gene            612150..613181
FT                   /locus_tag="Mthe_0592"
FT   CDS_pept        612150..613181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0592"
FT                   /product="condensin subunit ScpB"
FT                   /note="TIGRFAM: segregation and condensation protein B;
FT                   PFAM: chromosome segregation and condensation protein ScpB;
FT                   KEGG: mbu:Mbur_1497 chromosome segregation and condensation
FT                   protein ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14383"
FT                   /db_xref="GOA:A0B6Q9"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6Q9"
FT                   /protein_id="ABK14383.1"
FT                   /translation="MDAKALVEAMLFAAGRPLSVEEISGLSGLDAKDVLDAANSLLREY
FT                   ASRGGGIEVRAVEGSFVMQVRGDLAQSVAMVAPRELDSSVIRTLAVIAYRQPIMQSELA
FT                   RIRGNKCYEHVRLLERMGLISASKKGRTRELRTTRGFAEYFGLQSASPEFLRGIIAGKR
FT                   EIIGITPIYESLARRLGIDYVIVNPYRPEDGDIAKLREVHLLIASPGYAEKIRKHYSGE
FT                   IIEIGTSTFSKLKEGVEKLMLMRRDVPGAEALIREVDAALKDYRERAKGLGPVKPLTPI
FT                   ASEIALDMHLDVEERGVTAAADYTGENAEIIIPTHQEGHIDIIERIRQRYDAMLDGLRE
FT                   RHR"
FT   gene            complement(613324..613773)
FT                   /locus_tag="Mthe_0593"
FT   CDS_pept        complement(613324..613773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0593"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: neq:NEQ451 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14384"
FT                   /db_xref="GOA:A0B6R0"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R0"
FT                   /protein_id="ABK14384.1"
FT                   /translation="MLSSLFEMSFQNLGLSMEFSNPQEDLQGRTDAVVLLSMLLRKFGA
FT                   HPAILVVDGEIYLAGVGSIFGCAAGRCAITTTFGLSRGAWMNVVMHEIGHILGLDHCIE
FT                   RCLMQPAMNEEEVERRPFALCEQCFWIAREKQRGPASEYDLHPVP"
FT   gene            complement(613787..614644)
FT                   /locus_tag="Mthe_0594"
FT   CDS_pept        complement(613787..614644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0594"
FT                   /product="ATPases involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: mba:Mbar_A0634 ATP-binding protein involved in
FT                   chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14385"
FT                   /db_xref="GOA:A0B6R1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R1"
FT                   /protein_id="ABK14385.1"
FT                   /translation="MQDRCDMACDRCDARGSCTDEENRMRRIKRKMLVGSGKGGVGKST
FT                   VAAYLAIWLAKRGYSVGLLDADITGPNIPKLLGIEDERLTVGPDGIHPATVGNIKVVSM
FT                   ALILPTSGTSVVWRGPMKMAAIKQFLSDVCWGDLDYLIVDLPPGTSDEPISLVQLIPDL
FT                   DGVVVVTTPQDVAIIDTLKSIDMFRKMNVRIIGMVENMSGLVCPHCGKRVEAFGSGNGE
FT                   VHARDMDVDFLGSVPVDPELSMLYRYLDGIEVSSPGLRSMEAIAFKITRALDTDDREGT
FT                   LQRG"
FT   gene            615381..617615
FT                   /locus_tag="Mthe_0595"
FT   CDS_pept        615381..617615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0595"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: mma:MM3076 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; DNA
FT                   topoisomerase, type IA, zn finger domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14386"
FT                   /db_xref="GOA:A0B6R2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005739"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R2"
FT                   /protein_id="ABK14386.1"
FT                   /translation="MHLIIAEKHDAAKRISEILAGKKPTVTKVSGIDTFRFDDRVVIGL
FT                   SGHIVGLDYPECYNNWHKVDYRDLIRAEIVSRPTQERIVSALRKLGREADRVTIATDYD
FT                   REGELIGVEALCILQEVNPSIKADRVRFSAITKSEILRAFAQPEEVDFNLAASGEARQI
FT                   IDLVWGAALTRFISITSGRLGKEFLSVGRVQSPTLALIVDREKEIESFQPKPYWEIYAD
FT                   LEKGIRVRHSKSRIWTRDEVDRILNSLSDVARVRSISKGERRDRPPTPFDTTSFISAAS
FT                   SIGFTAANAMRIAESLYTNGYISYPRTDNTVYPPSIDLRSLLEMLSSGPFREDALELMK
FT                   GSITPTKGKRSTTDHPPIYPTSVADKDDLKEDQWKIYELVVRRFFATLSGECVWETTSI
FT                   SFDIGDEVFRANGSRILDLGWRRYYPYSRAEENVLPPLREGEGLKVLSHEVLSKETQPP
FT                   ARFGQGRLVKLMDELGLGTKSTRHDIISKLYARAYIHGNPIRPTKTAYAVVDTLQRHAP
FT                   AITKPEMTRTLENDMLKIAERKITKGEVIEESRQMLEAVFDELLAHRKEIEDSLREGLR
FT                   VDRIVGKCRLCGSDLIIRRGRRGARFVGCSGYPECRFTLPLPRGGMIVVTERRCETHDM
FT                   NHIRIINRGKRPWDLGCPYCNFNNWQAKKGSKTQRMPELDDISGIGPKSRERLESAGIK
FT                   TLEALVSTDPASISESTGISIKKIISWQESARSIIHKGEQGGEVPGSSTC"
FT   gene            complement(617778..617852)
FT                   /locus_tag="Mthe_R0016"
FT                   /note="tRNA-Met2"
FT   tRNA            complement(617778..617852)
FT                   /locus_tag="Mthe_R0016"
FT                   /product="tRNA-Met"
FT   gene            complement(618261..619574)
FT                   /locus_tag="Mthe_0596"
FT   CDS_pept        complement(618261..619574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0596"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   mac:MA3288 PmbA/TldD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14387"
FT                   /db_xref="GOA:A0B6R3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R3"
FT                   /protein_id="ABK14387.1"
FT                   /translation="MEFFDTRIVRGRRISIVVDNSKVEEISESIFQGVAVRALVDGAWG
FT                   FVRSDSIEDLERSIERACGIARAIGGREILNLAESERGLSCRVPVKKDPSSVSLEEKVD
FT                   LVREIERAARLPGISSTRVFYTDILTETEYSSSDGASLRSSVTRTGFGISAVAMRSGLL
FT                   QSSSEIRAGVCGLELIEREDPFELARRAARTALDLLDARVPEGGRFPVVLDQELGGVFI
FT                   HEAVGHAAEGDIVLEGGSILQGRVGEQIGSELVTVKDDPSLMHYGHYPFDDEGSAARET
FT                   VLVENGILRSYLHTRETAGRLGGSPRNARAQGYNRPIVRMSNTYLANGDWSLEEIFEEM
FT                   RDGVYLIGSRGGQVNTAEGIFQFNARRGYLVRKGEISELIRDVSLSGQTLSILKGVRAV
FT                   ADDLRFNSGGCGKGGQVVPVGDGAPHILIDEAVVGGAG"
FT   gene            complement(619583..621490)
FT                   /locus_tag="Mthe_0597"
FT   CDS_pept        complement(619583..621490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0597"
FT                   /product="Lon-B peptidase, Serine peptidase, MEROPS family
FT                   S16"
FT                   /note="KEGG: mma:MM0128 ATP-dependent protease La; TIGRFAM:
FT                   peptidase S16, Lon-like protease; PFAM: peptidase S16, lon
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14388"
FT                   /db_xref="GOA:A0B6R4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004663"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R4"
FT                   /protein_id="ABK14388.1"
FT                   /translation="MLSMEEPNELLGSIQFEDTSSITVPESLIDQVIGQEEAVEVIKKA
FT                   AHQRRHVMLIGSPGTGKSMLGKAMSELLPVEELQDILVYHNPEDNNNPRIRVVPAGRGR
FT                   QIVDAHKMEARKKVQTRNMFFMLIVMGLIVYAYYTGQLLFGIIAAALIFLSMRYLIPKE
FT                   DVFIPKLLVDNSGKKTAPFVDATGAHAGALLGDVRHDPFQSGGLETPSHERVECGAIHR
FT                   AHKGVLFIDEINTLRLESQQSLLTALQEGMYPITGQSERSSGALVRTEPVPCSFIMVVA
FT                   GNLDAVQGMHPALRSRIKGYGYEVYMRDTMEDTVENRDKLIRFVAQEVVRDGKIPHFTR
FT                   DAVAEIIREAKRRSGRKGHLTLMLRDLGGLIRVAGDIARSEGAPLTEARHVIEAKKMAR
FT                   SLEQQMADRYLERRKEYSMYKSSGDEVGRVNGLAVIGDSGIVLPIMAEVTPAQSKEEGR
FT                   VIATGRLQEIAKEAVTNVSALIKKLQGEDITTKDVHIQFIGTYEGVEGDSASISIATAV
FT                   VSALEGIPVKQSVAMTGSLSVRGDVLPVGGVTQKIEAAAQAGIKTVLIPKSNMGDVLVD
FT                   ESIRDKIEIIPVSNISEVFEYSLAGQRSKLLEKLRRFATEKKIGISIPDGIPSPAMSIL
FT                   "
FT   gene            621894..622124
FT                   /locus_tag="Mthe_0598"
FT   CDS_pept        621894..622124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0598"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   mac:MA1588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14389"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R5"
FT                   /protein_id="ABK14389.1"
FT                   /translation="MVIGVTMVKVVPGQEKPVYNALRQVDGIKNVYHVFGEFDFVVIIE
FT                   VDGLSTLNRLVDTIREIENVTATQTVVGAEL"
FT   gene            622124..623965
FT                   /locus_tag="Mthe_0599"
FT   CDS_pept        622124..623965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0599"
FT                   /product="DNA topoisomerase VI, B subunit"
FT                   /note="TIGRFAM: DNA topoisomerase VI, B subunit; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   KEGG: mbu:Mbur_1203 DNA topoisomerase VI, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14390"
FT                   /db_xref="GOA:A0B6R6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040494"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R6"
FT                   /protein_id="ABK14390.1"
FT                   /translation="MDIAEELAKQQRSISVAEFFEKNRQILGFDSAPRALITCVKEAVD
FT                   NSLDACEDAGILPDIFVQIKRTGELYRVIVEDNGPGIVPSEIPRVFAMLLYGSRFHVLR
FT                   QSRGQQGIGISAAVLYSQLTSGKPARITSRTSPERPARYVEVMINTAKNEPEIIREKDI
FT                   DWERPRGTRVELEIEGSYVRGRRQSVYSYLKNVAIVNPHARITFVEPDGSTERFERATE
FT                   LLPKRACEIKPHPAGIELGELTKMLRYTERRKLSSFLKESFTSIGNIAAQEVIHNSGLD
FT                   PSMDPRSLNYDQSKRLFEALRRIKIKSPPADCLSPIGEDLIRSGLAKEYKLDFIATVSR
FT                   PVSVYSGNPFVVEAGIGFGGELERSGRVDILRFANRVPLIYQQGACAITHAVEGVSWKS
FT                   YGLDQPGGGLPVGPAVILVHVASTNIPFTSESKDAIADIPEILTEIDLALKEIGRKLRR
FT                   FLALQETLSERREKEEIIGRILPRMADKLADMLGLERPDISMVVARIMGNILVRRDIKQ
FT                   ENGRLRVCIEIENNTSAQRSFKLHEILPLEAEELDPPARRVDMGDRYDYQWRIAIRSGE
FT                   RMVIRYTIKNHLQRMPEAVVEGLEPEIVTGARVLSDV"
FT   gene            623958..625031
FT                   /locus_tag="Mthe_0600"
FT   CDS_pept        623958..625031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0600"
FT                   /product="Spo11/DNA topoisomerase VI, subunit A-like
FT                   protein"
FT                   /note="PFAM: Spo11/DNA topoisomerase VI, subunit A,
FT                   N-terminal domain; KEGG: mbu:Mbur_1202 DNA topoisomerase,
FT                   type IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14391"
FT                   /db_xref="GOA:A0B6R7"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR004085"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R7"
FT                   /protein_id="ABK14391.1"
FT                   /translation="MSDPESRLLSIARSLYDQFREGTVPHLVLPTRTKKNIEYSTKDDV
FT                   WVYGDQESVRSVKTIRGAKTLLKTVHLVDLLVKEHLRGNRASTLREIYYISENWDLAKF
FT                   AEQAESDRLIEDLEIITGLQREEFHVRPEEDGAAVFGPLRIRERTRRGEREIHCQEDIG
FT                   EAGYQIPFNVDFVEFLEHDARMVIAVETGGMYARLIENGFDEEFDAILVHLKGQPARST
FT                   RRFIKRLNTELGLPVAVFTDGDPWSYRIFASVAYGAIKSAHLSEHLATPDARFLGVQPT
FT                   DIVEYNLSTDKLTDRDLHALRAELTDPRFGSDYWQMQIQLQIDLKKKAEQQAFAGKGLD
FT                   FVTKRYLPERLSELGMV"
FT   gene            complement(625094..625945)
FT                   /locus_tag="Mthe_0601"
FT   CDS_pept        complement(625094..625945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0601"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mac:MA4093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14392"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R8"
FT                   /protein_id="ABK14392.1"
FT                   /translation="MDILVRDAMVRDVAYVSLPGTRDKVLKVLNERHVSGVPVVKNCTV
FT                   VGMVTRTDLLRNPEEDQIAMLMTRNPYVVHPEDRLVDAAKLFVEKRVRRLPVVEDERLV
FT                   GIISVADLVKVIASLNIDETIDKYFERNVVVVWAEMPLPVVGAIMEYAGVQACPVIDTD
FT                   LQLVGIITDRDLIAKSVVEESLEKADADTAPEMDEWSWESQKEAISRYYQVSKITLKNV
FT                   KVKEAMVQAITALRSSRVSECARTMSQKRIDQMPVVNAHRKLIGMLNDHNLLLPFISAY
FT                   ER"
FT   gene            complement(625949..626392)
FT                   /locus_tag="Mthe_0602"
FT   CDS_pept        complement(625949..626392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0602"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mba:Mbar_A0825
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14393"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6R9"
FT                   /protein_id="ABK14393.1"
FT                   /translation="MIEKIMIATDGSVTSERAARFGVELARNLGARVIAVYVADTGRLS
FT                   HLPDEMILVGIRDMLLKEGEDATSYVESIASEAGVPCEKRIVEGKPTDEILKLSRDLSV
FT                   DLLVMGSVGRSGLDRFLLGSVAEKVVQHSRVPVLTVPGERKEG"
FT   gene            complement(626397..627545)
FT                   /locus_tag="Mthe_0603"
FT   CDS_pept        complement(626397..627545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0603"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   mac:MA4095 chlorohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14394"
FT                   /db_xref="GOA:A0B6S0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S0"
FT                   /protein_id="ABK14394.1"
FT                   /translation="MRRIDEDVNKLNAPPISKYSGPGSLASASEDAGFQDELILSGTVI
FT                   AGEDMVVLDGYVVIENGVIKEIGEGKERGHLEGIICPAFVNAHTHVADSIAKDPPFMDL
FT                   ADLVGPGGLKHRILESASDDLLVESMRFSVSEMLDTGTCVFGDFREGGSHGVELLLRAI
FT                   EGLGIQSRIFGRPLRAPWDIHPACWGVGLSSTRDYDQSFVDEVVRIARKEGKRIAIHAG
FT                   EAGRDDIDGALALDPDILIHLSRAERSDLRDVAESGASVVVCPRSNLFTRAGLPDVSSM
FT                   LSLGINVCVGTDNIMINSTNIFREMELLSKALVRDDRQVFMMCTINGARALGMDERLGS
FT                   VDPGKEARVMVFDRNSRNMRGSLNPLGSIVRRAEPSDIILRI"
FT   gene            627547..628215
FT                   /locus_tag="Mthe_0604"
FT   CDS_pept        627547..628215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0604"
FT                   /product="2,
FT                   5-diamino-6-(5-phosphoribosylamino)pyrimidin-4(3H)-one
FT                   reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="KEGG: afu:AF2007
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase; TIGRFAM:
FT                   2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase; PFAM: bifunctional deaminase-reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14395"
FT                   /db_xref="GOA:A0B6S1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S1"
FT                   /protein_id="ABK14395.1"
FT                   /translation="MRPYVLINSAMSADGKISSFLRRQVRISGSEDLLRVERLRAESDA
FT                   VMVGLGTVIADDPTLRVKSEALRSWRLERGVPENPLRIVADSRARTPPEARVLGPGCIV
FT                   AVSRYAPEDRLKELSERCEIAICGEDRVDLRELLEMLYRRGVRRLMVEGGGTLNWSLIE
FT                   QGLVDEICVFVGPMVIGGQDAPTLVDGRGFPENFQRLELESAERIDDGLLLKWRVVRSA
FT                   "
FT   gene            complement(628202..628900)
FT                   /locus_tag="Mthe_0605"
FT   CDS_pept        complement(628202..628900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0605"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   mbu:Mbur_0622 protein of unknown function DUF169"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14396"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S2"
FT                   /protein_id="ABK14396.1"
FT                   /translation="MDYAEMSDILKSTLGLDSEPVGVVLFKSEEDIPKDLKEIESPLPY
FT                   CGMVQRARRGEVLFARSDKHACRGGAAGIGLHAFPDNIVQGKLYFSKLNKCATPTVGQR
FT                   IVSNLPKIPAGSTVATLVAPLSKLNMNPDVVIFVGNALQARRIVQAVLYRRGGRMNLDT
FT                   AGIQSFCVDATASPILKGDVNVSLGCDGSAKKTGLTDNDVVVGIPFEMLEDICRVLKER
FT                   HEGWDRFMRS"
FT   gene            629227..629649
FT                   /locus_tag="Mthe_0606"
FT   CDS_pept        629227..629649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0606"
FT                   /product="competence-like protein"
FT                   /note="KEGG: hma:rrnAC2645 competence-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14397"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S3"
FT                   /protein_id="ABK14397.1"
FT                   /translation="MVWITKACLGLAILLVLLASPVYGDGNVSSSETPVRISNVSFVAP
FT                   SPERANLNEEWVKIENIGKIDVDLTGWSISDEQEHTYVFPDGFILRSGASVKVHTGTGN
FT                   NTQEDLYWGRSVPVWNNDGDSATLRDSSGSIIDSKP"
FT   sig_peptide     629227..629319
FT                   /locus_tag="Mthe_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.518 at
FT                   residue 31"
FT   gene            complement(629887..630069)
FT                   /locus_tag="Mthe_0607"
FT   CDS_pept        complement(629887..630069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0607"
FT                   /product="PUA domain containing protein"
FT                   /note="PFAM: PUA domain containing protein; KEGG:
FT                   mbu:Mbur_2206 PUA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14398"
FT                   /db_xref="GOA:A0B6S4"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S4"
FT                   /protein_id="ABK14398.1"
FT                   /translation="MSGANIPKKVVVSDYAVPFVARGGRVFSKLVLRADPDVNPGDEVL
FT                   VLDRNDRVITVAKAY"
FT   gene            complement(630208..630852)
FT                   /locus_tag="Mthe_0608"
FT   CDS_pept        complement(630208..630852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0608"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   chy:CHY_1698 prophage LambdaCh01, nuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14399"
FT                   /db_xref="GOA:A0B6S5"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S5"
FT                   /protein_id="ABK14399.1"
FT                   /translation="MVVVNNKSCHSRSGDVKLLQPAMAILLVFVVGCVTSVPDEFHGTV
FT                   VKVVDGDTFDVEGLGRVRLADVDCPEMDTEAGRAAANYTISWLFGRTVWLDIDDLKGRD
FT                   DYGRWICVVYLDENGAPDPEMNFNRMIVDSGHAVVRDFTDNEFNPADWWNHSSLQPGGG
FT                   CAYVGSVKSNKYHYPDCEWAQKISPVNLICFSSPSEARSKGYTPCRVCKPP"
FT   gene            631003..631593
FT                   /locus_tag="Mthe_0609"
FT   CDS_pept        631003..631593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0609"
FT                   /product="protein of unknown function DUF358"
FT                   /note="PFAM: protein of unknown function DUF358; KEGG:
FT                   mbu:Mbur_0907 protein of unknown function DUF358"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14400"
FT                   /db_xref="GOA:A0B6S6"
FT                   /db_xref="InterPro:IPR007158"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6S6"
FT                   /protein_id="ABK14400.1"
FT                   /translation="MRDFVIVGHIAKTTPDFSLEDLPGTSGRIDVLCRCVNSAFMLSHG
FT                   IRRDVRCHLILMGGPEPKILRFDGSRLRHLNPDERSTAALIKRALSIDASPSWRESTPG
FT                   IYIRKGDLRSLLESLRDEGQRLYYLREDGAPLSESVSDGVFVLGDHTGMTGDEEHLLDS
FT                   MGAETVSIGPLSLHADHCIVIVNWMCDNAALRR"
FT   gene            631714..632685
FT                   /locus_tag="Mthe_0610"
FT   CDS_pept        631714..632685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0610"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mth:MTH1484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14401"
FT                   /db_xref="GOA:A0B6S7"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S7"
FT                   /protein_id="ABK14401.1"
FT                   /translation="MIRTLVVYDSRYGSTEEVARTLSLILGPSDAVKVDEIQPEHRRFE
FT                   LFVLGAPVYKGVISPKLWNFVRESLSWLREKRIALFTTSIDRKDGETNLESLKKILGES
FT                   VLLSRALGGRMCVERLSSNDLLGMESFCKRKGFLFQDIDTLVREEVVEFGLEIKRTRDT
FT                   ISPRMPVNELRRLIDAFLASHNTCTLATGYGSRVRATPLEYLYRNGAMYILSEGGEKFA
FT                   NIVLNERVSVAVYDPYESMRDVAGIQLTGRAGFVEEGSDEYSDVLRQRGISQNIISSLP
FT                   VRLYMIKIMLERAELLCARLKSRGYEITQIYDFPEFGAAGSN"
FT   gene            complement(632748..634001)
FT                   /locus_tag="Mthe_0611"
FT   CDS_pept        complement(632748..634001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0611"
FT                   /product="tRNA(Ile2) 2-agmatinylcytidine synthetase"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; domain of unknown function DUF1743;
FT                   KEGG: mma:MM0445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14402"
FT                   /db_xref="GOA:A0B6S8"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S8"
FT                   /protein_id="ABK14402.1"
FT                   /translation="MLIVGIDDTDSERGFCTTYLAAVLIERLRASGCQTGAPRLVRLNP
FT                   CARYKTRGNAAIAIPVEAEDPEEIGKLALDTLLELSDLSGRNTNPGLVIADRVTAEMRR
FT                   FYRRAVTEILEIEEAKRILSSEGIWHRGFKNQRGLIGALAAVGSEFDDHTYELIAYRRR
FT                   GLWGTPRALDEDSIWNADRATYPATWDTVDYSNRRIVFSPHSPDPVLFGIRGDDPGAIR
FT                   RAFSMIRSEAPERCVMYVTNQGTDAHIIDMSDRDILLHDDRSYRLRGSVAGEPRVIEGG
FT                   HVFFPIDLGERKIECAAFEPTKCFRKIVRSLIPGDLIEVYGSMKSGTLNLEKIDIISLE
FT                   RQRRSRPPLCACGRRMESAGSGKGYRCRRCRTRSMEAEIVEHPRDIEEGLYEVPPSARR
FT                   HLAKPLVRTRNPRAHPSR"
FT   gene            634273..634887
FT                   /locus_tag="Mthe_0612"
FT   CDS_pept        634273..634887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0612"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: mma:MM1257
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14403"
FT                   /db_xref="GOA:A0B6S9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6S9"
FT                   /protein_id="ABK14403.1"
FT                   /translation="MDPVELLDVLGNENRRRILQLLSFRPFYFNEIAKRLDVGPKAVID
FT                   HLGVLEAAGLIECYRDERRRKYFRLARNVVLEVALASHSYGVRVYALSCPSMERESDCR
FT                   DLRAIHEELSALAAEMDRLRMMMADVATRELELRQRAMRAIEECATDEIEEELLFSLLS
FT                   GSSTEEMLAERLKMPPAVVRESLARLESRGLVRFENGSWSI"
FT   gene            634908..637073
FT                   /locus_tag="Mthe_0613"
FT   CDS_pept        634908..637073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0613"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: mma:MM1256 CdcH protein; TIGRFAM: AAA family
FT                   ATPase, CDC48 subfamily; PFAM: AAA ATPase VAT domain
FT                   protein domain protein; AAA ATPase, central domain protein;
FT                   cell division protein 48, CDC48, domain 2; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14404"
FT                   /db_xref="GOA:A0B6T0"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T0"
FT                   /protein_id="ABK14404.1"
FT                   /translation="MNDQIVLRVAEAYHRDAGKSIARISLDVINRLGLKNGDVVEIQGR
FT                   NKVCALAWPGNPGDAPDIIRIDGNLRSNLGVGIDDRVFVRRTEVKPARRVLLAPTRSIR
FT                   LIGGPQYLLRILEGRPVTKGEQIRIEMITNYLMMVVVSTTPPGPVVITRDTVINITSEQ
FT                   IEGFQFRDVTYEDIGGLSREIRAIREMVELPLRHPEVFQKLGITPPKGVLLHGPPGTGK
FT                   TLIARAVASETDATFTAISGPEIMSRYYGESEQRLRQIFEDAQKSAPSIIFIDEIDSIA
FT                   PKREEVLGDLERRVVAQLLSLMDGLTSRGEVIVIAATNRPNALDPALRRGGRFDREVEI
FT                   GIPNKNGRLEILYVHTRGMPLDDSLDLSEIAEMTHGFVGADLASLCKEAAMHTISRILP
FT                   DLDIEEEIPPEILDQLKVSREDFLAAMKKIEPSAMREVLVEIPEVHWSDIGGLEDAKQA
FT                   LREAVEWPIMYPEAFEAVGIRPPRGVLLYGPPGTGKTMIARAVATESGINFISIKGPEL
FT                   MSKWVGESERAVREVFRKAKQAAPALIFFDEIDSIVPARDSGRDSHVTERVVSQLLTEI
FT                   DGLVELKDVVVLAATNRPDLIDPSLLRPGRFDRMIYIQMPDLAARKKIFEIYMRKMPVA
FT                   GDVNIDELAARTDGYTGADIEMICREAGMLALREKIQPGMKRESLLLSQIQVRRDHFER
FT                   AYQNIKPHMPPETLKEYLRIMEMFGSG"
FT   gene            complement(637644..637937)
FT                   /locus_tag="Mthe_0614"
FT   CDS_pept        complement(637644..637937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14405"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T1"
FT                   /protein_id="ABK14405.1"
FT                   /translation="MRKSAIVLLMIVVILCICIWAQSSEKLNTVMPIAHVLEVSKNALS
FT                   QIISIACNLIGEIATRAGEVISELSLEVFKILVKIASDMDTRIQSVLHRPVI"
FT   sig_peptide     complement(637872..637937)
FT                   /locus_tag="Mthe_0614"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.736 at
FT                   residue 22"
FT   gene            639006..639680
FT                   /locus_tag="Mthe_0615"
FT   CDS_pept        639006..639680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14406"
FT                   /db_xref="GOA:A0B6T2"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T2"
FT                   /protein_id="ABK14406.1"
FT                   /translation="MRDRWRSRSWAARYLGSSWAFRPVQPIFESISSQPICPQWSHGVP
FT                   RVALHLLQSIAAGVLSTLRDPGPQFQSAHTSRARRFYHHPEHFLLMRCLIACVMILLVA
FT                   QAVAHPLEASGRVSSISSGDTFMVDGFGIVHLADVRAPDVHTVDGVHSKEFTMERLLNV
FT                   QVFLDIDNVTGYRPDGITECLVYLSNPDGTPDLQRLFNRIIMDAGFANLRDDENEFDPA
FT                   SW"
FT   gene            complement(639708..640499)
FT                   /locus_tag="Mthe_0616"
FT   CDS_pept        complement(639708..640499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14407"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T3"
FT                   /protein_id="ABK14407.1"
FT                   /translation="MPMAEPFVETETCRTKCRWVAKVFEEFNRPRTTVRSLFYHALRRG
FT                   KSDYPICGGFVGEIRVTRPFDESDASRLVKWVTLASELGYIPRDALLEEMPGIHVLTPD
FT                   HRSVADAELWINRSALNPLIWPVCNRYGITLVSVSGARLDDALQDLRIRAEDEELCLLC
FT                   MADLSPSGLSFVTTLRDALSDSGMRVMHIAMTPEQVVRLQIPMVRADKKSIDKQYKEIL
FT                   RGAGLDGRMMAELDALEACYPGGIAGFLESLIREHVERERA"
FT   gene            complement(641559..642362)
FT                   /locus_tag="Mthe_0617"
FT   CDS_pept        complement(641559..642362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0617"
FT                   /product="2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate
FT                   synthase"
FT                   /note="KEGG: mbu:Mbur_2001 predicted
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; TIGRFAM:
FT                   predicted phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14408"
FT                   /db_xref="GOA:A0B6T4"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR010210"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T4"
FT                   /protein_id="ABK14408.1"
FT                   /translation="MSEIGKRVRLERIMDRDSGNTVIIPLDHGISVGPIQGLANLPEMV
FT                   DKVAKGGANAVLQQKGMVRHGHRGYGRDIGLIVHMSASTSLGPDPNNKVQVAMVEEALK
FT                   LGADAVSVHINIGSETEAEQLHFLGMVSERCDFWGMPLVAMMYPRGKNITNPNAPDVVA
FT                   HAARAGAELGADIIKTNYTGSPDSFRDVVAGCPVPVVIAGGPKTATDLEFLQMIEGAMK
FT                   AGARGVAIGRNVFQHRDPTRMTRAICAIVHHGRSAEEAASILSER"
FT   gene            complement(642611..643309)
FT                   /locus_tag="Mthe_0618"
FT   CDS_pept        complement(642611..643309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0618"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   mka:MK0637 SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14409"
FT                   /db_xref="GOA:A0B6T5"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T5"
FT                   /protein_id="ABK14409.1"
FT                   /translation="MDLDRLVLGAELPDGVLIRFRPFSEGDADMIRDVYQHRHYDLLDI
FT                   RPGEVVFDVGAHIGSFALRAAGMVGEDGLVVAVEPERSNYELLRMNSEGMDSIIPLRMA
FT                   LSDFRGTGRLFLAEGTVAHSLVFRRSTSWDEVPVNTMNGLIEELGIGPDVVKIDAEGAA
FT                   LKILSCADRMRCRKIAIAAYHFPAEDLQVAGRLRSMGFMPNIIHVRASVYRSPFAPSVP
FT                   IVMGEWRGNV"
FT   gene            643396..645279
FT                   /locus_tag="Mthe_0619"
FT   CDS_pept        643396..645279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0619"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; acetyl-CoA
FT                   hydrolase/transferase; KEGG: syn:slr1888 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14410"
FT                   /db_xref="GOA:A0B6T6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T6"
FT                   /protein_id="ABK14410.1"
FT                   /translation="MEIMEHYYSDLRAQWPEKFVSLERAFSHIHAGDRIFIGTGCGEPQ
FT                   FLVQALADYVREHPKAFFDTEILHVWTLGAAPYTDIKFRENFRLNTFFIGRSTRDAVNK
FT                   ELADYTPIFFSAIPDLIYRGRIPIDVALIQTTPPDRHGYLNLGISVDIVKAAVEKASVV
FT                   IAQINSNMPRVQGDGFIHMDDVSFVIPHDEPLLEYMESVPTELAQQIGRYVARIVEDGS
FT                   TIEAGYGMIPNAVLANLKHKKHLGIHTSLLTDGFIELMKVGAVDNSMKSIDRYKTIASF
FT                   CMGTRKTYEYIHDNPAIEFKTIDYTNNPLIIAKNRNMVSINSAMEVDLTGQATAESLGT
FT                   FFHSGIGGQADFMRGAVLSPGGKAILALPSTAENGRISRIVPMLREGAGVTLTRGDLHY
FT                   VVTEYGIAYLHGKNVRERAMDLIALAHPKFRPWLLEEAKRLSLIYADQEFVPGEKGEYP
FT                   EHLETYRTTKTGINILLRPVKITDEPLLKDFFYSLSDETMYQRFASARKGMSHKQLQDF
FT                   VVIDYTREMVILAVIEEDDKEEVIGLGQYSIAEGTHTAEVAIVVRDDYQRKGVGMEILS
FT                   YLVYLARKQGLFYLNAEVLVENQAVLRMFERLNLRTERKLEEGVYSVKIYL"
FT   gene            complement(645378..646388)
FT                   /locus_tag="Mthe_0620"
FT   CDS_pept        complement(645378..646388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0620"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: SpoVT/AbrB domain protein; PhoU family
FT                   protein; KEGG: mac:MA1380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14411"
FT                   /db_xref="GOA:A0B6T7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T7"
FT                   /protein_id="ABK14411.1"
FT                   /translation="METRKVQRTGKSTFIVSLPKGWVVRSGIKPGSIVYITQGESGELV
FT                   LSPERTSQSLKVKLDIGEKSGEALIRDIIGCYLSGYRTIEVVSPYMTPEQKRDIHQIVS
FT                   KLIGPEILEETGNKVLIQDLLNSDELQSDRALRRLRTVVKSMIQDAIDSLIGMKKRLAQ
FT                   DVIQRDDDVDRLNLLVSRQFIEMLRTGALSQSSLDVITAFNYALAASNLERIADHAHSI
FT                   ANLVIEHSMSVPDDMALELTRISSIICGLIDEAISALLHRNTEIANSIIEQTKEIRREA
FT                   MRSFEPVISSSSTGVNQEEILMRMVISSSIARFLDHIKNIGEFTINMTHAQLRKS"
FT   gene            complement(646394..647074)
FT                   /locus_tag="Mthe_0621"
FT   CDS_pept        complement(646394..647074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0621"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   mta:Moth_0115 phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14412"
FT                   /db_xref="GOA:A0B6T8"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T8"
FT                   /protein_id="ABK14412.1"
FT                   /translation="MTLGWGVVSPYRERYHRDLNALRAMTRELSDLVSSSIERSVEALC
FT                   RNDAILAREVVQGDYAVDDLSVKLESKCMELLALQQPMAKDLRMIIGILKIGIDLERAG
FT                   DLAVDIARVVIQTKDKNRMEMPDGLSKMAGIAVEMLSGAMEALEKGDPDMARNVTRHDY
FT                   VIDSLYVKVRDVLMRMTAEDMNLMDQTIPLLMVNRHIERIGDHICNICESIVYMIEGKR
FT                   EHLN"
FT   gene            complement(647071..647880)
FT                   /locus_tag="Mthe_0622"
FT   CDS_pept        complement(647071..647880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0622"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="KEGG: mba:Mbar_A1781 phosphate ABC transporter,
FT                   ATP-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14413"
FT                   /db_xref="GOA:A0B6T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6T9"
FT                   /protein_id="ABK14413.1"
FT                   /translation="MSNAVSVPVPLSMSRGRQEVSCLFKIESRNLSLWYGSKQALKSIT
FT                   LGIPENKITALIGPSGCGKSTFIRCINRMNDLIPGVRIEGEILYDGKNIYDRDTDVVAL
FT                   RKKIGMVFQKPNPFPMSIYDNIAYGPRIHGYKNIDRIVEQSLRDAALWEEVEDRLDQPA
FT                   MGLSGGQQQRLCIARALAMRPEVILFDEPCSALDPISTARIEELMESLRGKYTQIIVTH
FT                   NMQQAARVSDYTAYFYMGEMIEFGETKQIFENPRERSTEDYITGRFG"
FT   gene            complement(648202..649506)
FT                   /locus_tag="Mthe_0623"
FT   CDS_pept        complement(648202..649506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0623"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="KEGG: mba:Mbar_A3173 aspartyl-tRNA synthetase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA synthetase,
FT                   class II (D, K and N); nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14414"
FT                   /db_xref="GOA:A0B6U0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6U0"
FT                   /protein_id="ABK14414.1"
FT                   /translation="MILRTHYSGEIRPEMDGSEVTLAGHVHEIRDLGGICFLVLRDREG
FT                   LAQVTVLTKRADRKLVETVRGVSRESVVLVRGRVKAEPKAPNGFEILPEAVEVLSRADS
FT                   PLPLDPTGKVGAELDTRLDARFLDLRRPASMAVFKIESAVMRSLRNTFYEKGFIEVCTP
FT                   KIVATATEGGTALFPISYFEREAFLNQSPQLYKQILMATGLDRVFEIGPIFRAEEHDTR
FT                   RHLNEAISVDVEVSYADHEDVMSLLENAVSSAYRYVSEICEKELQILGVDLDIPKTPFR
FT                   RITYTEALEMASESGRKSMEWGDDIDTETEHYLGSLIGEHYFLTDWPSSVKPYYTQPYE
FT                   DKPEICKGFDLMHPSMELASGAQRVHDYELLISRIKEKGLNPESFEFYLKPFRYGMPPH
FT                   AGWGLGLARLVQTMLGLENIRDAVLFPRDRRRLVP"
FT   gene            complement(649568..650218)
FT                   /locus_tag="Mthe_0624"
FT   CDS_pept        complement(649568..650218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0624"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   mbu:Mbur_0184 protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14415"
FT                   /db_xref="GOA:A0B6U1"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6U1"
FT                   /protein_id="ABK14415.1"
FT                   /translation="MQMRFEEWDRIYKRILADFSFSRSRDEEAARVLSSLLDSIDQITL
FT                   DELKDAVRGRDVVVCGNAPRLRDEIGGITPSDVVLAADGATSVLLEHDVIPDIIVTDLD
FT                   GCMPDIIDANRRGSAVVVHAHGDNIDKLKEHVPHLRRVLGTTQASPLENVHNFGGFTDG
FT                   DRAVFLALEFMPKSIRLIGFDFDDENVTPRKSKKLRWAKVLLEIALGPGCTDP"
FT   gene            complement(650321..651355)
FT                   /locus_tag="Mthe_0625"
FT   CDS_pept        complement(650321..651355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14416"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6U2"
FT                   /protein_id="ABK14416.1"
FT                   /translation="MKRVIILLLAVMVFIGLSAGAGLSNDLRPPGYELKKDAEGEEYPR
FT                   YPYEVAEKNVTFNFEQDVQGSGYFMTYRYAKAGALAFKDYVHGSGSIDNEFVMFTQELD
FT                   KNTHPIDADWVDEDVSCISVKEDNVMVYSPYQFAIGAGYYAVNPLVFDSLLKEKTWIKN
FT                   YRAGTSMHHEVEYAHGIDKELEVLAKEKYFHQYDPVYEGVGYTQMKINEHVDNGKVHFG
FT                   VLQASSDYTANATAPAYPGTALTGSALSDIRAYKNPAIEIDEDYFGTYDITKNMTLNVP
FT                   YKITQKSEDWLPCCSGGWADIPAALKRGFGSSAEGIFDCSCLAKARAGMYGPTDVNPPF
FT                   KAWA"
FT   sig_peptide     complement(651290..651355)
FT                   /locus_tag="Mthe_0625"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.632 at
FT                   residue 22"
FT   gene            complement(651591..652646)
FT                   /locus_tag="Mthe_0626"
FT   CDS_pept        complement(651591..652646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0626"
FT                   /product="cell division protein pelota"
FT                   /note="TIGRFAM: putative translation factor pelota; PFAM:
FT                   eRF1 domain 1; eRF1 domain 2 protein; eRF1 domain 3
FT                   protein; KEGG: mac:MA0652 cell division protein pelota"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14417"
FT                   /db_xref="GOA:A0B6U3"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0B6U3"
FT                   /protein_id="ABK14417.1"
FT                   /translation="MMVFMRVIKRNLRGDEGEISLVAESLDDLWHLKHLVSPGDLVFAT
FT                   TQRKISGATDKLRPEKAERRTVRLGISVEAVEFHTYSNWLRIHGVIKSGVDIGSYHTLN
FT                   IEAGSELSIIKRWRPDELQRIEEAVAESNRPRVVLALVEEGEATIGVLRQFGVQTVAEI
FT                   RGGSGKGSGSSVRDDFLKEVADQIANSAGDDAYVVLAGPGFTKEDLRKVMEARYPDLLK
FT                   RLTMDDASSTGRSGFQEVLRRGTVDRIVEASRISRETRLMDDLMKEIATDGRAAYGIRE
FT                   VREAANYGAIETLMIVDQLVRRGDVESLIRDVAAGRGRVVIFSTEFEPGERLEALGGVA
FT                   ALLRFRIPGAS"
FT   gene            complement(652752..653057)
FT                   /locus_tag="Mthe_0627"
FT   CDS_pept        complement(652752..653057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14418"
FT                   /db_xref="GOA:A0B6U4"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6U4"
FT                   /protein_id="ABK14418.1"
FT                   /translation="MPEFATPFAGMASDRKLTKQELVRAIRYVIAAEYEAIQLYTQLAE
FT                   STDDECARAVLIDIADEEVVHAGEFLRLLKELEPREEELYKEGYEEVEEILEKLRK"
FT   gene            653848..654489
FT                   /locus_tag="Mthe_0628"
FT   CDS_pept        653848..654489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0628"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pab:PAB1224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14419"
FT                   /db_xref="GOA:A0B6U5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0B6U5"
FT                   /protein_id="ABK14419.1"
FT                   /translation="MPEVISFDMDGTLVSPKYVDRVWMEGIPELYAKRHGVELDNAKEI
FT                   VIGEYLKIGSDRLEWYDLGYWLEKFDLKIDKYELLEMYRSEIEVYPEVEEVLDSLRDAG
FT                   YELVVTSNAAREFIEMELDGLMDRFSRVFSVTSDFRDVKKSPRSYILVCRALGRKPLEV
FT                   LHIGDHYVYDYEAPIEAGLDALFLDRMGNRSGPEVVVDLREAADRILNGM"
FT   gene            654526..655230
FT                   /locus_tag="Mthe_0629"
FT   CDS_pept        654526..655230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mthe_0629"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: mbu:Mbur_1000 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mthe_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABK14420"
FT                   /db_xref="GOA:A0B6U6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="UniProtKB/TrEMBL: